F462616
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 551 | 325 | 511 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300025915|Ga0207693_10285145|Ga0207693_102851452 |
| Length | 311 |
| Sequence | MAILDRFRLDDRVVIITGASAGLGVSFAEACAEAGADVVLAARRAEKLKETADLVRSAGRRALTVTTDVTDPRQCQAMADAAVEEFGRVDVLVNNAGVGTVVPATRETPEQFRSVIDTNLNGSYWAAQACGRIMQPGSSIVNISSVLGLTTAGLPEAAYSASKAGIIGLTRDLAQQWGFRKGIRVNAIAPGFFHSEMTDQLPPEYVANVARLNAATLASLALSPAPPSEVHLLTKQLENDSKIQWKPAPGATAYEVLWRKTTDADFPEENVQRTTEPKVDLTDSKDNVIFGVRSVDAKGHRSLIVIPEPER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 3 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 4 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 5 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 6 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 7 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 8 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 9 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 10 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 11 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 12 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 13 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 14 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 15 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 16 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 17 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 18 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 19 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 20 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 21 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 22 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 23 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 24 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 25 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 26 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 27 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 28 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 29 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 30 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 31 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 32 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 33 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 34 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 35 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 36 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 37 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 38 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 39 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 40 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 41 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 42 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 43 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 44 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 45 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 46 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 47 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 109 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 203 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 221 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 222 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 223 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 224 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 226 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 227 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 228 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 229 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 230 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 231 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 232 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 272 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 273 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 274 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 275 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 276 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 277 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 278 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 279 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 280 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 281 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 282 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 320 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 321 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 322 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 323 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 324 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 325 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.56 |
| Metatranscriptomes | 0.18 |
| Isolates | 7.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.17 |
| Nodule | 2.18 |
| Rhizoplane | 9.44 |
| Rhizosphere | 74.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1016435 | 3300001977 | Bacteria | 1057 |
| 2 | JGI24739J22299_10043323 | 3300001989 | Bacteria | 1488 |
| 3 | JGI24739J22299_10080943 | 3300001989 | Bacteria | 998 |
| 4 | JGI24743J22301_10005260 | 3300001991 | Bacteria | 2151 |
| 5 | JGI24743J22301_10018135 | 3300001991 | Bacteria | 1328 |
| 6 | JGI24750J21931_1017300 | 3300002070 | Bacteria | 985 |
| 7 | JGI24745J21846_1001374 | 3300002073 | Bacteria | 2350 |
| 8 | JGI24748J21848_1007157 | 3300002074 | Bacteria | 1306 |
| 9 | JGI24738J21930_10002619 | 3300002075 | Bacteria | 4640 |
| 10 | JGI24738J21930_10010017 | 3300002075 | Bacteria | 2120 |
| 11 | JGI24749J21850_1001821 | 3300002076 | Bacteria | 3017 |
| 12 | JGI24749J21850_1014763 | 3300002076 | Bacteria | 1095 |
| 13 | JGI24744J21845_10019574 | 3300002077 | Bacteria | 1338 |
| 14 | JGI24034J26672_10009237 | 3300002239 | Bacteria | 1452 |
| 15 | JGI24742J22300_10000474 | 3300002244 | Bacteria | 5970 |
| 16 | Ga0055540_1000129 | 3300003792 | Bacteria | 76241 |
| 17 | Ga0055540_1017258 | 3300003792 | Bacteria | 2020 |
| 18 | Ga0070683_100008598 | 3300005329 | Bacteria | 8676 |
| 19 | Ga0070683_100039018 | 3300005329 | Bacteria | 4357 |
| 20 | Ga0070670_100473148 | 3300005331 | Bacteria | 1112 |
| 21 | Ga0070666_10115051 | 3300005335 | Bacteria | 1863 |
| 22 | Ga0070680_100077371 | 3300005336 | Bacteria | 2740 |
| 23 | Ga0070682_100006879 | 3300005337 | Bacteria | 6392 |
| 24 | Ga0068868_100166625 | 3300005338 | Bacteria | 1823 |
| 25 | Ga0068868_100314983 | 3300005338 | Bacteria | 1332 |
| 26 | Ga0070660_100121390 | 3300005339 | Bacteria | 2085 |
| 27 | Ga0070689_100018088 | 3300005340 | Bacteria | 5185 |
| 28 | Ga0070689_100404469 | 3300005340 | Bacteria | 1154 |
| 29 | Ga0070691_10028587 | 3300005341 | Bacteria | 2606 |
