F462716

General Info

Members Datasets Scaffolds Average Seq Length
552 345 1104 214

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10183464|Ga0105240_101834642
Length 244
Sequence MQPVAATGCFSSYENERVLSITTSISRIDMPAKLQTLRTIDESGAILIVRLPDADTAEHVAHAAVEGGFRALEITLSIPGAVDLIRRLAHRYDSEGVAVGAGTVLDGHAAYECIRAGARFLVSPQLNREMIRVANRYQVPTVSGAFTPTELLESAEEGADILKLFPTENAGIPYAKAVLAPFAHLPIMPAGGVTVENVAEWFAAGVAGVGVGSAVTKAWQPDGDYGRVTTAARDFLTAVRDARR

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
204 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
215 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
216 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
217 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
218 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
219 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
220 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
221 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
222 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
225 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
226 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
227 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
228 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
229 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
230 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
231 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
232 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
233 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
234 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
235 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
236 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
237 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
238 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
253 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
279 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
324 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
325 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
326 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
327 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
328 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
331 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
333 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
334 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
335 2862574272 Streptomyces sp. AcE210 Isolate Nodule
336 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
337 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
338 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
339 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
340 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
341 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
342 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
343 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
344 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
345 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0.36
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 3.8
Nodule 0.18
Rhizoplane 8.33
Rhizosphere 81.34
Stem 0
Stem Tuber 0
Unclassified 3.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10183464 3300009093 Bacteria 2467
2 JGI24735J21928_10030140 3300002067 Bacteria 1612
3 JGI24750J21931_1002302 3300002070 Bacteria 2306
4 JGI24738J21930_10000712 3300002075 Bacteria 9586
5 JGI24749J21850_1014325 3300002076 Bacteria 1112
6 JGI25152J39213_1000086 3300002773 Bacteria 64446
7 Ga0055539_1000019 3300003752 Bacteria 341727
8 Ga0055539_1015281 3300003752 Bacteria 933
9 Ga0055533_1000023 3300003756 Bacteria 341727
10 Ga0055525_1000125 3300003759 Bacteria 115822
11 Ga0065712_10085108 3300005290 Unclassified 2719
12 Ga0065715_10108157 3300005293 Bacteria 2733
13 Ga0065715_10238647 3300005293 Unclassified 1207
14 Ga0065707_10089282 3300005295 Unclassified 4401
15 Ga0070658_10067747 3300005327 Bacteria 2917
16 Ga0070658_10221513 3300005327 Unclassified 1600
17 Ga0070658_10237448 3300005327 Bacteria 1544
18 Ga0070676_10016108 3300005328 Bacteria 4130
19 Ga0070670_100084417 3300005331 Bacteria 2728
20 Ga0070670_100282174 3300005331 Bacteria 1450
21 Ga0070677_10277341 3300005333 Bacteria 843
22 Ga0068869_100006656 3300005334 Bacteria 7339
23 Ga0070666_10049746 3300005335 Bacteria 2818
24 Ga0070680_100238203 3300005336 Bacteria 1538
25 Ga0070682_100023279 3300005337 Bacteria 3677
26 Ga0068868_100064077 3300005338 Bacteria 2917
27 Ga0070660_100079204 3300005339 Bacteria 2577
28 Ga0070660_100550499 3300005339 Bacteria 962
29 Ga0070660_100559547 3300005339 Unclassified 954
30 Ga0070689_100046119 3300005340 Bacteria 3357
31 Ga0070691_10009250 3300005341 Bacteria 4502
32 Ga0070661_100032531 3300005344 Bacteria 3776
33 Ga0070661_100075981 3300005344 Bacteria 2476
34 Ga0070668_100026680 3300005347 Bacteria 4384
35 Ga0070668_100044930 3300005347 Bacteria 3389
36 Ga0070668_100244560 3300005347 Bacteria 1487
37 Ga0070669_100003650 3300005353 Bacteria 11099
38 Ga0070669_100006384 3300005353 Bacteria 8492
39 Ga0070669_100048009 3300005353 Bacteria 3116
40 Ga0070669_100197979 3300005353 Bacteria 1579
41 Ga0070675_100039191 3300005354 Bacteria 3865
42 Ga0070675_100292251 3300005354 Bacteria 1434
43 Ga0070675_100396710 3300005354 Bacteria 1230
44 Ga0070675_100773088 3300005354 Bacteria 877
45 Ga0070671_100080203 3300005355 Bacteria 2728
46 Ga0070671_100394395 3300005355 Bacteria 1184