| 30 | Ga0070668_100144125 | 3300005347 | Bacteria | 1922 |
| 31 | Ga0070668_100410414 | 3300005347 | Bacteria | 1158 |
| 32 | Ga0070669_100107346 | 3300005353 | Bacteria | 2114 |
| 33 | Ga0070675_100229928 | 3300005354 | Bacteria | 1617 |
| 34 | Ga0070671_100000270 | 3300005355 | Bacteria | 35025 |
| 35 | Ga0070674_100019096 | 3300005356 | Bacteria | 4349 |
| 36 | Ga0070674_100140845 | 3300005356 | Unclassified | 1810 |
| 37 | Ga0070674_100165573 | 3300005356 | Bacteria | 1681 |
| 38 | Ga0070674_100333679 | 3300005356 | Bacteria | 1219 |
| 39 | Ga0070673_100052077 | 3300005364 | Bacteria | 3210 |
| 40 | Ga0070688_100159175 | 3300005365 | Bacteria | 1550 |
| 41 | Ga0070688_100215194 | 3300005365 | Bacteria | 1351 |
| 42 | Ga0070659_100135186 | 3300005366 | Bacteria | 2005 |
| 43 | Ga0070667_100000519 | 3300005367 | Bacteria | 38707 |
| 44 | Ga0070667_100017933 | 3300005367 | Bacteria | 5868 |
| 45 | Ga0070667_100094574 | 3300005367 | Bacteria | 2575 |
| 46 | Ga0070667_100330515 | 3300005367 | Bacteria | 1377 |
| 47 | Ga0070703_10037517 | 3300005406 | Bacteria | 1493 |
| 48 | Ga0070709_10242953 | 3300005434 | Bacteria | 1294 |
| 49 | Ga0070714_100027179 | 3300005435 | Bacteria | 4735 |
| 50 | Ga0070714_100279496 | 3300005435 | Bacteria | 1550 |
| 51 | Ga0070714_100314249 | 3300005435 | Bacteria | 1463 |
| 52 | Ga0070713_100001021 | 3300005436 | Bacteria | 17922 |
| 53 | Ga0070713_100082542 | 3300005436 | Bacteria | 2745 |
| 54 | Ga0070713_100432501 | 3300005436 | Bacteria | 1233 |
| 55 | Ga0070710_10000886 | 3300005437 | Bacteria | 14310 |
| 56 | Ga0070710_10045038 | 3300005437 | Bacteria | 2450 |
| 57 | Ga0070710_10169214 | 3300005437 | Bacteria | 1360 |
| 58 | Ga0070701_10015672 | 3300005438 | Bacteria | 3506 |
| 59 | Ga0070711_100372043 | 3300005439 | Bacteria | 1153 |
| 60 | Ga0070705_100137437 | 3300005440 | Bacteria | 1603 |
| 61 | Ga0070700_100002013 | 3300005441 | Bacteria | 10324 |
| 62 | Ga0070700_100015776 | 3300005441 | Bacteria | 4291 |
| 63 | Ga0070700_100108210 | 3300005441 | Bacteria | 1843 |
| 64 | Ga0070708_100005219 | 3300005445 | Bacteria | 10287 |
| 65 | Ga0070708_100027390 | 3300005445 | Bacteria | 4889 |
| 66 | Ga0070708_100164504 | 3300005445 | Bacteria | 2069 |
| 67 | Ga0070663_100157177 | 3300005455 | Bacteria | 1748 |
| 68 | Ga0068867_100006376 | 3300005459 | Bacteria | 8340 |
| 69 | Ga0070685_10059495 | 3300005466 | Bacteria | 2231 |
| 70 | Ga0070685_10133521 | 3300005466 | Bacteria | 1554 |
| 71 | Ga0070706_100014393 | 3300005467 | Bacteria | 7311 |
| 72 | Ga0070706_100027755 | 3300005467 | Bacteria | 5206 |
| 73 | Ga0070706_100263900 | 3300005467 | Bacteria | 1607 |
| 74 | Ga0070707_100022878 | 3300005468 | Bacteria | 5909 |
| 75 | Ga0070707_100053905 | 3300005468 | Bacteria | 3855 |
| 76 | Ga0070707_100074196 | 3300005468 | Bacteria | 3280 |
| 77 | Ga0070707_100213658 | 3300005468 | Bacteria | 1880 |
| 78 | Ga0070698_100020408 | 3300005471 | Bacteria | 6945 |
| 79 | Ga0070698_100073794 | 3300005471 | Bacteria | 3417 |
| 80 | Ga0070698_100117098 | 3300005471 | Bacteria | 2626 |
| 81 | Ga0070698_100400557 | 3300005471 | Bacteria | 1306 |
| 82 | Ga0070699_100001180 | 3300005518 | Bacteria | 24208 |
| 83 | Ga0070679_100125377 | 3300005530 | Bacteria | 2550 |
| 84 | Ga0070684_100213867 | 3300005535 | Bacteria | 1757 |
| 85 | Ga0070697_100034421 | 3300005536 | Bacteria | 4084 |
| 86 | Ga0070672_100005018 | 3300005543 | Bacteria | 8725 |
| 87 | Ga0070672_100085830 | 3300005543 | Bacteria | 2530 |
| 88 | Ga0070686_100095559 | 3300005544 | Bacteria | 1997 |
| 89 | Ga0070695_100053073 | 3300005545 | Bacteria | 2606 |
| 90 | Ga0070696_100087653 | 3300005546 | Bacteria | 2211 |
| 91 | Ga0070693_100108396 | 3300005547 | Bacteria | 1704 |
| 92 | Ga0070693_100165906 | 3300005547 | Bacteria | 1410 |
| 93 | Ga0070665_100003024 | 3300005548 | Bacteria | 18135 |
| 94 | Ga0070665_100290377 | 3300005548 | Bacteria | 1638 |
| 95 | Ga0068857_100481814 | 3300005577 | Bacteria | 1163 |
| 96 | Ga0068856_100528614 | 3300005614 | Bacteria | 1201 |
| 97 | Ga0070702_100051111 | 3300005615 | Bacteria | 2365 |
| 98 | Ga0068852_100029346 | 3300005616 | Bacteria | 4518 |
| 99 | Ga0068859_100197406 | 3300005617 | Bacteria | 2096 |
| 100 | Ga0068859_100704293 | 3300005617 | Bacteria | 1100 |
| 101 | Ga0068864_100166763 | 3300005618 | Bacteria | 2006 |
| 102 | Ga0068864_100385535 | 3300005618 | Bacteria | 1329 |
| 103 | Ga0068864_100585082 | 3300005618 | Bacteria | 1082 |
| 104 | Ga0068866_10004033 | 3300005718 | Bacteria | 6037 |
| 105 | Ga0068866_10176713 | 3300005718 | Bacteria | 1258 |
| 106 | Ga0068861_100007505 | 3300005719 | Bacteria | 7476 |
| 107 | Ga0068861_100455866 | 3300005719 | Bacteria | 1147 |
| 108 | Ga0068851_10049835 | 3300005834 | Bacteria | 2126 |
| 109 | Ga0068863_100000322 | 3300005841 | Bacteria | 48726 |
| 110 | Ga0068863_100004380 | 3300005841 | Bacteria | 13920 |
| 111 | Ga0068863_100068275 | 3300005841 | Bacteria | 3363 |
| 112 | Ga0068863_100078278 | 3300005841 | Bacteria | 3131 |
| 113 | Ga0068863_100298399 | 3300005841 | Bacteria | 1563 |
| 114 | Ga0068858_100759246 | 3300005842 | Bacteria | 945 |
| 115 | Ga0068860_100024247 | 3300005843 | Bacteria | 5865 |
| 116 | Ga0068860_100089480 | 3300005843 | Bacteria | 2931 |
| 117 | Ga0068860_100346980 | 3300005843 | Bacteria | 1460 |
| 118 | Ga0068860_100418331 | 3300005843 | Bacteria | 1328 |
| 119 | Ga0068860_100430295 | 3300005843 | Bacteria | 1309 |
| 120 | Ga0068862_100000087 | 3300005844 | Bacteria | 110040 |
| 121 | Ga0068862_100125825 | 3300005844 | Bacteria | 2263 |
| 122 | Ga0068862_100273281 | 3300005844 | Bacteria | 1546 |
| 123 | Ga0068862_100541194 | 3300005844 | Bacteria | 1111 |
| 124 | Ga0081455_10010764 | 3300005937 | Bacteria | 9245 |
| 125 | Ga0070717_10037001 | 3300006028 | Bacteria | 3961 |
| 126 | Ga0075368_10076953 | 3300006042 | Bacteria | 1354 |
| 127 | Ga0075364_10010113 | 3300006051 | Bacteria | 5689 |
| 128 | Ga0075364_10043356 | 3300006051 | Bacteria | 2925 |
| 129 | Ga0075364_10051858 | 3300006051 | Bacteria | 2680 |
| 130 | Ga0070715_10016478 | 3300006163 | Bacteria | 2777 |
| 131 | Ga0070716_100119432 | 3300006173 | Bacteria | 1648 |
| 132 | Ga0070712_100068958 | 3300006175 | Bacteria | 2521 |
| 133 | Ga0070712_100204484 | 3300006175 | Bacteria | 1553 |
| 134 | Ga0075367_10007920 | 3300006178 | Bacteria | 5475 |
| 135 | Ga0075369_10001359 | 3300006186 | Bacteria | 8313 |
| 136 | Ga0075370_10021490 | 3300006353 | Bacteria | 3535 |
| 137 | Ga0075370_10059969 | 3300006353 | Bacteria | 2167 |
| 138 | Ga0075370_10139803 | 3300006353 | Unclassified | 1415 |
| 139 | Ga0068871_100602260 | 3300006358 | Bacteria | 999 |
| 140 | Ga0075428_100266996 | 3300006844 | Bacteria | 1842 |
| 141 | Ga0075430_100040540 | 3300006846 | Bacteria | 3942 |
| 142 | Ga0068865_100005567 | 3300006881 | Bacteria | 7640 |
| 143 | Ga0068865_100266448 | 3300006881 | Bacteria | 1359 |
| 144 | Ga0097620_100000055 | 3300006931 | Bacteria | 119802 |
| 145 | Ga0097620_100197422 | 3300006931 | Bacteria | 2096 |
| 146 | Ga0097620_100704312 | 3300006931 | Bacteria | 1100 |
| 147 | Ga0099795_10089946 | 3300007788 | Bacteria | 1188 |
| 148 | Ga0105250_10012859 | 3300009092 | Bacteria | 3447 |
| 149 | Ga0105240_10176840 | 3300009093 | Bacteria | 2522 |
| 150 | Ga0111539_10212986 | 3300009094 | Bacteria | 2251 |
| 151 | Ga0105245_10128789 | 3300009098 | Bacteria | 2372 |
| 152 | Ga0105245_10232597 | 3300009098 | Bacteria | 1783 |
| 153 | Ga0105247_10149142 | 3300009101 | Bacteria | 1539 |
| 154 | Ga0105247_10156416 | 3300009101 | Bacteria | 1506 |
| 155 | Ga0105243_10020187 | 3300009148 | Bacteria | 5052 |
| 156 | Ga0105243_10683628 | 3300009148 | Bacteria | 998 |
| 157 | Ga0105243_10756918 | 3300009148 | Bacteria | 953 |
| 158 | Ga0105241_10268953 | 3300009174 | Bacteria | 1451 |
| 159 | Ga0105248_10032784 | 3300009177 | Bacteria | 5804 |
| 160 | Ga0105237_10215049 | 3300009545 | Bacteria | 1922 |
| 161 | Ga0105237_10489338 | 3300009545 | Bacteria | 1236 |
| 162 | Ga0105238_10126521 | 3300009551 | Bacteria | 2534 |
| 163 | Ga0105249_10534976 | 3300009553 | Bacteria | 1221 |
| 164 | Ga0099796_10073524 | 3300010159 | Unclassified | 1239 |
| 165 | Ga0099796_10156910 | 3300010159 | Bacteria | 899 |
| 166 | Ga0105239_10085466 | 3300010375 | Bacteria | 3477 |
| 167 | Ga0105239_10276160 | 3300010375 | Bacteria | 1891 |
| 168 | Ga0157373_10284146 | 3300013100 | Bacteria | 1173 |
| 169 | Ga0157370_10153718 | 3300013104 | Bacteria | 2141 |
| 170 | Ga0157369_10199570 | 3300013105 | Bacteria | 2100 |
| 171 | Ga0163162_10002540 | 3300013306 | Bacteria | 17270 |
| 172 | Ga0163162_10375436 | 3300013306 | Bacteria | 1555 |
| 173 | Ga0157372_10558655 | 3300013307 | Bacteria | 1334 |
| 174 | Ga0157375_10126026 | 3300013308 | Bacteria | 2675 |
| 175 | Ga0163163_10009414 | 3300014325 | Bacteria | 8722 |
| 176 | Ga0157380_10010871 | 3300014326 | Bacteria | 6564 |
| 177 | Ga0157380_10208820 | 3300014326 | Bacteria | 1738 |
| 178 | Ga0157380_10660754 | 3300014326 | Bacteria | 1044 |
| 179 | Ga0157377_10016034 | 3300014745 | Bacteria | 3847 |
| 180 | Ga0157379_10014763 | 3300014968 | Bacteria | 6851 |
| 181 | Ga0157379_10113668 | 3300014968 | Bacteria | 2433 |
| 182 | Ga0163161_10059970 | 3300017792 | Bacteria | 2768 |
| 183 | Ga0163161_10287138 | 3300017792 | Bacteria | 1292 |
| 184 | Ga0224572_1011402 | 3300024225 | Bacteria | 1682 |
| 185 | Ga0209051_1000034 | 3300025303 | Bacteria | 371498 |
| 186 | Ga0209051_1000616 | 3300025303 | Bacteria | 41069 |
| 187 | Ga0209051_1001401 | 3300025303 | Bacteria | 20760 |
| 188 | Ga0209051_1003970 | 3300025303 | Bacteria | 9401 |
| 189 | Ga0209051_1015166 | 3300025303 | Bacteria | 3557 |
| 190 | Ga0207656_10096492 | 3300025321 | Bacteria | 1349 |
| 191 | Ga0207653_10004208 | 3300025885 | Bacteria | 4516 |
| 192 | Ga0207692_10003941 | 3300025898 | Bacteria | 5828 |
| 193 | Ga0207692_10104260 | 3300025898 | Bacteria | 1562 |
| 194 | Ga0207692_10263977 | 3300025898 | Bacteria | 1036 |
| 195 | Ga0207642_10065607 | 3300025899 | Bacteria | 1706 |
| 196 | Ga0207710_10208236 | 3300025900 | Bacteria | 968 |
| 197 | Ga0207688_10005203 | 3300025901 | Bacteria | 7070 |
| 198 | Ga0207688_10017595 | 3300025901 | Bacteria | 3887 |
| 199 | Ga0207680_10031067 | 3300025903 | Bacteria | 3022 |
| 200 | Ga0207647_10052239 | 3300025904 | Bacteria | 2523 |
| 201 | Ga0207685_10033167 | 3300025905 | Bacteria | 1864 |
| 202 | Ga0207699_10036731 | 3300025906 | Bacteria | 2795 |
| 203 | Ga0207699_10265499 | 3300025906 | Bacteria | 1188 |
| 204 | Ga0207645_10014546 | 3300025907 | Bacteria | 5264 |
| 205 | Ga0207643_10010630 | 3300025908 | Bacteria | 4961 |
| 206 | Ga0207684_10054123 | 3300025910 | Bacteria | 3405 |
| 207 | Ga0207684_10130564 | 3300025910 | Bacteria | 2156 |
| 208 | Ga0207707_10167309 | 3300025912 | Bacteria | 1921 |
| 209 | Ga0207671_10094053 | 3300025914 | Bacteria | 2262 |
| 210 | Ga0207671_10111649 | 3300025914 | Bacteria | 2080 |
| 211 | Ga0207693_10032663 | 3300025915 | Bacteria | 4107 |
| 212 | Ga0207693_10099379 | 3300025915 | Bacteria | 2282 |
| 213 | Ga0207693_10285145 | 3300025915 | Bacteria | 1294 |
| 214 | Ga0207662_10013789 | 3300025918 | Bacteria | 4523 |
| 215 | Ga0207649_10165777 | 3300025920 | Bacteria | 1535 |
| 216 | Ga0207646_10013591 | 3300025922 | Bacteria | 7775 |
| 217 | Ga0207646_10024206 | 3300025922 | Bacteria | 5565 |
| 218 | Ga0207646_10027978 | 3300025922 | Bacteria | 5137 |
| 219 | Ga0207650_10122473 | 3300025925 | Bacteria | 2027 |
| 220 | Ga0207659_10070262 | 3300025926 | Bacteria | 2553 |
| 221 | Ga0207687_10093865 | 3300025927 | Bacteria | 2195 |
| 222 | Ga0207687_10143583 | 3300025927 | Bacteria | 1814 |
| 223 | Ga0207687_10200311 | 3300025927 | Bacteria | 1560 |
| 224 | Ga0207700_10007399 | 3300025928 | Bacteria | 6705 |
| 225 | Ga0207700_10069990 | 3300025928 | Bacteria | 2695 |
| 226 | Ga0207700_10277201 | 3300025928 | Bacteria | 1441 |
| 227 | Ga0207664_10013054 | 3300025929 | Bacteria | 5954 |
| 228 | Ga0207664_10032875 | 3300025929 | Bacteria | 3980 |
| 229 | Ga0207644_10009239 | 3300025931 | Bacteria | 6468 |
| 230 | Ga0207690_10097019 | 3300025932 | Bacteria | 2097 |
| 231 | Ga0207706_10025968 | 3300025933 | Bacteria | 5245 |
| 232 | Ga0207709_10000326 | 3300025935 | Bacteria | 51484 |
| 233 | Ga0207709_10009878 | 3300025935 | Bacteria | 5254 |
| 234 | Ga0207709_10478123 | 3300025935 | Bacteria | 968 |
| 235 | Ga0207670_10249171 | 3300025936 | Bacteria | 1372 |
| 236 | Ga0207669_10013370 | 3300025937 | Bacteria | 4073 |
| 237 | Ga0207669_10152284 | 3300025937 | Bacteria | 1621 |
| 238 | Ga0207669_10275438 | 3300025937 | Bacteria | 1266 |
| 239 | Ga0207704_10286829 | 3300025938 | Bacteria | 1254 |
| 240 | Ga0207704_10432083 | 3300025938 | Bacteria | 1047 |
| 241 | Ga0207665_10005355 | 3300025939 | Bacteria | 8566 |
| 242 | Ga0207665_10008631 | 3300025939 | Bacteria | 6709 |
| 243 | Ga0207665_10217633 | 3300025939 | Bacteria | 1398 |
| 244 | Ga0207691_10001264 | 3300025940 | Bacteria | 25336 |
| 245 | Ga0207691_10018114 | 3300025940 | Bacteria | 6670 |
| 246 | Ga0207689_10007860 | 3300025942 | Bacteria | 9317 |
| 247 | Ga0207661_10011662 | 3300025944 | Bacteria | 6378 |
| 248 | Ga0207661_10095745 | 3300025944 | Bacteria | 2483 |
| 249 | Ga0207661_10105679 | 3300025944 | Bacteria | 2373 |
| 250 | Ga0207667_10715179 | 3300025949 | Bacteria | 1003 |
| 251 | Ga0207712_10105870 | 3300025961 | Bacteria | 2100 |
| 252 | Ga0207668_10148982 | 3300025972 | Bacteria | 1809 |
| 253 | Ga0207668_10558485 | 3300025972 | Bacteria | 992 |
| 254 | Ga0207640_10369205 | 3300025981 | Bacteria | 1159 |
| 255 | Ga0207658_10000774 | 3300025986 | Bacteria | 27330 |
| 256 | Ga0207658_10011542 | 3300025986 | Bacteria | 6014 |