47 Ga0070674_100016669 3300005356 Bacteria 4609
48 Ga0070673_100038615 3300005364 Bacteria 3647
49 Ga0070673_100868723 3300005364 Unclassified 835
50 Ga0070688_100025111 3300005365 Bacteria 3525
51 Ga0070688_100153735 3300005365 Bacteria 1575
52 Ga0070659_100027240 3300005366 Bacteria 4401
53 Ga0070659_100082945 3300005366 Bacteria 2561
54 Ga0070703_10008591 3300005406 Bacteria 2873
55 Ga0070709_10025856 3300005434 Bacteria 3471
56 Ga0070714_100124797 3300005435 Bacteria 2294
57 Ga0070714_100360678 3300005435 Bacteria 1366
58 Ga0070714_100488872 3300005435 Bacteria 1173
59 Ga0070710_10013108 3300005437 Bacteria 4139
60 Ga0070710_10267295 3300005437 Bacteria 1105
61 Ga0070701_10005876 3300005438 Bacteria 5119
62 Ga0070711_100197956 3300005439 Bacteria 1548
63 Ga0070711_100824916 3300005439 Bacteria 788
64 Ga0070705_100100879 3300005440 Bacteria 1822
65 Ga0070700_100011950 3300005441 Bacteria 4824
66 Ga0070694_100003281 3300005444 Bacteria 9667
67 Ga0070663_100180580 3300005455 Bacteria 1637
68 Ga0070678_100050863 3300005456 Bacteria 3000
69 Ga0070662_100433763 3300005457 Bacteria 1088
70 Ga0070681_10374425 3300005458 Bacteria 1334
71 Ga0068867_100026017 3300005459 Bacteria 4198
72 Ga0070685_10099453 3300005466 Bacteria 1774
73 Ga0070698_100092183 3300005471 Bacteria 3011
74 Ga0070684_100589221 3300005535 Bacteria 1033
75 Ga0070697_100811177 3300005536 Bacteria 828
76 Ga0068853_100058954 3300005539 Bacteria 3315
77 Ga0070672_100032676 3300005543 Bacteria 3930
78 Ga0070672_100315792 3300005543 Bacteria 1327
79 Ga0070695_100177869 3300005545 Bacteria 1505
80 Ga0070696_100021763 3300005546 Bacteria 4350
81 Ga0070693_100024055 3300005547 Bacteria 3263
82 Ga0068855_100049685 3300005563 Bacteria 4945
83 Ga0068855_100436959 3300005563 Bacteria 1430
84 Ga0068855_100441176 3300005563 Bacteria 1422
85 Ga0070664_100047867 3300005564 Bacteria 3614
86 Ga0070664_100240081 3300005564 Bacteria 1626
87 Ga0070664_100332284 3300005564 Unclassified 1379
88 Ga0068857_100058869 3300005577 Unclassified 3412
89 Ga0068857_100550353 3300005577 Bacteria 1087
90 Ga0068854_100002719 3300005578 Bacteria 10969
91 Ga0068856_100146730 3300005614 Bacteria 2367
92 Ga0068856_100457968 3300005614 Bacteria 1296
93 Ga0070702_100070573 3300005615 Bacteria 2062
94 Ga0068852_100234848 3300005616 Bacteria 1750
95 Ga0068852_100267606 3300005616 Bacteria 1643
96 Ga0068852_100781024 3300005616 Bacteria 968
97 Ga0068859_100086101 3300005617 Bacteria 3188
98 Ga0068859_100307553 3300005617 Bacteria 1678
99 Ga0068859_100437886 3300005617 Bacteria 1403
100 Ga0068864_100321158 3300005618 Bacteria 1454
101 Ga0068866_10014308 3300005718 Bacteria 3500
102 Ga0068861_100021740 3300005719 Bacteria 4613
103 Ga0068851_10145972 3300005834 Bacteria 1290
104 Ga0068870_10012162 3300005840 Bacteria 4014
105 Ga0068870_10079815 3300005840 Bacteria 1806
106 Ga0068870_10310146 3300005840 Bacteria 999
107 Ga0068858_100473322 3300005842 Bacteria 1208
108 Ga0068860_100088749 3300005843 Bacteria 2943
109 Ga0068860_100258569 3300005843 Bacteria 1696
110 Ga0068860_100440851 3300005843 Bacteria 1294
111 Ga0068862_100008592 3300005844 Bacteria 8450
112 Ga0068862_100011477 3300005844 Bacteria 7313
113 Ga0081455_10003292 3300005937 Bacteria 18688
114 Ga0081539_10000146 3300005985 Bacteria 164571
115 Ga0070717_10012367 3300006028 Bacteria 6505
116 Ga0075365_10302404 3300006038 Bacteria 1126
117 Ga0070715_10009503 3300006163 Bacteria 3431
118 Ga0070716_100020292 3300006173 Bacteria 3487
119 Ga0070716_100331070 3300006173 Bacteria 1071
120 Ga0070712_100038645 3300006175 Bacteria 3262
121 Ga0075369_10030999 3300006186 Bacteria 2254
122 Ga0097621_100026176 3300006237 Bacteria 4573
123 Ga0097621_100026993 3300006237 Bacteria 4511
124 Ga0068871_100068420 3300006358 Bacteria 2916
125 Ga0075428_100002074 3300006844 Bacteria 21622
126 Ga0075428_100012216 3300006844 Bacteria 9549
127 Ga0075431_100014252 3300006847 Bacteria 8039
128 Ga0075433_10111473 3300006852 Unclassified 2427
129 Ga0075434_100000491 3300006871 Bacteria 29807
130 Ga0075434_100009513 3300006871 Bacteria 9067
131 Ga0075434_100175671 3300006871 Archaea 2162
132 Ga0075429_100512582 3300006880 Bacteria 1051
133 Ga0068865_100006303 3300006881 Bacteria 7227
134 Ga0097620_100086101 3300006931 Bacteria 3188
135 Ga0097620_100307566 3300006931 Bacteria 1678
136 Ga0097620_100437896 3300006931 Bacteria 1403
137 Ga0075435_100711666 3300007076 Archaea 873
138 Ga0105251_10176017 3300009011 Bacteria 964
139 Ga0105251_10259551 3300009011 Bacteria 784
140 Ga0105244_10015081 3300009036 Bacteria 4442
141 Ga0105244_10193645 3300009036 Bacteria 960
142 Ga0105244_10261282 3300009036 Bacteria 806
143 Ga0105240_10086275 3300009093 Bacteria 3844
144 Ga0105240_10305562 3300009093 Bacteria 1818
145 Ga0111539_10002888 3300009094 Bacteria 22812
146 Ga0111539_10043526 3300009094 Bacteria 5381
147 Ga0111539_10255212 3300009094 Bacteria 2042
148 Ga0105245_10224033 3300009098 Bacteria 1816
149 Ga0105245_10460679 3300009098 Bacteria 1282
150 Ga0105245_10739504 3300009098 Bacteria 1019
151 Ga0105247_10022380 3300009101 Bacteria 3807
152 Ga0105247_10101882 3300009101 Bacteria 1836
153 Ga0114129_10001828 3300009147 Bacteria 28970
154 Ga0114129_10288920 3300009147 Unclassified 2189
155 Ga0114129_11061795 3300009147 Bacteria 1016
156 Ga0105243_10019572 3300009148 Bacteria 5131
157 Ga0105243_10301455 3300009148 Bacteria 1452
158 Ga0105241_10164314 3300009174 Bacteria 1828
159 Ga0105241_10330320 3300009174 Bacteria 1318
160 Ga0105241_10474285 3300009174 Bacteria 1111