| 257 | Ga0207658_10294580 | 3300025986 | Bacteria | 1396 |
| 258 | Ga0207677_10134910 | 3300026023 | Bacteria | 1880 |
| 259 | Ga0207677_10271634 | 3300026023 | Bacteria | 1387 |
| 260 | Ga0207703_10628482 | 3300026035 | Bacteria | 1017 |
| 261 | Ga0207639_10016541 | 3300026041 | Bacteria | 5221 |
| 262 | Ga0207639_10183159 | 3300026041 | Bacteria | 1783 |
| 263 | Ga0207678_10035566 | 3300026067 | Bacteria | 4336 |
| 264 | Ga0207678_10062050 | 3300026067 | Bacteria | 3214 |
| 265 | Ga0207678_10086091 | 3300026067 | Bacteria | 2686 |
| 266 | Ga0207708_10000259 | 3300026075 | Bacteria | 41740 |
| 267 | Ga0207708_10035467 | 3300026075 | Bacteria | 3795 |
| 268 | Ga0207708_10134749 | 3300026075 | Bacteria | 1934 |
| 269 | Ga0207708_10247228 | 3300026075 | Bacteria | 1436 |
| 270 | Ga0207702_10112524 | 3300026078 | Bacteria | 2423 |
| 271 | Ga0207702_10316120 | 3300026078 | Bacteria | 1486 |
| 272 | Ga0207641_10000451 | 3300026088 | Bacteria | 46849 |
| 273 | Ga0207641_10007659 | 3300026088 | Bacteria | 8978 |
| 274 | Ga0207641_10007845 | 3300026088 | Bacteria | 8864 |
| 275 | Ga0207641_10182740 | 3300026088 | Bacteria | 1922 |
| 276 | Ga0207641_10354635 | 3300026088 | Bacteria | 1399 |
| 277 | Ga0207648_10008057 | 3300026089 | Bacteria | 10266 |
| 278 | Ga0207648_10038279 | 3300026089 | Bacteria | 4221 |
| 279 | Ga0207676_10722529 | 3300026095 | Bacteria | 967 |
| 280 | Ga0207674_10832457 | 3300026116 | Bacteria | 890 |
| 281 | Ga0207675_100023956 | 3300026118 | Bacteria | 5675 |
| 282 | Ga0207675_100037603 | 3300026118 | Bacteria | 4514 |
| 283 | Ga0207675_100527793 | 3300026118 | Bacteria | 1177 |
| 284 | Ga0207675_100758976 | 3300026118 | Bacteria | 982 |
| 285 | Ga0207683_10739548 | 3300026121 | Bacteria | 912 |
| 286 | Ga0207698_10036576 | 3300026142 | Bacteria | 3605 |
| 287 | Ga0268266_10014404 | 3300028379 | Bacteria | 6798 |
| 288 | Ga0268266_10659981 | 3300028379 | Bacteria | 1007 |
| 289 | Ga0268265_10000020 | 3300028380 | Bacteria | 275575 |
| 290 | Ga0268265_10813356 | 3300028380 | Bacteria | 912 |
| 291 | Ga0316181_1130982 | 3300030744 | Bacteria | 853 |
| 292 | Ga0265760_10004461 | 3300031090 | Bacteria | 4018 |
| 293 | Ga0265327_10001643 | 3300031251 | Bacteria | 26969 |
| 294 | Ga0265327_10025928 | 3300031251 | Bacteria | 3406 |
| 295 | Ga0316578_10059347 | 3300031728 | Bacteria | 2250 |
| 296 | Ga0307410_10047047 | 3300031852 | Bacteria | 2881 |
| 297 | Ga0307410_10309866 | 3300031852 | Bacteria | 1249 |
| 298 | Ga0307409_100061770 | 3300031995 | Bacteria | 2930 |
| 299 | Ga0307409_100381741 | 3300031995 | Bacteria | 1340 |
| 300 | Ga0307416_100084851 | 3300032002 | Bacteria | 2693 |
| 301 | Ga0307414_10259064 | 3300032004 | Bacteria | 1450 |
| 302 | Ga0307414_10394244 | 3300032004 | Bacteria | 1201 |
| 303 | Ga0307415_100104290 | 3300032126 | Bacteria | 2088 |
| 304 | Ga0307510_10098693 | 3300033180 | Bacteria | 2723 |
| 305 | Ga0373931_0067444 | 3300035691 | Bacteria | 1944 |
| 306 | Ga0373931_0277452 | 3300035691 | Bacteria | 1028 |
| 307 | Ga0316584_0081905 | 3300036712 | Bacteria | 2417 |
| 308 | Ga0395899_0089742 | 3300037312 | Bacteria | 2229 |
| 309 | Ga0395900_0538682 | 3300037418 | Bacteria | 1113 |
| 310 | Ga0395898_0005642 | 3300037466 | Bacteria | 13493 |
| 311 | Ga0395898_0033513 | 3300037466 | Bacteria | 5124 |
| 312 | Ga0395905_0043864 | 3300037471 | Bacteria | 4196 |
| 313 | Ga0395905_0460069 | 3300037471 | Bacteria | 1171 |
| 314 | Ga0436364_1305262 | 3300037853 | Bacteria | 1230 |
| 315 | Ga0395901_0004342 | 3300038443 | Bacteria | 14302 |
| 316 | Ga0395901_0014350 | 3300038443 | Bacteria | 8067 |
| 317 | Ga0436365_0556286 | 3300039437 | Bacteria | 27236 |
| 318 | Ga0436365_0649704 | 3300039437 | Bacteria | 9121 |
| 319 | Ga0436361_0808268 | 3300039447 | Bacteria | 1795 |
| 320 | Ga0439466_0017642 | 3300041411 | Bacteria | 2570 |
| 321 | Ga0439465_0009544 | 3300041413 | Bacteria | 3057 |
| 322 | Ga0439465_0011440 | 3300041413 | Bacteria | 2785 |
| 323 | Ga0439465_0015182 | 3300041413 | Bacteria | 2403 |
| 324 | Ga0451802_0674418 | 3300041460 | Bacteria | 2478 |
| 325 | Ga0451851_0962111 | 3300041507 | Bacteria | 923 |
| 326 | Ga0439446_0013495 | 3300042156 | Bacteria | 2243 |
| 327 | Ga0439434_0010885 | 3300042435 | Bacteria | 2686 |
| 328 | Ga0439459_0010171 | 3300042438 | Bacteria | 1636 |
| 329 | Ga0466972_0137161 | 3300044658 | Bacteria | 1151 |
| 330 | Ga0466965_0004053 | 3300044683 | Bacteria | 6502 |
| 331 | Ga0466965_0328782 | 3300044683 | Bacteria | 834 |
| 332 | Ga0466966_0012519 | 3300044684 | Bacteria | 5619 |
| 333 | Ga0466966_0052297 | 3300044684 | Bacteria | 2595 |
| 334 | Ga0466966_0212772 | 3300044684 | Bacteria | 1168 |
| 335 | Ga0466966_0372861 | 3300044684 | Bacteria | 857 |
| 336 | Ga0466961_0008672 | 3300044693 | Bacteria | 6481 |
| 337 | Ga0466961_0017087 | 3300044693 | Bacteria | 4659 |
| 338 | Ga0466963_0053943 | 3300044694 | Bacteria | 2671 |
| 339 | Ga0466963_0150474 | 3300044694 | Bacteria | 1616 |
| 340 | Ga0466964_0019807 | 3300044706 | Bacteria | 2589 |
| 341 | Ga0466964_0069472 | 3300044706 | Bacteria | 1486 |
| 342 | Ga0466971_0132695 | 3300044719 | Bacteria | 1157 |
| 343 | Ga0466968_0000471 | 3300044735 | Bacteria | 13554 |
| 344 | Ga0466970_0020859 | 3300044765 | Bacteria | 3409 |
| 345 | Ga0466970_0054923 | 3300044765 | Bacteria | 2127 |
| 346 | Ga0466970_0091699 | 3300044765 | Bacteria | 1649 |
| 347 | Ga0466957_0094843 | 3300044842 | Bacteria | 1874 |
| 348 | Ga0466957_0172622 | 3300044842 | Bacteria | 1409 |
| 349 | Ga0466960_0095201 | 3300044901 | Bacteria | 1525 |
| 350 | Ga0466960_0242797 | 3300044901 | Bacteria | 998 |
| 351 | Ga0466959_0021896 | 3300045049 | Bacteria | 4720 |
| 352 | Ga0466959_0066205 | 3300045049 | Bacteria | 2621 |
| 353 | Ga0466959_0112041 | 3300045049 | Bacteria | 1946 |
| 354 | Ga0466967_0001676 | 3300045976 | Bacteria | 13142 |
| 355 | Ga0466967_0033143 | 3300045976 | Bacteria | 4371 |
| 356 | Ga0466967_0084090 | 3300045976 | Bacteria | 2879 |
| 357 | Ga0466967_0098674 | 3300045976 | Bacteria | 2667 |
| 358 | Ga0466967_0173819 | 3300045976 | Bacteria | 2028 |
| 359 | Ga0466967_0317126 | 3300045976 | Bacteria | 1503 |
| 360 | Ga0466967_0327179 | 3300045976 | Bacteria | 1479 |
| 361 | Ga0466967_0414764 | 3300045976 | Bacteria | 1312 |
| 362 | Ga0466967_0427075 | 3300045976 | Bacteria | 1292 |
| 363 | Ga0495629_0199906 | 3300046459 | Bacteria | 1382 |
| 364 | Ga0495641_0100906 | 3300046461 | Bacteria | 1288 |
| 365 | Ga0495664_0064395 | 3300046477 | Bacteria | 2185 |
| 366 | Ga0495608_0081819 | 3300046511 | Bacteria | 2098 |
| 367 | Ga0495608_0082888 | 3300046511 | Bacteria | 2082 |
| 368 | Ga0495648_0211689 | 3300046524 | Bacteria | 962 |
| 369 | Ga0495652_0056247 | 3300046529 | Bacteria | 3342 |
| 370 | Ga0495652_0108592 | 3300046529 | Bacteria | 2236 |
| 371 | Ga0495645_0336541 | 3300046543 | Bacteria | 976 |
| 372 | Ga0495667_0049186 | 3300046559 | Bacteria | 2783 |