161 Ga0105242_10053312 3300009176 Bacteria 3302
162 Ga0105242_10198160 3300009176 Bacteria 1782
163 Ga0105248_10212588 3300009177 Bacteria 2179
164 Ga0105248_10850946 3300009177 Bacteria 1029
165 Ga0105237_10069390 3300009545 Bacteria 3520
166 Ga0105238_10427267 3300009551 Unclassified 1320
167 Ga0105238_10484865 3300009551 Bacteria 1236
168 Ga0105249_10001093 3300009553 Bacteria 24114
169 Ga0105249_10040989 3300009553 Bacteria 4207
170 Ga0105249_10920018 3300009553 Bacteria 942
171 Ga0105239_10069225 3300010375 Bacteria 3878
172 Ga0105246_10000458 3300011119 Bacteria 21880
173 Ga0105246_10001554 3300011119 Bacteria 13638
174 Ga0105246_10065823 3300011119 Bacteria 2535
175 Ga0157371_10257659 3300013102 Bacteria 1257
176 Ga0157370_10014780 3300013104 Bacteria 7967
177 Ga0157378_10154497 3300013297 Bacteria 2140
178 Ga0163162_10411833 3300013306 Bacteria 1484
179 Ga0157372_10030863 3300013307 Bacteria 5864
180 Ga0157372_10325875 3300013307 Bacteria 1788
181 Ga0157372_10399386 3300013307 Bacteria 1602
182 Ga0157375_10080399 3300013308 Bacteria 3297
183 Ga0157375_11513777 3300013308 Bacteria 792
184 Ga0163163_10073694 3300014325 Bacteria 3405
185 Ga0157380_10130943 3300014326 Bacteria 2140
186 Ga0157380_10652230 3300014326 Bacteria 1050
187 Ga0182008_10252865 3300014497 Bacteria 909
188 Ga0157377_10116111 3300014745 Bacteria 1616
189 Ga0157379_10134202 3300014968 Bacteria 2229
190 Ga0157379_10345112 3300014968 Bacteria 1362
191 Ga0157379_10404237 3300014968 Bacteria 1256
192 Ga0157376_10158512 3300014969 Bacteria 2049
193 Ga0163161_10022367 3300017792 Bacteria 4452
194 Ga0206356_11411687 3300020070 Bacteria 850
195 Ga0206353_11854190 3300020082 Bacteria 13264
196 Ga0209566_100031 3300025225 Bacteria 341555
197 Ga0209674_100001 3300025226 Bacteria 4013750
198 Ga0209563_100001 3300025230 Bacteria 4013775
199 Ga0209677_100001 3300025253 Bacteria 4013787
200 Ga0209677_100144 3300025253 Bacteria 65856
201 Ga0209129_1000100 3300025258 Bacteria 162353
202 Ga0209025_1001942 3300025294 Bacteria 23851
203 Ga0207697_10089260 3300025315 Bacteria 1305
204 Ga0207656_10157298 3300025321 Bacteria 1079
205 Ga0207655_1012170 3300025728 Bacteria 5052
206 Ga0207655_1028193 3300025728 Bacteria 2654
207 Ga0207655_1064746 3300025728 Bacteria 1392
208 Ga0207692_10012187 3300025898 Bacteria 3685
209 Ga0207642_10015696 3300025899 Bacteria 2831
210 Ga0207642_10192493 3300025899 Bacteria 1120
211 Ga0207710_10031975 3300025900 Bacteria 2304
212 Ga0207688_10001484 3300025901 Bacteria 12299
213 Ga0207688_10003631 3300025901 Bacteria 8422
214 Ga0207688_10131697 3300025901 Bacteria 1466
215 Ga0207680_10063544 3300025903 Bacteria 2260
216 Ga0207647_10014720 3300025904 Bacteria 5387
217 Ga0207647_10057883 3300025904 Bacteria 2375
218 Ga0207699_10031654 3300025906 Bacteria 2972
219 Ga0207699_10626041 3300025906 Bacteria 785
220 Ga0207645_10000915 3300025907 Bacteria 24508
221 Ga0207645_10027946 3300025907 Bacteria 3641
222 Ga0207643_10035587 3300025908 Bacteria 2792
223 Ga0207643_10049008 3300025908 Bacteria 2393
224 Ga0207643_10056580 3300025908 Bacteria 2231
225 Ga0207705_10008446 3300025909 Bacteria 7518
226 Ga0207705_10068411 3300025909 Bacteria 2571
227 Ga0207654_10050889 3300025911 Bacteria 2382
228 Ga0207654_10704168 3300025911 Bacteria 726
229 Ga0207695_10121743 3300025913 Bacteria 2576
230 Ga0207693_10012201 3300025915 Bacteria 6942
231 Ga0207662_10024976 3300025918 Bacteria 3439
232 Ga0207662_10334291 3300025918 Bacteria 1014
233 Ga0207657_10034444 3300025919 Bacteria 4553
234 Ga0207657_10044324 3300025919 Bacteria 3911
235 Ga0207649_10351217 3300025920 Bacteria 1091
236 Ga0207681_10007893 3300025923 Bacteria 6508
237 Ga0207681_10109424 3300025923 Bacteria 2007
238 Ga0207694_10053901 3300025924 Bacteria 3119
239 Ga0207694_10525594 3300025924 Bacteria 992
240 Ga0207650_10052490 3300025925 Bacteria 3020
241 Ga0207650_10116094 3300025925 Bacteria 2078
242 Ga0207650_10142788 3300025925 Bacteria 1883
243 Ga0207650_10347693 3300025925 Bacteria 1219
244 Ga0207659_10280808 3300025926 Bacteria 1361
245 Ga0207659_10351074 3300025926 Bacteria 1224
246 Ga0207687_10412390 3300025927 Bacteria 1113
247 Ga0207664_10185701 3300025929 Bacteria 1787
248 Ga0207664_10200601 3300025929 Bacteria 1722
249 Ga0207706_10008044 3300025933 Bacteria 9732
250 Ga0207706_10022049 3300025933 Bacteria 5716
251 Ga0207709_10288286 3300025935 Bacteria 1216
252 Ga0207709_10358604 3300025935 Bacteria 1103
253 Ga0207670_10223674 3300025936 Bacteria 1442
254 Ga0207669_10037800 3300025937 Bacteria 2773
255 Ga0207704_10504872 3300025938 Bacteria 975
256 Ga0207665_10007264 3300025939 Bacteria 7329
257 Ga0207691_10060425 3300025940 Bacteria 3443
258 Ga0207691_10244221 3300025940 Bacteria 1551
259 Ga0207691_10320547 3300025940 Bacteria 1329
260 Ga0207691_10794476 3300025940 Bacteria 795
261 Ga0207711_10062410 3300025941 Bacteria 3215
262 Ga0207689_10004109 3300025942 Bacteria 13238
263 Ga0207689_10097700 3300025942 Bacteria 2412
264 Ga0207661_10043141 3300025944 Bacteria 3558
265 Ga0207679_10020829 3300025945 Bacteria 4433
266 Ga0207667_10130044 3300025949 Bacteria 2593
267 Ga0207651_10155675 3300025960 Bacteria 1785
268 Ga0207651_10640885 3300025960 Unclassified 932
269 Ga0207712_10026239 3300025961 Unclassified 3879
270 Ga0207712_10031026 3300025961 Bacteria 3597
271 Ga0207712_10060811 3300025961 Bacteria 2679
272 Ga0207668_10056429 3300025972 Bacteria 2735
273 Ga0207668_10721245 3300025972 Bacteria 878
274 Ga0207668_10753697 3300025972 Bacteria 859
275 Ga0207640_10002293 3300025981 Bacteria 10282
276 Ga0207658_10014035 3300025986 Bacteria 5483
277 Ga0207658_10077330 3300025986 Bacteria 2539
278 Ga0207658_10324269 3300025986 Bacteria 1334
279 Ga0207677_10061881 3300026023 Bacteria 2594
280 Ga0207703_10657794 3300026035 Bacteria 994
281 Ga0207703_10661372 3300026035 Bacteria 991
282 Ga0207639_10083556 3300026041 Bacteria 2534
283 Ga0207678_10022095 3300026067 Bacteria 5575
284 Ga0207678_10341259 3300026067 Bacteria 1291
285 Ga0207708_10020605 3300026075 Bacteria 4973
286 Ga0207708_10045380 3300026075 Bacteria 3349
287 Ga0207702_10335933 3300026078 Bacteria 1442
288 Ga0207641_10072934 3300026088 Bacteria 2958
289 Ga0207648_10007048 3300026089 Bacteria 11108
290 Ga0207648_10049381 3300026089 Bacteria 3681
291 Ga0207676_10098250 3300026095 Bacteria 2420
292 Ga0207676_10521141 3300026095 Bacteria 1131
293 Ga0207674_10078376 3300026116 Bacteria 3309
294 Ga0207674_10130962 3300026116 Bacteria 2471
295 Ga0207675_100006239 3300026118 Bacteria 11314
296 Ga0207675_100072003 3300026118 Bacteria 3232
297 Ga0207683_10074178 3300026121 Bacteria 3010
298 Ga0207683_11047659 3300026121 Bacteria 757
299 Ga0209974_10176666 3300027876 Bacteria 780
300 Ga0207428_10005592 3300027907 Bacteria 11691
301 Ga0207428_10027671 3300027907 Bacteria 4719
302 Ga0268266_10496710 3300028379 Bacteria 1164
303 Ga0268265_10091953 3300028380 Unclassified 2427
304 Ga0268265_10146890 3300028380 Bacteria 1982
305 Ga0268265_10169498 3300028380 Bacteria 1864
306 Ga0268264_10115711 3300028381 Bacteria 2356
307 Ga0307517_10004236 3300028786 Bacteria 22122
308 Ga0307515_10000279 3300028794 Bacteria 125422
309 Ga0307511_10036064 3300030521 Bacteria 4302
310 Ga0265330_10097548 3300031235 Bacteria 1259
311 Ga0265332_10060676 3300031238 Bacteria 1618
312 Ga0307509_10004313 3300031507 Bacteria 20665
313 Ga0307509_10012105 3300031507 Bacteria 10352
314 Ga0307408_100020293 3300031548 Bacteria 4483
315 Ga0307408_100029541 3300031548 Bacteria 3799
316 Ga0307408_100068190 3300031548 Bacteria 2619
317 Ga0307408_100081557 3300031548 Bacteria 2419
318 Ga0307408_100093452 3300031548 Bacteria 2275
319 Ga0307408_100210373 3300031548 Bacteria 1580
320 Ga0307408_100665937 3300031548 Bacteria 932
321 Ga0307405_10005724 3300031731 Bacteria 6033
322 Ga0307405_10107907 3300031731 Bacteria 1880
323 Ga0307405_10270938 3300031731 Bacteria 1273
324 Ga0307413_10264765 3300031824 Bacteria 1284
325 Ga0307410_10124148 3300031852 Bacteria 1887
326 Ga0307406_10170554 3300031901 Bacteria 1574
327 Ga0307406_10315249 3300031901 Bacteria 1207
328 Ga0307412_10004135 3300031911 Bacteria 8082
329 Ga0307412_10020869 3300031911 Bacteria 3993
330 Ga0307412_10094422 3300031911 Bacteria 2100
331 Ga0307412_10156762 3300031911 Bacteria 1686
332 Ga0307409_100612456 3300031995 Bacteria 1077
333 Ga0307409_100862162 3300031995 Bacteria 917
334 Ga0307416_100005890 3300032002 Bacteria 7606
335 Ga0307416_100070347 3300032002 Bacteria 2901
336 Ga0307416_100242806 3300032002 Bacteria 1746
337 Ga0307416_100514117 3300032002 Bacteria 1264
338 Ga0307416_100548918 3300032002 Bacteria 1228
339 Ga0307416_100897755 3300032002 Bacteria 986
340 Ga0307416_101149401 3300032002 Bacteria 881
341 Ga0307414_10053076 3300032004 Bacteria 2825
342 Ga0307414_10743137 3300032004 Bacteria 891
343 Ga0307411_10466415 3300032005 Bacteria 1060
344 Ga0307411_10471682 3300032005 Bacteria 1055
345 Ga0307415_100009912 3300032126 Bacteria 5371
346 Ga0316583_10068455 3300032133 Bacteria 1242
347 Ga0307507_10003278 3300033179 Bacteria 31833
348 Ga0307507_10013142 3300033179 Bacteria 10108
349 Ga0307507_10066781 3300033179 Bacteria 3294
350 Ga0307510_10007254 3300033180 Bacteria 13202
351 Ga0373945_0047091 3300035116 Bacteria 1576
352 Ga0373943_0100176 3300035170 Bacteria 1514
353 Ga0373927_0149721 3300035695 Bacteria 1528
354 Ga0373947_0046416 3300035725 Bacteria 2602
355 Ga0395899_0500171 3300037312 Bacteria 789
356 Ga0395900_0022654 3300037418 Bacteria 6428
357 Ga0395900_0284849 3300037418 Bacteria 1643
358 Ga0395900_0668210 3300037418 Bacteria 974
359 Ga0395898_0015738 3300037466 Bacteria 7751
360 Ga0395898_0057467 3300037466 Bacteria 3791
361 Ga0395898_0354385 3300037466 Bacteria 1399
362 Ga0395898_0433355 3300037466 Bacteria 1253
363 Ga0395898_0825345 3300037466 Bacteria 867
364 Ga0395901_0010507 3300038443 Bacteria 9376
365 Ga0395901_0068243 3300038443 Bacteria 3704
366 Ga0395901_0317188 3300038443 Bacteria 1613
367 Ga0439439_0076315 3300041406 Bacteria 902
368 Ga0439461_0023085 3300041410 Bacteria 1250
369 Ga0439461_0045919 3300041410 Bacteria 957
370 Ga0451789_0773769 3300041443 Bacteria 6622
371 Ga0451791_0046506 3300041451 Bacteria 8235
372 Ga0451797_0755319 3300041453 Bacteria 2054
373 Ga0451837_0306202 3300041494 Bacteria 4361
374 Ga0451839_1273660 3300041496 Bacteria 1021
375 Ga0451843_1359134 3300041509 Bacteria 1400
376 Ga0451855_0524852 3300041511 Bacteria 1856
377 Ga0451853_0926246 3300041512 Bacteria 2079
378 Ga0439433_0011663 3300041999 Bacteria 1926
379 Ga0439441_023876 3300042001 Archaea 1145
380 Ga0439443_007046 3300042003 Bacteria 1556
381 Ga0439448_0036352 3300042005 Bacteria 1579
382 Ga0439456_021266 3300042013 Bacteria 1372
383 Ga0439463_054974 3300042016 Bacteria 1016
384 Ga0450912_001635 3300042116 Bacteria 1405
385 Ga0450888_001339 3300042126 Bacteria 2350
386 Ga0439446_0018296 3300042156 Bacteria 1962
387 Ga0439458_0010521 3300042157 Bacteria 2064
388 Ga0439434_0017516 3300042435 Bacteria 2144