| 373 | Ga0495588_0120490 | 3300046674 | Bacteria | 1383 |
| 374 | Ga0495657_0015958 | 3300046675 | Bacteria | 5480 |
| 375 | Ga0495599_0200117 | 3300046678 | Bacteria | 1227 |
| 376 | Ga0495674_0103201 | 3300047319 | Bacteria | 2425 |
| 377 | Ga0495674_0130847 | 3300047319 | Bacteria | 2114 |
| 378 | Ga0495672_0216222 | 3300047320 | Bacteria | 949 |
| 379 | Ga0495684_0065447 | 3300047471 | Bacteria | 2763 |
| 380 | Ga0496100_0001882 | 3300048903 | Bacteria | 10528 |
| 381 | Ga0496100_0177002 | 3300048903 | Bacteria | 1540 |
| 382 | Ga0496100_0536462 | 3300048903 | Bacteria | 904 |
| 383 | Ga0496101_0000190 | 3300048904 | Bacteria | 48412 |
| 384 | Ga0496101_0003048 | 3300048904 | Bacteria | 10339 |
| 385 | Ga0496101_0005417 | 3300048904 | Bacteria | 8131 |
| 386 | Ga0496102_0000020 | 3300048905 | Bacteria | 260823 |
| 387 | Ga0496102_0291868 | 3300048905 | Unclassified | 1537 |
| 388 | Ga0496102_0355879 | 3300048905 | Bacteria | 1378 |
| 389 | Ga0496103_0000011 | 3300048906 | Bacteria | 304506 |
| 390 | Ga0496103_0001900 | 3300048906 | Bacteria | 13581 |
| 391 | Ga0496103_0249281 | 3300048906 | Bacteria | 1143 |
| 392 | Ga0496104_0047583 | 3300048907 | Bacteria | 4042 |
| 393 | Ga0496104_0061356 | 3300048907 | Bacteria | 3565 |
| 394 | Ga0496105_0231220 | 3300048908 | Bacteria | 1503 |
| 395 | Ga0496105_0282432 | 3300048908 | Bacteria | 1338 |
| 396 | Ga0496106_0004364 | 3300048909 | Bacteria | 10509 |
| 397 | Ga0496106_0113113 | 3300048909 | Bacteria | 2115 |
| 398 | Ga0496107_0001598 | 3300048910 | Bacteria | 14103 |
| 399 | Ga0496107_0071384 | 3300048910 | Bacteria | 2523 |
| 400 | Ga0496107_0075387 | 3300048910 | Bacteria | 2455 |
| 401 | Ga0496107_0102983 | 3300048910 | Bacteria | 2094 |
| 402 | Ga0496107_0266604 | 3300048910 | Bacteria | 1274 |
| 403 | Ga0496108_0025850 | 3300048911 | Bacteria | 4841 |
| 404 | Ga0496108_0046829 | 3300048911 | Bacteria | 3614 |
| 405 | Ga0496108_0148358 | 3300048911 | Bacteria | 2023 |
| 406 | Ga0496108_0290464 | 3300048911 | Bacteria | 1423 |
| 407 | Ga0496109_0005598 | 3300048912 | Bacteria | 10517 |
| 408 | Ga0496109_0097341 | 3300048912 | Bacteria | 2727 |
| 409 | Ga0496109_0278841 | 3300048912 | Bacteria | 1575 |
| 410 | Ga0496109_0375849 | 3300048912 | Bacteria | 1342 |
| 411 | Ga0496110_0007092 | 3300048913 | Bacteria | 8920 |
| 412 | Ga0496110_0069505 | 3300048913 | Bacteria | 3119 |
| 413 | Ga0496110_0092805 | 3300048913 | Bacteria | 2702 |
| 414 | Ga0496110_0097720 | 3300048913 | Bacteria | 2631 |
| 415 | Ga0496110_0163681 | 3300048913 | Bacteria | 2017 |
| 416 | Ga0496110_0329234 | 3300048913 | Bacteria | 1391 |
| 417 | Ga0496111_0022789 | 3300048914 | Bacteria | 4388 |
| 418 | Ga0496111_0117709 | 3300048914 | Bacteria | 1961 |
| 419 | Ga0496112_0003946 | 3300048915 | Bacteria | 12428 |
| 420 | Ga0496112_0213272 | 3300048915 | Bacteria | 1888 |
| 421 | Ga0496113_0000098 | 3300048916 | Bacteria | 36496 |
| 422 | Ga0496114_0004789 | 3300048917 | Bacteria | 10535 |
| 423 | Ga0496114_0020021 | 3300048917 | Bacteria | 5428 |
| 424 | Ga0496114_0033900 | 3300048917 | Bacteria | 4209 |
| 425 | Ga0496114_0132126 | 3300048917 | Bacteria | 2156 |
| 426 | Ga0496114_0152767 | 3300048917 | Bacteria | 2003 |
| 427 | Ga0496114_0169339 | 3300048917 | Bacteria | 1903 |
| 428 | Ga0496115_0011453 | 3300048918 | Bacteria | 6648 |
| 429 | Ga0496115_0023437 | 3300048918 | Bacteria | 4791 |
| 430 | Ga0496115_0104587 | 3300048918 | Bacteria | 2323 |
| 431 | Ga0496116_0000067 | 3300048919 | Bacteria | 260793 |
| 432 | Ga0496116_0008100 | 3300048919 | Bacteria | 9185 |
| 433 | Ga0496117_0000192 | 3300048920 | Bacteria | 124451 |
| 434 | Ga0496117_0057989 | 3300048920 | Bacteria | 2684 |
| 435 | Ga0496118_0000076 | 3300048921 | Bacteria | 193263 |
| 436 | Ga0496118_0026894 | 3300048921 | Bacteria | 4885 |
| 437 | Ga0496119_0000237 | 3300048922 | Bacteria | 77727 |
| 438 | Ga0496119_0011441 | 3300048922 | Bacteria | 7349 |
| 439 | Ga0496119_0052621 | 3300048922 | Bacteria | 2493 |
| 440 | Ga0496120_0053513 | 3300048923 | Bacteria | 2293 |
| 441 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 442 | Ga0496121_0005722 | 3300048924 | Bacteria | 15785 |
| 443 | Ga0496121_0022738 | 3300048924 | Bacteria | 6067 |
| 444 | Ga0496122_0000305 | 3300048925 | Bacteria | 108235 |
| 445 | Ga0496122_0008120 | 3300048925 | Bacteria | 11438 |
| 446 | Ga0496123_0000284 | 3300048926 | Bacteria | 99532 |
| 447 | Ga0496123_0030579 | 3300048926 | Bacteria | 3939 |
| 448 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 449 | Ga0496124_0041933 | 3300048927 | Bacteria | 3944 |
| 450 | Ga0496124_0363031 | 3300048927 | Bacteria | 1020 |
| 451 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 452 | Ga0496126_0000009 | 3300048929 | Bacteria | 750350 |
| 453 | Ga0496126_0000080 | 3300048929 | Bacteria | 221672 |
| 454 | Ga0496126_0002421 | 3300048929 | Bacteria | 25257 |
| 455 | Ga0501031_0308265 | 3300049568 | Bacteria | 1026 |
| 456 | Ga0501032_0051892 | 3300049569 | Bacteria | 2764 |
| 457 | Ga0501034_0058099 | 3300049571 | Bacteria | 3888 |
| 458 | Ga0501036_0064777 | 3300049572 | Bacteria | 3093 |
| 459 | Ga0501038_0117657 | 3300049574 | Bacteria | 2195 |
| 460 | Ga0501038_0315118 | 3300049574 | Bacteria | 1225 |
| 461 | Ga0501039_0129041 | 3300049575 | Bacteria | 1984 |
| 462 | Ga0501042_0389309 | 3300049578 | Bacteria | 1010 |
| 463 | Ga0501043_0312475 | 3300049579 | Bacteria | 1199 |
| 464 | Ga0501046_0000489 | 3300049580 | Bacteria | 39452 |
| 465 | Ga0501047_0014088 | 3300049581 | Bacteria | 7599 |
| 466 | Ga0501048_0180373 | 3300049582 | Bacteria | 1497 |
| 467 | Ga0501067_0026580 | 3300049583 | Bacteria | 3205 |
| 468 | Ga0501068_0184077 | 3300049584 | Bacteria | 1321 |
| 469 | Ga0501069_0002776 | 3300049585 | Bacteria | 8948 |
| 470 | Ga0501070_0004050 | 3300049586 | Bacteria | 12593 |
| 471 | Ga0501070_0019334 | 3300049586 | Bacteria | 5712 |
| 472 | Ga0501070_0212967 | 3300049586 | Bacteria | 1585 |
| 473 | Ga0501071_0195248 | 3300049587 | Bacteria | 1519 |
| 474 | Ga0501072_0021610 | 3300049588 | Bacteria | 4990 |
| 475 | Ga0501073_0030122 | 3300049589 | Bacteria | 3876 |
| 476 | Ga0501074_0012514 | 3300049590 | Bacteria | 6168 |
| 477 | Ga0501074_0254250 | 3300049590 | Bacteria | 1249 |
| 478 | Ga0501075_0174781 | 3300049591 | Bacteria | 1639 |
| 479 | Ga0501079_0005400 | 3300049741 | Bacteria | 9516 |
| 480 | Ga0501080_0005179 | 3300049742 | Bacteria | 11616 |
| 481 | Ga0501080_0006135 | 3300049742 | Bacteria | 10780 |
| 482 | Ga0501080_0022489 | 3300049742 | Bacteria | 5840 |
| 483 | Ga0501083_0372305 | 3300049744 | Bacteria | 929 |
| 484 | Ga0501035_0000542 | 3300049822 | Bacteria | 41925 |
| 485 | Ga0501044_0000153 | 3300049823 | Bacteria | 85673 |
| 486 | Ga0501044_0104873 | 3300049823 | Bacteria | 2840 |
| 487 | Ga0501044_0202515 | 3300049823 | Bacteria | 1942 |