389 Ga0439435_0001617 3300042436 Bacteria 4230
390 Ga0439444_0005180 3300042437 Bacteria 1925
391 Ga0439444_0039072 3300042437 Archaea 924
392 Ga0439464_0003929 3300042439 Bacteria 3782
393 Ga0439460_0021667 3300042461 Bacteria 1758
394 Ga0451577_0114244 3300042876 Bacteria 2417
395 Ga0439440_0012294 3300042993 Bacteria 1818
396 Ga0466966_0112337 3300044684 Bacteria 1679
397 Ga0466961_0449017 3300044693 Unclassified 780
398 Ga0466970_0145831 3300044765 Bacteria 1306
399 Ga0466967_0706223 3300045976 Bacteria 999
400 Ga0495592_0007336 3300046454 Bacteria 8247
401 Ga0495629_0002943 3300046459 Bacteria 12978
402 Ga0495629_0046314 3300046459 Bacteria 3050
403 Ga0495629_0623328 3300046459 Bacteria 720
404 Ga0495638_0017403 3300046460 Bacteria 4792
405 Ga0495651_0001060 3300046462 Bacteria 21237
406 Ga0495651_0164167 3300046462 Bacteria 1588
407 Ga0495653_0220711 3300046463 Bacteria 1274
408 Ga0495580_0010494 3300046472 Bacteria 7215
409 Ga0495580_0020103 3300046472 Bacteria 4950
410 Ga0495664_0002218 3300046477 Bacteria 10391
411 Ga0495664_0034437 3300046477 Bacteria 2980
412 Ga0495584_0248184 3300046491 Bacteria 905
413 Ga0495596_0193610 3300046500 Bacteria 790
414 Ga0495606_0115093 3300046507 Bacteria 1617
415 Ga0495628_0009657 3300046516 Bacteria 8232
416 Ga0495666_0025690 3300046526 Bacteria 2908
417 Ga0495640_0083050 3300046533 Bacteria 2126
418 Ga0495586_0013436 3300046535 Bacteria 4343
419 Ga0495587_0009384 3300046536 Bacteria 6272
420 Ga0495587_0191829 3300046536 Bacteria 1157
421 Ga0495667_0100556 3300046559 Bacteria 1871
422 Ga0495667_0150070 3300046559 Bacteria 1501
423 Ga0495667_0705446 3300046559 Bacteria 625
424 Ga0495634_0110097 3300046642 Bacteria 1771
425 Ga0495625_0024624 3300046660 Bacteria 4578
426 Ga0495635_0204455 3300046663 Bacteria 1339
427 Ga0495588_0014513 3300046674 Bacteria 3772
428 Ga0495657_0002737 3300046675 Bacteria 14713
429 Ga0495646_0000074 3300046680 Bacteria 46838
430 Ga0495658_0001600 3300046683 Bacteria 11801
431 Ga0495613_0009419 3300046689 Bacteria 7244
432 Ga0495624_0219049 3300046690 Bacteria 1154
433 Ga0495670_0168249 3300046691 Bacteria 1154
434 Ga0495649_0265615 3300046694 Bacteria 879
435 Ga0495589_0003663 3300046794 Bacteria 8305
436 Ga0495589_0120430 3300046794 Bacteria 1264
437 Ga0495600_0032065 3300046809 Bacteria 3408
438 Ga0495600_0125959 3300046809 Bacteria 1666
439 Ga0495600_0221258 3300046809 Bacteria 1211
440 Ga0495581_0014051 3300047315 Bacteria 4642
441 Ga0495604_0000258 3300047317 Bacteria 47028
442 Ga0495674_0007361 3300047319 Bacteria 10527
443 Ga0495674_0214046 3300047319 Bacteria 1595
444 Ga0495674_0301383 3300047319 Bacteria 1309
445 Ga0495676_0000887 3300047321 Bacteria 24969
446 Ga0495676_0001648 3300047321 Bacteria 19487
447 Ga0495676_0128641 3300047321 Bacteria 1832
448 Ga0495677_0151605 3300047445 Bacteria 893
449 Ga0495681_0000382 3300047470 Bacteria 34681
450 Ga0495684_0061930 3300047471 Bacteria 2846
451 Ga0495593_0000437 3300047673 Bacteria 23286
452 Ga0495602_0527179 3300048088 Bacteria 822
453 Ga0495614_0000896 3300048089 Bacteria 12646
454 Ga0495614_0009433 3300048089 Bacteria 4314
455 Ga0495626_0193697 3300048091 Bacteria 837
456 Ga0496100_0001999 3300048903 Bacteria 10207
457 Ga0496100_0316106 3300048903 Bacteria 1172
458 Ga0496101_0000133 3300048904 Bacteria 67081
459 Ga0496101_0175667 3300048904 Bacteria 1647
460 Ga0496101_0262244 3300048904 Bacteria 1348
461 Ga0496102_0000032 3300048905 Bacteria 214049
462 Ga0496102_0044337 3300048905 Bacteria 4036
463 Ga0496102_0218943 3300048905 Bacteria 1794
464 Ga0496102_0762252 3300048905 Bacteria 890
465 Ga0496103_0000027 3300048906 Bacteria 213677
466 Ga0496103_0018268 3300048906 Bacteria 4205
467 Ga0496104_0004106 3300048907 Bacteria 12639
468 Ga0496104_0210215 3300048907 Bacteria 1857
469 Ga0496104_0356053 3300048907 Bacteria 1376
470 Ga0496105_0315651 3300048908 Bacteria 1254
471 Ga0496106_0024997 3300048909 Bacteria 4443
472 Ga0496106_0044069 3300048909 Bacteria 3348
473 Ga0496107_0006526 3300048910 Bacteria 8027
474 Ga0496107_0024116 3300048910 Bacteria 4302
475 Ga0496108_0023014 3300048911 Bacteria 5126
476 Ga0496108_0027415 3300048911 Bacteria 4704
477 Ga0496108_0063358 3300048911 Bacteria 3113
478 Ga0496108_0119249 3300048911 Bacteria 2262
479 Ga0496109_0036174 3300048912 Bacteria 4456
480 Ga0496109_0076849 3300048912 Bacteria 3072
481 Ga0496109_0308046 3300048912 Bacteria 1494
482 Ga0496110_0020359 3300048913 Bacteria 5601
483 Ga0496110_0032943 3300048913 Bacteria 4479
484 Ga0496110_0137713 3300048913 Bacteria 2207
485 Ga0496110_0147092 3300048913 Bacteria 2132
486 Ga0496110_0565825 3300048913 Bacteria 1032
487 Ga0496110_0842817 3300048913 Bacteria 822
488 Ga0496111_0019985 3300048914 Bacteria 4659
489 Ga0496111_0127271 3300048914 Bacteria 1884
490 Ga0496112_0016968 3300048915 Bacteria 6834
491 Ga0496112_0017920 3300048915 Bacteria 6663
492 Ga0496112_0052181 3300048915 Bacteria 4013
493 Ga0496112_0223026 3300048915 Bacteria 1841
494 Ga0496113_0401361 3300048916 Bacteria 1101
495 Ga0496114_0011593 3300048917 Bacteria 7046
496 Ga0496114_0050056 3300048917 Bacteria 3477
497 Ga0496114_0825842 3300048917 Bacteria 806
498 Ga0496115_0053133 3300048918 Bacteria 3251
499 Ga0496116_0000088 3300048919 Bacteria 213188
500 Ga0496116_0001898 3300048919 Bacteria 22535
501 Ga0496117_0000018 3300048920 Bacteria 479613
502 Ga0496118_0000013 3300048921 Bacteria 574008
503 Ga0496119_0116610 3300048922 Unclassified 1473
504 Ga0496119_0116735 3300048922 Unclassified 1472
505 Ga0496120_0020683 3300048923 Bacteria 4174
506 Ga0496120_0110550 3300048923 Unclassified 1436
507 Ga0496121_0000095 3300048924 Bacteria 209011
508 Ga0496122_0118384 3300048925 Bacteria 1716
509 Ga0496123_0194686 3300048926 Bacteria 1045
510 Ga0496124_0062627 3300048927 Bacteria 3112
511 Ga0496125_0055805 3300048928 Bacteria 3214
512 Ga0496126_0000415 3300048929 Bacteria 86270
513 Ga0496126_0006563 3300048929 Bacteria 12960
514 Ga0501032_0087605 3300049569 Bacteria 2067
515 Ga0501034_0000010 3300049571 Bacteria 312213
516 Ga0501046_0003959 3300049580 Bacteria 13525
517 Ga0501265_018330 3300049762 Bacteria 925
518 nmdc:mga05p37_1917188_c1 3300050507 Unclassified 565
519 nmdc:mga05p37_5661_c1 3300050507 Bacteria 14692
520 nmdc:mga0qj67_334010_c1 3300050509 Bacteria 1226
521 nmdc:mga0qj67_409714_c1 3300050509 Bacteria 1093
522 nmdc:mga06r32_36377_c1 3300050510 Bacteria 4651
523 nmdc:mga08y16_1033049_c1 3300050511 Bacteria 800
524 nmdc:mga08y16_6847_c1 3300050511 Bacteria 11950
525 nmdc:mga0n895_13149_c1 3300050512 Bacteria 7453
526 nmdc:mga0n895_272999_c1 3300050512 Bacteria 1715
527 nmdc:mga0n895_418_c1 3300050512 Bacteria 28494
528 nmdc:mga0rr50_431058_c1 3300050513 Archaea 1116
529 nmdc:mga0a205_1027638_c1 3300050515 Bacteria 671
530 nmdc:mga0sz30_24570_c1 3300050516 Bacteria 2459
531 Ga0500640_004842 3300053095 Bacteria 4942
532 Ga0500553_108435 3300053101 Bacteria 1175
533 Ga0500560_000811 3300053107 Bacteria 4813
534 Ga0500562_003785 3300053108 Bacteria 3807
535 Ga0500573_0060225 3300053140 Bacteria 2175
536 Ga0500616_0005617 3300053153 Bacteria 8470
537 Ga0590075_031188 3300059424 Bacteria 1351
538 Ga0590077_028636 3300059426 Bacteria 1211
539 2655034103 2654587600 Bacteria 3911798
540 2775657329 2775506735 Bacteria 4556596
541 2857720473 2857720070 Bacteria 3189373
542 2862575410 2862574272 Bacteria 10567477
543 2904777851 2904776348 Bacteria 4658726
544 2919054977 2919051321 Bacteria 4210889
545 2919059988 2919059106 Bacteria 4991624
546 2919540647 2919538618 Bacteria 4677069
547 2932430643 2932426870 Bacteria 4547726
548 2939651407 2939647034 Bacteria 4681660
549 2939680210 2939679117 Bacteria 6921672
550 2945956927 2945956166 Bacteria 5110334
551 2984553624 2984551494 Bacteria 3877562
552 3006427172 3006425503 Bacteria 6491253
553 Ga0105240_10183464
554 JGI24735J21928_10030140
555 JGI24750J21931_1002302
556 JGI24738J21930_10000712
557 JGI24749J21850_1014325
558 JGI25152J39213_1000086
559 Ga0055539_1000019
560 Ga0055539_1015281
561 Ga0055533_1000023
562 Ga0055525_1000125
563 Ga0065712_10085108
564 Ga0065715_10108157
565 Ga0065715_10238647
566 Ga0065707_10089282
567 Ga0070658_10067747
568 Ga0070658_10221513
569 Ga0070658_10237448
570 Ga0070676_10016108
571 Ga0070670_100084417
572 Ga0070670_100282174
573 Ga0070677_10277341
574 Ga0068869_100006656
575 Ga0070666_10049746
576 Ga0070680_100238203
577 Ga0070682_100023279
578 Ga0068868_100064077
579 Ga0070660_100079204
580 Ga0070660_100550499
581 Ga0070660_100559547
582 Ga0070689_100046119
583 Ga0070691_10009250
584 Ga0070661_100032531
585 Ga0070661_100075981
586 Ga0070668_100026680
587 Ga0070668_100044930
588 Ga0070668_100244560
589 Ga0070669_100003650
590 Ga0070669_100006384
591 Ga0070669_100048009
592 Ga0070669_100197979
593 Ga0070675_100039191
594 Ga0070675_100292251
595 Ga0070675_100396710
596 Ga0070675_100773088
597 Ga0070671_100080203
598 Ga0070671_100394395
599 Ga0070674_100016669
600 Ga0070673_100038615
601 Ga0070673_100868723
602 Ga0070688_100025111
603 Ga0070688_100153735
604 Ga0070659_100027240
605 Ga0070659_100082945
606 Ga0070703_10008591
607 Ga0070709_10025856
608 Ga0070714_100124797
609 Ga0070714_100360678
610 Ga0070714_100488872
611 Ga0070710_10013108
612 Ga0070710_10267295
613 Ga0070701_10005876
614 Ga0070711_100197956
615 Ga0070711_100824916
616 Ga0070705_100100879
617 Ga0070700_100011950
618 Ga0070694_100003281
619 Ga0070663_100180580
620 Ga0070678_100050863
621 Ga0070662_100433763
622 Ga0070681_10374425
623 Ga0068867_100026017
624 Ga0070685_10099453
625 Ga0070698_100092183
626 Ga0070684_100589221
627 Ga0070697_100811177
628 Ga0068853_100058954
629 Ga0070672_100032676
630 Ga0070672_100315792
631 Ga0070695_100177869
632 Ga0070696_100021763
633 Ga0070693_100024055
634 Ga0068855_100049685
635 Ga0068855_100436959
636 Ga0068855_100441176
637 Ga0070664_100047867
638 Ga0070664_100240081
639 Ga0070664_100332284
640 Ga0068857_100058869
641 Ga0068857_100550353
642 Ga0068854_100002719
643 Ga0068856_100146730
644 Ga0068856_100457968
645 Ga0070702_100070573
646 Ga0068852_100234848
647 Ga0068852_100267606
648 Ga0068852_100781024
649 Ga0068859_100086101
650 Ga0068859_100307553
651 Ga0068859_100437886
652 Ga0068864_100321158
653 Ga0068866_10014308
654 Ga0068861_100021740
655 Ga0068851_10145972
656 Ga0068870_10012162
657 Ga0068870_10079815
658 Ga0068870_10310146
659 Ga0068858_100473322
660 Ga0068860_100088749
661 Ga0068860_100258569
662 Ga0068860_100440851
663 Ga0068862_100008592
664 Ga0068862_100011477
665 Ga0081455_10003292
666 Ga0081539_10000146
667 Ga0070717_10012367
668 Ga0075365_10302404
669 Ga0070715_10009503
670 Ga0070716_100020292
671 Ga0070716_100331070
672 Ga0070712_100038645
673 Ga0075369_10030999
674 Ga0097621_100026176
675 Ga0097621_100026993
676 Ga0068871_100068420
677 Ga0075428_100002074
678 Ga0075428_100012216
679 Ga0075431_100014252
680 Ga0075433_10111473
681 Ga0075434_100000491
682 Ga0075434_100009513
683 Ga0075434_100175671
684 Ga0075429_100512582