| 488 | Ga0501044_0549421 | 3300049823 | Bacteria | 1052 |
| 489 | nmdc:mga03n38_16394_c1 | 3300050490 | Bacteria | 2881 |
| 490 | nmdc:mga03n38_34464_c1 | 3300050490 | Bacteria | 2162 |
| 491 | nmdc:mga03n38_85533_c1 | 3300050490 | Bacteria | 1491 |
| 492 | nmdc:mga00v17_142821_c1 | 3300050491 | Bacteria | 1536 |
| 493 | nmdc:mga00v17_223958_c1 | 3300050491 | Bacteria | 1218 |
| 494 | nmdc:mga00v17_706_c1 | 3300050491 | Bacteria | 18264 |
| 495 | nmdc:mga00v17_99479_c1 | 3300050491 | Bacteria | 1834 |
| 496 | nmdc:mga0yw44_36007_c1 | 3300050492 | Bacteria | 2914 |
| 497 | nmdc:mga0yw44_51865_c1 | 3300050492 | Bacteria | 2485 |
| 498 | nmdc:mga06z11_101550_c1 | 3300050494 | Bacteria | 1579 |
| 499 | nmdc:mga04h51_8892_c3 | 3300050495 | Bacteria | 1611 |
| 500 | nmdc:mga07m45_13340_c1 | 3300050496 | Bacteria | 4359 |
| 501 | nmdc:mga07m45_313795_c1 | 3300050496 | Bacteria | 911 |
| 502 | nmdc:mga0qj67_187148_c1 | 3300050509 | Bacteria | 1682 |
| 503 | nmdc:mga0qj67_47743_c1 | 3300050509 | Bacteria | 3382 |
| 504 | nmdc:mga06r32_547386_c1 | 3300050510 | Bacteria | 1131 |
| 505 | nmdc:mga08y16_93805_c1 | 3300050511 | Bacteria | 3127 |
| 506 | nmdc:mga0sz30_11352_c1 | 3300050516 | Bacteria | 3438 |
| 507 | Ga0495601_0128855 | 3300053077 | Bacteria | 1647 |
| 508 | Ga0500635_0006292 | 3300053080 | Bacteria | 3163 |
| 509 | Ga0500583_0043402 | 3300053092 | Bacteria | 2054 |
| 510 | Ga0500642_0033937 | 3300053130 | Bacteria | 2155 |
| 511 | Ga0500564_023134 | 3300053138 | Bacteria | 2847 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2939582691 | 2939586381 | 246 |
| 2 | 3300046459 | Ga0495629_0199906 | Ga0495629_0199906_498_1277 | 248 |
| 3 | 3300032002 | Ga0307416_100084851 | Ga0307416_1000848511 | 249 |
| 4 | iso_pu_bacteria | 2523231044 | 2523384694 | 249 |
| 5 | iso_pu_bacteria | 2565956761 | 2566993509 | 249 |
| 6 | iso_pu_bacteria | 2626541554 | 2626634603 | 249 |
| 7 | iso_pu_bacteria | 2626541554 | 2626636392 | 249 |
| 8 | iso_pu_bacteria | 2643221715 | 2644639405 | 249 |
| 9 | iso_pu_bacteria | 2671180195 | 2671838516 | 249 |
| 10 | iso_pu_bacteria | 2675903059 | 2676484217 | 249 |
| 11 | iso_pu_bacteria | 2738541308 | 2738889305 | 249 |
| 12 | iso_pu_bacteria | 2738543011 | 2739239564 | 249 |
| 13 | iso_pu_bacteria | 2751185725 | 2753036081 | 249 |
| 14 | iso_pu_bacteria | 2751185792 | 2753323953 | 249 |
| 15 | iso_pu_bacteria | 2773857922 | 2774856672 | 249 |
| 16 | iso_pu_bacteria | 2842134933 | 2842139723 | 249 |
| 17 | iso_pu_bacteria | 2889300758 | 2889304758 | 249 |
| 18 | iso_pu_bacteria | 2904535858 | 2904537222 | 249 |
| 19 | iso_pu_bacteria | 2904765812 | 2904770480 | 249 |
| 20 | iso_pu_bacteria | 2904770941 | 2904771562 | 249 |
| 21 | iso_pu_bacteria | 2908811453 | 2908812353 | 249 |
| 22 | iso_pu_bacteria | 2919420072 | 2919422929 | 249 |
| 23 | iso_pu_bacteria | 2919432681 | 2919435537 | 249 |
| 24 | iso_pu_bacteria | 2922554459 | 2922559847 | 249 |
| 25 | iso_pu_bacteria | 2929212328 | 2929217592 | 249 |
| 26 | iso_pu_bacteria | 2939743619 | 2939746658 | 249 |
| 27 | iso_pu_bacteria | 8054913762 | 8054919652 | 249 |
| 28 | iso_pu_bacteria | 8054920844 | 8054922701 | 249 |
| 29 | 3300003792 | Ga0055540_1017258 | Ga0055540_10172581 | 250 |
| 30 | 3300005455 | Ga0070663_100157177 | Ga0070663_1001571773 | 250 |
| 31 | 3300025303 | Ga0209051_1003970 | Ga0209051_10039703 | 250 |
| 32 | 3300026067 | Ga0207678_10062050 | Ga0207678_100620503 | 250 |
| 33 | 3300041413 | Ga0439465_0011440 | Ga0439465_0011440_610_1362 | 250 |
| 34 | 3300042156 | Ga0439446_0013495 | Ga0439446_0013495_1080_1832 | 250 |
| 35 | 3300042435 | Ga0439434_0010885 | Ga0439434_0010885_717_1469 | 250 |
| 36 | 3300044694 | Ga0466963_0053943 | Ga0466963_0053943_1332_2087 | 250 |
| 37 | 3300045976 | Ga0466967_0317126 | Ga0466967_0317126_634_1389 | 250 |
| 38 | 3300048922 | Ga0496119_0052621 | Ga0496119_0052621_1230_1982 | 250 |
| 39 | 3300049574 | Ga0501038_0315118 | Ga0501038_0315118_412_1164 | 250 |
| 40 | 3300049742 | Ga0501080_0022489 | Ga0501080_0022489_3962_4714 | 250 |
| 41 | iso_pu_bacteria | 2939582691 | 2939586409 | 250 |
| 42 | 3300048924 | Ga0496121_0022738 | Ga0496121_0022738_4196_4951 | 251 |
| 43 | iso_pu_bacteria | 2508501039 | 2508676510 | 251 |
| 44 | iso_pu_bacteria | 2675902999 | 2676200588 | 251 |
| 45 | iso_pu_bacteria | 2684623035 | 2686534651 | 251 |
| 46 | iso_pu_bacteria | 2687453737 | 2689956921 | 251 |
| 47 | iso_pu_bacteria | 2773857921 | 2774845166 | 251 |
| 48 | iso_pu_bacteria | 2857481737 | 2857484007 | 251 |
| 49 | iso_pu_bacteria | 2895880812 | 2895887513 | 251 |
| 50 | 3300005338 | Ga0068868_100314983 | Ga0068868_1003149832 | 252 |
| 51 | 3300005841 | Ga0068863_100004380 | Ga0068863_10000438010 | 252 |
| 52 | 3300006353 | Ga0075370_10139803 | Ga0075370_101398032 | 252 |
| 53 | 3300009098 | Ga0105245_10232597 | Ga0105245_102325972 | 252 |
| 54 | 3300025303 | Ga0209051_1001401 | Ga0209051_100140111 | 252 |
| 55 | 3300025927 | Ga0207687_10200311 | Ga0207687_102003112 | 252 |
| 56 | 3300025938 | Ga0207704_10432083 | Ga0207704_104320832 | 252 |
| 57 | 3300026067 | Ga0207678_10086091 | Ga0207678_100860913 | 252 |
| 58 | 3300026088 | Ga0207641_10000451 | Ga0207641_1000045141 | 252 |
| 59 | 3300042438 | Ga0439459_0010171 | Ga0439459_0010171_827_1585 | 252 |
| 60 | 3300046461 | Ga0495641_0100906 | Ga0495641_0100906_297_1064 | 252 |
| 61 | 3300046511 | Ga0495608_0081819 | Ga0495608_0081819_1299_2066 | 252 |
| 62 | 3300047319 | Ga0495674_0130847 | Ga0495674_0130847_506_1273 | 252 |
| 63 | 3300048904 | Ga0496101_0005417 | Ga0496101_0005417_6944_7702 | 252 |
| 64 | 3300048905 | Ga0496102_0355879 | Ga0496102_0355879_36_803 | 252 |
| 65 | 3300048908 | Ga0496105_0231220 | Ga0496105_0231220_336_1103 | 252 |
| 66 | 3300048915 | Ga0496112_0003946 | Ga0496112_0003946_2472_3230 | 252 |
| 67 | 3300048916 | Ga0496113_0000098 | Ga0496113_0000098_544_1302 | 252 |
| 68 | 3300048917 | Ga0496114_0020021 | Ga0496114_0020021_2930_3697 | 252 |
| 69 | 3300048917 | Ga0496114_0152767 | Ga0496114_0152767_702_1469 | 252 |
| 70 | 3300048925 | Ga0496122_0000305 | Ga0496122_0000305_30962_31720 | 252 |
| 71 | 3300048926 | Ga0496123_0000284 | Ga0496123_0000284_44291_45049 | 252 |
| 72 | 3300048929 | Ga0496126_0002421 | Ga0496126_0002421_17838_18596 | 252 |
| 73 | iso_pu_bacteria | 2643221576 | 2643892633 | 252 |
| 74 | iso_pu_bacteria | 2643221590 | 2643962082 | 252 |
| 75 | iso_pu_bacteria | 2902837492 | 2902839922 | 252 |
| 76 | 3300001989 | JGI24739J22299_10043323 | JGI24739J22299_100433232 | 253 |
| 77 | 3300001991 | JGI24743J22301_10005260 | JGI24743J22301_100052602 | 253 |
| 78 | 3300002075 | JGI24738J21930_10002619 | JGI24738J21930_100026194 | 253 |
| 79 | 3300002076 | JGI24749J21850_1001821 | JGI24749J21850_10018213 | 253 |
| 80 | 3300005329 | Ga0070683_100008598 | Ga0070683_1000085983 | 253 |
| 81 | 3300005329 | Ga0070683_100039018 | Ga0070683_1000390184 | 253 |
| 82 | 3300005331 | Ga0070670_100473148 | Ga0070670_1004731482 | 253 |
| 83 | 3300005337 | Ga0070682_100006879 | Ga0070682_1000068797 | 253 |
| 84 | 3300005338 | Ga0068868_100166625 | Ga0068868_1001666252 | 253 |
| 85 | 3300005340 | Ga0070689_100404469 | Ga0070689_1004044691 | 253 |
| 86 | 3300005341 | Ga0070691_10028587 | Ga0070691_100285872 | 253 |
| 87 | 3300005347 | Ga0070668_100144125 | Ga0070668_1001441252 | 253 |
| 88 | 3300005347 | Ga0070668_100410414 | Ga0070668_1004104141 | 253 |
| 89 | 3300005355 | Ga0070671_100000270 | Ga0070671_10000027018 | 253 |
| 90 | 3300005356 | Ga0070674_100019096 | Ga0070674_1000190962 | 253 |
| 91 | 3300005356 | Ga0070674_100140845 | Ga0070674_1001408451 | 253 |
| 92 | 3300005356 | Ga0070674_100165573 | Ga0070674_1001655732 | 253 |
| 93 | 3300005365 | Ga0070688_100159175 | Ga0070688_1001591752 | 253 |
| 94 | 3300005366 | Ga0070659_100135186 | Ga0070659_1001351862 | 253 |
| 95 | 3300005367 | Ga0070667_100017933 | Ga0070667_1000179336 | 253 |
| 96 | 3300005367 | Ga0070667_100330515 | Ga0070667_1003305152 | 253 |
| 97 | 3300005435 | Ga0070714_100027179 | Ga0070714_1000271794 | 253 |
| 98 | 3300005435 | Ga0070714_100279496 | Ga0070714_1002794961 | 253 |
| 99 | 3300005436 | Ga0070713_100001021 | Ga0070713_10000102116 | 253 |
| 100 | 3300005436 | Ga0070713_100432501 | Ga0070713_1004325011 | 253 |
| 101 | 3300005437 | Ga0070710_10000886 | Ga0070710_100008866 | 253 |
| 102 | 3300005437 | Ga0070710_10045038 | Ga0070710_100450382 | 253 |
| 103 | 3300005437 | Ga0070710_10169214 | Ga0070710_101692142 | 253 |
| 104 | 3300005438 | Ga0070701_10015672 | Ga0070701_100156722 | 253 |
| 105 | 3300005441 | Ga0070700_100002013 | Ga0070700_1000020133 | 253 |
| 106 | 3300005441 | Ga0070700_100015776 | Ga0070700_1000157766 | 253 |
| 107 | 3300005445 | Ga0070708_100005219 | Ga0070708_10000521910 | 253 |
| 108 | 3300005445 | Ga0070708_100027390 | Ga0070708_1000273903 | 253 |
| 109 | 3300005459 | Ga0068867_100006376 | Ga0068867_1000063762 | 253 |
| 110 | 3300005466 | Ga0070685_10059495 | Ga0070685_100594952 | 253 |
| 111 | 3300005467 | Ga0070706_100014393 | Ga0070706_1000143935 | 253 |
| 112 | 3300005467 | Ga0070706_100263900 | Ga0070706_1002639003 | 253 |
| 113 | 3300005468 | Ga0070707_100022878 | Ga0070707_1000228788 | 253 |
| 114 | 3300005468 | Ga0070707_100053905 | Ga0070707_1000539053 | 253 |
| 115 | 3300005468 | Ga0070707_100213658 | Ga0070707_1002136582 | 253 |
| 116 | 3300005471 | Ga0070698_100020408 | Ga0070698_1000204086 | 253 |
| 117 | 3300005471 | Ga0070698_100117098 | Ga0070698_1001170982 | 253 |
| 118 | 3300005518 | Ga0070699_100001180 | Ga0070699_10000118024 | 253 |
| 119 | 3300005530 | Ga0070679_100125377 | Ga0070679_1001253772 | 253 |
| 120 | 3300005535 | Ga0070684_100213867 | Ga0070684_1002138672 | 253 |
| 121 | 3300005536 | Ga0070697_100034421 | Ga0070697_1000344215 | 253 |
| 122 | 3300005543 | Ga0070672_100005018 | Ga0070672_1000050182 | 253 |
| 123 | 3300005546 | Ga0070696_100087653 | Ga0070696_1000876531 | 253 |
| 124 | 3300005547 | Ga0070693_100108396 | Ga0070693_1001083962 | 253 |
| 125 | 3300005548 | Ga0070665_100003024 | Ga0070665_10000302415 | 253 |
| 126 | 3300005615 | Ga0070702_100051111 | Ga0070702_1000511112 | 253 |
| 127 | 3300005616 | Ga0068852_100029346 | Ga0068852_1000293463 | 253 |
| 128 | 3300005617 | Ga0068859_100197406 | Ga0068859_1001974062 | 253 |
| 129 | 3300005618 | Ga0068864_100585082 | Ga0068864_1005850822 | 253 |
| 130 | 3300005718 | Ga0068866_10004033 | Ga0068866_100040332 | 253 |
| 131 | 3300005718 | Ga0068866_10176713 | Ga0068866_101767131 | 253 |
| 132 | 3300005719 | Ga0068861_100007505 | Ga0068861_1000075054 | 253 |
| 133 | 3300005719 | Ga0068861_100455866 | Ga0068861_1004558661 | 253 |
| 134 | 3300005841 | Ga0068863_100000322 | Ga0068863_10000032242 | 253 |
| 135 | 3300005841 | Ga0068863_100068275 | Ga0068863_1000682753 | 253 |
| 136 | 3300005841 | Ga0068863_100078278 | Ga0068863_1000782785 | 253 |
| 137 | 3300005842 | Ga0068858_100759246 | Ga0068858_1007592462 | 253 |
| 138 | 3300005843 | Ga0068860_100024247 | Ga0068860_1000242473 | 253 |
| 139 | 3300005843 | Ga0068860_100089480 | Ga0068860_1000894801 | 253 |
| 140 | 3300005844 | Ga0068862_100125825 | Ga0068862_1001258251 | 253 |
| 141 | 3300005844 | Ga0068862_100541194 | Ga0068862_1005411942 | 253 |
| 142 | 3300006028 | Ga0070717_10037001 | Ga0070717_100370013 | 253 |
| 143 | 3300006042 | Ga0075368_10076953 | Ga0075368_100769532 | 253 |
| 144 | 3300006051 | Ga0075364_10010113 | Ga0075364_100101135 | 253 |
| 145 | 3300006051 | Ga0075364_10043356 | Ga0075364_100433564 | 253 |
| 146 | 3300006051 | Ga0075364_10051858 | Ga0075364_100518583 | 253 |
| 147 | 3300006173 | Ga0070716_100119432 | Ga0070716_1001194322 | 253 |
| 148 | 3300006175 | Ga0070712_100204484 | Ga0070712_1002044841 | 253 |
| 149 | 3300006178 | Ga0075367_10007920 | Ga0075367_100079205 | 253 |
| 150 | 3300006186 | Ga0075369_10001359 | Ga0075369_100013593 | 253 |
| 151 | 3300006353 | Ga0075370_10021490 | Ga0075370_100214904 | 253 |
| 152 | 3300006353 | Ga0075370_10059969 | Ga0075370_100599693 | 253 |
| 153 | 3300006358 | Ga0068871_100602260 | Ga0068871_1006022601 | 253 |
| 154 | 3300006844 | Ga0075428_100266996 | Ga0075428_1002669962 | 253 |
| 155 | 3300006881 | Ga0068865_100005567 | Ga0068865_1000055672 | 253 |
| 156 | 3300006881 | Ga0068865_100266448 | Ga0068865_1002664481 | 253 |
| 157 | 3300006931 | Ga0097620_100197422 | Ga0097620_1001974222 | 253 |
| 158 | 3300007788 | Ga0099795_10089946 | Ga0099795_100899462 | 253 |
| 159 | 3300009094 | Ga0111539_10212986 | Ga0111539_102129863 | 253 |
| 160 | 3300009098 | Ga0105245_10128789 | Ga0105245_101287892 | 253 |
| 161 | 3300009101 | Ga0105247_10156416 | Ga0105247_101564162 | 253 |
| 162 | 3300009148 | Ga0105243_10020187 | Ga0105243_100201875 | 253 |
| 163 | 3300009148 | Ga0105243_10683628 | Ga0105243_106836282 | 253 |
| 164 | 3300009148 | Ga0105243_10756918 | Ga0105243_107569181 | 253 |
| 165 | 3300009177 | Ga0105248_10032784 | Ga0105248_100327846 | 253 |
| 166 | 3300009553 | Ga0105249_10534976 | Ga0105249_105349762 | 253 |
| 167 | 3300010159 | Ga0099796_10073524 | Ga0099796_100735242 | 253 |
| 168 | 3300013105 | Ga0157369_10199570 | Ga0157369_101995703 | 253 |
| 169 | 3300013306 | Ga0163162_10375436 | Ga0163162_103754361 | 253 |
| 170 | 3300013308 | Ga0157375_10126026 | Ga0157375_101260262 | 253 |
| 171 | 3300014326 | Ga0157380_10010871 | Ga0157380_100108714 | 253 |
| 172 | 3300014326 | Ga0157380_10208820 | Ga0157380_102088202 | 253 |
| 173 | 3300014745 | Ga0157377_10016034 | Ga0157377_100160344 | 253 |
| 174 | 3300014968 | Ga0157379_10014763 | Ga0157379_100147635 | 253 |
| 175 | 3300017792 | Ga0163161_10059970 | Ga0163161_100599702 | 253 |
| 176 | 3300024225 | Ga0224572_1011402 | Ga0224572_10114022 | 253 |
| 177 | 3300025303 | Ga0209051_1000616 | Ga0209051_100061631 | 253 |