685 Ga0068865_100006303
686 Ga0097620_100086101
687 Ga0097620_100307566
688 Ga0097620_100437896
689 Ga0075435_100711666
690 Ga0105251_10176017
691 Ga0105251_10259551
692 Ga0105244_10015081
693 Ga0105244_10193645
694 Ga0105244_10261282
695 Ga0105240_10086275
696 Ga0105240_10305562
697 Ga0111539_10002888
698 Ga0111539_10043526
699 Ga0111539_10255212
700 Ga0105245_10224033
701 Ga0105245_10460679
702 Ga0105245_10739504
703 Ga0105247_10022380
704 Ga0105247_10101882
705 Ga0114129_10001828
706 Ga0114129_10288920
707 Ga0114129_11061795
708 Ga0105243_10019572
709 Ga0105243_10301455
710 Ga0105241_10164314
711 Ga0105241_10330320
712 Ga0105241_10474285
713 Ga0105242_10053312
714 Ga0105242_10198160
715 Ga0105248_10212588
716 Ga0105248_10850946
717 Ga0105237_10069390
718 Ga0105238_10427267
719 Ga0105238_10484865
720 Ga0105249_10001093
721 Ga0105249_10040989
722 Ga0105249_10920018
723 Ga0105239_10069225
724 Ga0105246_10000458
725 Ga0105246_10001554
726 Ga0105246_10065823
727 Ga0157371_10257659
728 Ga0157370_10014780
729 Ga0157378_10154497
730 Ga0163162_10411833
731 Ga0157372_10030863
732 Ga0157372_10325875
733 Ga0157372_10399386
734 Ga0157375_10080399
735 Ga0157375_11513777
736 Ga0163163_10073694
737 Ga0157380_10130943
738 Ga0157380_10652230
739 Ga0182008_10252865
740 Ga0157377_10116111
741 Ga0157379_10134202
742 Ga0157379_10345112
743 Ga0157379_10404237
744 Ga0157376_10158512
745 Ga0163161_10022367
746 Ga0206356_11411687
747 Ga0206353_11854190
748 Ga0209566_100031
749 Ga0209674_100001
750 Ga0209563_100001
751 Ga0209677_100001
752 Ga0209677_100144
753 Ga0209129_1000100
754 Ga0209025_1001942
755 Ga0207697_10089260
756 Ga0207656_10157298
757 Ga0207655_1012170
758 Ga0207655_1028193
759 Ga0207655_1064746
760 Ga0207692_10012187
761 Ga0207642_10015696
762 Ga0207642_10192493
763 Ga0207710_10031975
764 Ga0207688_10001484
765 Ga0207688_10003631
766 Ga0207688_10131697
767 Ga0207680_10063544
768 Ga0207647_10014720
769 Ga0207647_10057883
770 Ga0207699_10031654
771 Ga0207699_10626041
772 Ga0207645_10000915
773 Ga0207645_10027946
774 Ga0207643_10035587
775 Ga0207643_10049008
776 Ga0207643_10056580
777 Ga0207705_10008446
778 Ga0207705_10068411
779 Ga0207654_10050889
780 Ga0207654_10704168
781 Ga0207695_10121743
782 Ga0207693_10012201
783 Ga0207662_10024976
784 Ga0207662_10334291
785 Ga0207657_10034444
786 Ga0207657_10044324
787 Ga0207649_10351217
788 Ga0207681_10007893
789 Ga0207681_10109424
790 Ga0207694_10053901
791 Ga0207694_10525594
792 Ga0207650_10052490
793 Ga0207650_10116094
794 Ga0207650_10142788
795 Ga0207650_10347693
796 Ga0207659_10280808
797 Ga0207659_10351074
798 Ga0207687_10412390
799 Ga0207664_10185701
800 Ga0207664_10200601
801 Ga0207706_10008044
802 Ga0207706_10022049
803 Ga0207709_10288286
804 Ga0207709_10358604
805 Ga0207670_10223674
806 Ga0207669_10037800
807 Ga0207704_10504872
808 Ga0207665_10007264
809 Ga0207691_10060425
810 Ga0207691_10244221
811 Ga0207691_10320547
812 Ga0207691_10794476
813 Ga0207711_10062410
814 Ga0207689_10004109
815 Ga0207689_10097700
816 Ga0207661_10043141
817 Ga0207679_10020829
818 Ga0207667_10130044
819 Ga0207651_10155675
820 Ga0207651_10640885
821 Ga0207712_10026239
822 Ga0207712_10031026
823 Ga0207712_10060811
824 Ga0207668_10056429
825 Ga0207668_10721245
826 Ga0207668_10753697
827 Ga0207640_10002293
828 Ga0207658_10014035
829 Ga0207658_10077330
830 Ga0207658_10324269
831 Ga0207677_10061881
832 Ga0207703_10657794
833 Ga0207703_10661372
834 Ga0207639_10083556
835 Ga0207678_10022095
836 Ga0207678_10341259
837 Ga0207708_10020605
838 Ga0207708_10045380
839 Ga0207702_10335933
840 Ga0207641_10072934
841 Ga0207648_10007048
842 Ga0207648_10049381
843 Ga0207676_10098250
844 Ga0207676_10521141
845 Ga0207674_10078376
846 Ga0207674_10130962
847 Ga0207675_100006239
848 Ga0207675_100072003
849 Ga0207683_10074178
850 Ga0207683_11047659
851 Ga0209974_10176666
852 Ga0207428_10005592
853 Ga0207428_10027671
854 Ga0268266_10496710
855 Ga0268265_10091953
856 Ga0268265_10146890
857 Ga0268265_10169498
858 Ga0268264_10115711
859 Ga0307517_10004236
860 Ga0307515_10000279
861 Ga0307511_10036064
862 Ga0265330_10097548
863 Ga0265332_10060676
864 Ga0307509_10004313
865 Ga0307509_10012105
866 Ga0307408_100020293
867 Ga0307408_100029541
868 Ga0307408_100068190
869 Ga0307408_100081557
870 Ga0307408_100093452
871 Ga0307408_100210373
872 Ga0307408_100665937
873 Ga0307405_10005724
874 Ga0307405_10107907
875 Ga0307405_10270938
876 Ga0307413_10264765
877 Ga0307410_10124148
878 Ga0307406_10170554
879 Ga0307406_10315249
880 Ga0307412_10004135
881 Ga0307412_10020869
882 Ga0307412_10094422
883 Ga0307412_10156762
884 Ga0307409_100612456
885 Ga0307409_100862162
886 Ga0307416_100005890
887 Ga0307416_100070347
888 Ga0307416_100242806
889 Ga0307416_100514117
890 Ga0307416_100548918
891 Ga0307416_100897755
892 Ga0307416_101149401
893 Ga0307414_10053076
894 Ga0307414_10743137
895 Ga0307411_10466415
896 Ga0307411_10471682
897 Ga0307415_100009912
898 Ga0316583_10068455
899 Ga0307507_10003278
900 Ga0307507_10013142
901 Ga0307507_10066781
902 Ga0307510_10007254
903 Ga0373945_0047091
904 Ga0373943_0100176
905 Ga0373927_0149721
906 Ga0373947_0046416
907 Ga0395899_0500171
908 Ga0395900_0022654
909 Ga0395900_0284849
910 Ga0395900_0668210
911 Ga0395898_0015738
912 Ga0395898_0057467
913 Ga0395898_0354385
914 Ga0395898_0433355
915 Ga0395898_0825345
916 Ga0395901_0010507
917 Ga0395901_0068243
918 Ga0395901_0317188
919 Ga0439439_0076315
920 Ga0439461_0023085
921 Ga0439461_0045919
922 Ga0451789_0773769
923 Ga0451791_0046506
924 Ga0451797_0755319
925 Ga0451837_0306202
926 Ga0451839_1273660
927 Ga0451843_1359134
928 Ga0451855_0524852
929 Ga0451853_0926246
930 Ga0439433_0011663
931 Ga0439441_023876
932 Ga0439443_007046
933 Ga0439448_0036352
934 Ga0439456_021266
935 Ga0439463_054974
936 Ga0450912_001635
937 Ga0450888_001339
938 Ga0439446_0018296
939 Ga0439458_0010521
940 Ga0439434_0017516
941 Ga0439435_0001617
942 Ga0439444_0005180
943 Ga0439444_0039072
944 Ga0439464_0003929
945 Ga0439460_0021667
946 Ga0451577_0114244
947 Ga0439440_0012294
948 Ga0466966_0112337
949 Ga0466961_0449017
950 Ga0466970_0145831
951 Ga0466967_0706223
952 Ga0495592_0007336
953 Ga0495629_0002943
954 Ga0495629_0046314
955 Ga0495629_0623328
956 Ga0495638_0017403
957 Ga0495651_0001060
958 Ga0495651_0164167
959 Ga0495653_0220711
960 Ga0495580_0010494
961 Ga0495580_0020103
962 Ga0495664_0002218
963 Ga0495664_0034437
964 Ga0495584_0248184
965 Ga0495596_0193610
966 Ga0495606_0115093
967 Ga0495628_0009657
968 Ga0495666_0025690
969 Ga0495640_0083050
970 Ga0495586_0013436
971 Ga0495587_0009384
972 Ga0495587_0191829
973 Ga0495667_0100556
974 Ga0495667_0150070
975 Ga0495667_0705446
976 Ga0495634_0110097
977 Ga0495625_0024624
978 Ga0495635_0204455
979 Ga0495588_0014513
980 Ga0495657_0002737
981 Ga0495646_0000074
982 Ga0495658_0001600
983 Ga0495613_0009419
984 Ga0495624_0219049
985 Ga0495670_0168249
986 Ga0495649_0265615
987 Ga0495589_0003663
988 Ga0495589_0120430
989 Ga0495600_0032065
990 Ga0495600_0125959
991 Ga0495600_0221258
992 Ga0495581_0014051
993 Ga0495604_0000258
994 Ga0495674_0007361
995 Ga0495674_0214046
996 Ga0495674_0301383
997 Ga0495676_0000887
998 Ga0495676_0001648
999 Ga0495676_0128641
1000 Ga0495677_0151605
1001 Ga0495681_0000382
1002 Ga0495684_0061930
1003 Ga0495593_0000437
1004 Ga0495602_0527179
1005 Ga0495614_0000896
1006 Ga0495614_0009433
1007 Ga0495626_0193697
1008 Ga0496100_0001999
1009 Ga0496100_0316106
1010 Ga0496101_0000133
1011 Ga0496101_0175667
1012 Ga0496101_0262244
1013 Ga0496102_0000032
1014 Ga0496102_0044337
1015 Ga0496102_0218943
1016 Ga0496102_0762252
1017 Ga0496103_0000027
1018 Ga0496103_0018268
1019 Ga0496104_0004106
1020 Ga0496104_0210215
1021 Ga0496104_0356053
1022 Ga0496105_0315651
1023 Ga0496106_0024997
1024 Ga0496106_0044069
1025 Ga0496107_0006526
1026 Ga0496107_0024116
1027 Ga0496108_0023014
1028 Ga0496108_0027415
1029 Ga0496108_0063358
1030 Ga0496108_0119249
1031 Ga0496109_0036174
1032 Ga0496109_0076849
1033 Ga0496109_0308046
1034 Ga0496110_0020359
1035 Ga0496110_0032943
1036 Ga0496110_0137713
1037 Ga0496110_0147092
1038 Ga0496110_0565825
1039 Ga0496110_0842817
1040 Ga0496111_0019985
1041 Ga0496111_0127271
1042 Ga0496112_0016968
1043 Ga0496112_0017920
1044 Ga0496112_0052181
1045 Ga0496112_0223026
1046 Ga0496113_0401361
1047 Ga0496114_0011593
1048 Ga0496114_0050056
1049 Ga0496114_0825842
1050 Ga0496115_0053133
1051 Ga0496116_0000088
1052 Ga0496116_0001898
1053 Ga0496117_0000018
1054 Ga0496118_0000013
1055 Ga0496119_0116610
1056 Ga0496119_0116735
1057 Ga0496120_0020683
1058 Ga0496120_0110550
1059 Ga0496121_0000095
1060 Ga0496122_0118384
1061 Ga0496123_0194686
1062 Ga0496124_0062627
1063 Ga0496125_0055805
1064 Ga0496126_0000415
1065 Ga0496126_0006563
1066 Ga0501032_0087605
1067 Ga0501034_0000010
1068 Ga0501046_0003959
1069 Ga0501265_018330
1070 nmdc:mga05p37_1917188_c1
1071 nmdc:mga05p37_5661_c1
1072 nmdc:mga0qj67_334010_c1
1073 nmdc:mga0qj67_409714_c1
1074 nmdc:mga06r32_36377_c1
1075 nmdc:mga08y16_1033049_c1
1076 nmdc:mga08y16_6847_c1
1077 nmdc:mga0n895_13149_c1
1078 nmdc:mga0n895_272999_c1
1079 nmdc:mga0n895_418_c1
1080 nmdc:mga0rr50_431058_c1
1081 nmdc:mga0a205_1027638_c1
1082 nmdc:mga0sz30_24570_c1
1083 Ga0500640_004842
1084 Ga0500553_108435
1085 Ga0500560_000811
1086 Ga0500562_003785
1087 Ga0500573_0060225
1088 Ga0500616_0005617
1089 Ga0590075_031188
1090 Ga0590077_028636
1091 2655034103
1092 2775657329
1093 2857720473
1094 2862575410
1095 2904777851
1096 2919054977
1097 2919059988
1098 2919540647
1099 2932430643
1100 2939651407
1101 2939680210
1102 2945956927
1103 2984553624
1104 3006427172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

38

231

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e01-assembly1.cif.gz_A structure of engineered nano-cage fusion protein 0.953 11 212
7b3y-assembly1.cif.gz_B-9 structure of a nanoparticle for a covid-19 vaccine candidate 0.9486 5 212
6p6f-assembly1.cif.gz_A bg505 sosip-i53-50np 0.9483 6 212
8cus-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.9437 6 211
1wa3-assembly2.cif.gz_F mechanism of the class i kdpg aldolase 0.9433 6 212
ID Description Score Start End Superfamily
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.94 4 213 3.20.20.70
af_A0A1D6HW21_144_318_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9387 39 209 3.20.20.70
af_K7LFS0_36_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9343 3 213 3.20.20.70
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9227 16 213 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9227 4 213 3.20.20.70
ID Description Score Start End GO Terms
AF-J7LNB9-F1-model_v4 deleted 0.9967 1 215
AF-A0A3B9W0H3-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9957 38 169 GO:0016829
AF-J7LNB9-F1-model_v4 deleted 0.992 1 215
AF-B8H749-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase 0.9892 1 215 GO:0016829
AF-A0A512D9E2-F1-model_v4 Bifunctional 2-keto-4-hydroxyglutarate aldolase/2-keto-3-deoxy-6-phosphogluconate aldolase 0.987 1 215 GO:0016829

Map