| 178 | 3300025303 | Ga0209051_1015166 | Ga0209051_10151664 | 253 |
| 179 | 3300025898 | Ga0207692_10003941 | Ga0207692_100039412 | 253 |
| 180 | 3300025898 | Ga0207692_10104260 | Ga0207692_101042601 | 253 |
| 181 | 3300025898 | Ga0207692_10263977 | Ga0207692_102639771 | 253 |
| 182 | 3300025899 | Ga0207642_10065607 | Ga0207642_100656071 | 253 |
| 183 | 3300025901 | Ga0207688_10005203 | Ga0207688_100052035 | 253 |
| 184 | 3300025905 | Ga0207685_10033167 | Ga0207685_100331672 | 253 |
| 185 | 3300025906 | Ga0207699_10036731 | Ga0207699_100367311 | 253 |
| 186 | 3300025906 | Ga0207699_10265499 | Ga0207699_102654991 | 253 |
| 187 | 3300025908 | Ga0207643_10010630 | Ga0207643_100106303 | 253 |
| 188 | 3300025910 | Ga0207684_10054123 | Ga0207684_100541233 | 253 |
| 189 | 3300025915 | Ga0207693_10099379 | Ga0207693_100993792 | 253 |
| 190 | 3300025915 | Ga0207693_10285145 | Ga0207693_102851452 | 253 |
| 191 | 3300025920 | Ga0207649_10165777 | Ga0207649_101657772 | 253 |
| 192 | 3300025922 | Ga0207646_10013591 | Ga0207646_100135919 | 253 |
| 193 | 3300025922 | Ga0207646_10024206 | Ga0207646_100242065 | 253 |
| 194 | 3300025925 | Ga0207650_10122473 | Ga0207650_101224732 | 253 |
| 195 | 3300025927 | Ga0207687_10093865 | Ga0207687_100938652 | 253 |
| 196 | 3300025928 | Ga0207700_10007399 | Ga0207700_100073994 | 253 |
| 197 | 3300025928 | Ga0207700_10277201 | Ga0207700_102772011 | 253 |
| 198 | 3300025929 | Ga0207664_10013054 | Ga0207664_100130545 | 253 |
| 199 | 3300025929 | Ga0207664_10032875 | Ga0207664_100328753 | 253 |
| 200 | 3300025931 | Ga0207644_10009239 | Ga0207644_100092394 | 253 |
| 201 | 3300025932 | Ga0207690_10097019 | Ga0207690_100970192 | 253 |
| 202 | 3300025935 | Ga0207709_10000326 | Ga0207709_1000032614 | 253 |
| 203 | 3300025935 | Ga0207709_10009878 | Ga0207709_100098784 | 253 |
| 204 | 3300025935 | Ga0207709_10478123 | Ga0207709_104781232 | 253 |
| 205 | 3300025936 | Ga0207670_10249171 | Ga0207670_102491712 | 253 |
| 206 | 3300025937 | Ga0207669_10013370 | Ga0207669_100133703 | 253 |
| 207 | 3300025937 | Ga0207669_10275438 | Ga0207669_102754382 | 253 |
| 208 | 3300025938 | Ga0207704_10286829 | Ga0207704_102868291 | 253 |
| 209 | 3300025939 | Ga0207665_10005355 | Ga0207665_100053559 | 253 |
| 210 | 3300025939 | Ga0207665_10217633 | Ga0207665_102176332 | 253 |
| 211 | 3300025940 | Ga0207691_10001264 | Ga0207691_100012649 | 253 |
| 212 | 3300025944 | Ga0207661_10011662 | Ga0207661_100116622 | 253 |
| 213 | 3300025944 | Ga0207661_10095745 | Ga0207661_100957452 | 253 |
| 214 | 3300025944 | Ga0207661_10105679 | Ga0207661_101056791 | 253 |
| 215 | 3300025961 | Ga0207712_10105870 | Ga0207712_101058702 | 253 |
| 216 | 3300025972 | Ga0207668_10148982 | Ga0207668_101489822 | 253 |
| 217 | 3300025981 | Ga0207640_10369205 | Ga0207640_103692051 | 253 |
| 218 | 3300025986 | Ga0207658_10011542 | Ga0207658_100115425 | 253 |
| 219 | 3300025986 | Ga0207658_10294580 | Ga0207658_102945802 | 253 |
| 220 | 3300026023 | Ga0207677_10271634 | Ga0207677_102716342 | 253 |
| 221 | 3300026035 | Ga0207703_10628482 | Ga0207703_106284821 | 253 |
| 222 | 3300026041 | Ga0207639_10016541 | Ga0207639_100165413 | 253 |
| 223 | 3300026075 | Ga0207708_10000259 | Ga0207708_100002596 | 253 |
| 224 | 3300026075 | Ga0207708_10134749 | Ga0207708_101347492 | 253 |
| 225 | 3300026075 | Ga0207708_10247228 | Ga0207708_102472281 | 253 |
| 226 | 3300026088 | Ga0207641_10007659 | Ga0207641_100076597 | 253 |
| 227 | 3300026088 | Ga0207641_10007845 | Ga0207641_100078456 | 253 |
| 228 | 3300026088 | Ga0207641_10182740 | Ga0207641_101827401 | 253 |
| 229 | 3300026089 | Ga0207648_10008057 | Ga0207648_100080575 | 253 |
| 230 | 3300026095 | Ga0207676_10722529 | Ga0207676_107225292 | 253 |
| 231 | 3300026118 | Ga0207675_100023956 | Ga0207675_1000239564 | 253 |
| 232 | 3300026118 | Ga0207675_100527793 | Ga0207675_1005277931 | 253 |
| 233 | 3300026118 | Ga0207675_100758976 | Ga0207675_1007589761 | 253 |
| 234 | 3300026142 | Ga0207698_10036576 | Ga0207698_100365763 | 253 |
| 235 | 3300028379 | Ga0268266_10014404 | Ga0268266_100144046 | 253 |
| 236 | 3300028379 | Ga0268266_10659981 | Ga0268266_106599812 | 253 |
| 237 | 3300030744 | Ga0316181_1130982 | Ga0316181_11309821 | 253 |
| 238 | 3300031090 | Ga0265760_10004461 | Ga0265760_100044613 | 253 |
| 239 | 3300031728 | Ga0316578_10059347 | Ga0316578_100593473 | 253 |
| 240 | 3300031852 | Ga0307410_10047047 | Ga0307410_100470473 | 253 |
| 241 | 3300031852 | Ga0307410_10309866 | Ga0307410_103098661 | 253 |
| 242 | 3300031995 | Ga0307409_100061770 | Ga0307409_1000617702 | 253 |
| 243 | 3300031995 | Ga0307409_100381741 | Ga0307409_1003817411 | 253 |
| 244 | 3300032004 | Ga0307414_10259064 | Ga0307414_102590642 | 253 |
| 245 | 3300032004 | Ga0307414_10394244 | Ga0307414_103942441 | 253 |
| 246 | 3300032126 | Ga0307415_100104290 | Ga0307415_1001042901 | 253 |
| 247 | 3300033180 | Ga0307510_10098693 | Ga0307510_100986931 | 253 |
| 248 | 3300035691 | Ga0373931_0277452 | Ga0373931_0277452_19_789 | 253 |
| 249 | 3300036712 | Ga0316584_0081905 | Ga0316584_0081905_1152_1913 | 253 |
| 250 | 3300037471 | Ga0395905_0460069 | Ga0395905_0460069_328_1089 | 253 |
| 251 | 3300039437 | Ga0436365_0556286 | Ga0436365_0556286_13103_13864 | 253 |
| 252 | 3300039447 | Ga0436361_0808268 | Ga0436361_0808268_678_1439 | 253 |
| 253 | 3300041411 | Ga0439466_0017642 | Ga0439466_0017642_964_1725 | 253 |
| 254 | 3300041413 | Ga0439465_0009544 | Ga0439465_0009544_617_1378 | 253 |
| 255 | 3300041413 | Ga0439465_0015182 | Ga0439465_0015182_936_1703 | 253 |
| 256 | 3300041460 | Ga0451802_0674418 | Ga0451802_0674418_305_1066 | 253 |
| 257 | 3300041507 | Ga0451851_0962111 | Ga0451851_0962111_45_806 | 253 |
| 258 | 3300044658 | Ga0466972_0137161 | Ga0466972_0137161_234_995 | 253 |
| 259 | 3300044683 | Ga0466965_0004053 | Ga0466965_0004053_1363_2124 | 253 |
| 260 | 3300044683 | Ga0466965_0328782 | Ga0466965_0328782_13_774 | 253 |
| 261 | 3300044684 | Ga0466966_0012519 | Ga0466966_0012519_849_1610 | 253 |
| 262 | 3300044684 | Ga0466966_0052297 | Ga0466966_0052297_520_1281 | 253 |
| 263 | 3300044684 | Ga0466966_0212772 | Ga0466966_0212772_317_1078 | 253 |
| 264 | 3300044684 | Ga0466966_0372861 | Ga0466966_0372861_83_844 | 253 |
| 265 | 3300044693 | Ga0466961_0008672 | Ga0466961_0008672_752_1513 | 253 |
| 266 | 3300044693 | Ga0466961_0017087 | Ga0466961_0017087_1617_2378 | 253 |
| 267 | 3300044694 | Ga0466963_0150474 | Ga0466963_0150474_815_1576 | 253 |
| 268 | 3300044706 | Ga0466964_0019807 | Ga0466964_0019807_1215_1976 | 253 |
| 269 | 3300044706 | Ga0466964_0069472 | Ga0466964_0069472_208_969 | 253 |
| 270 | 3300044719 | Ga0466971_0132695 | Ga0466971_0132695_147_908 | 253 |
| 271 | 3300044735 | Ga0466968_0000471 | Ga0466968_0000471_3116_3877 | 253 |
| 272 | 3300044765 | Ga0466970_0020859 | Ga0466970_0020859_1830_2591 | 253 |
| 273 | 3300044765 | Ga0466970_0054923 | Ga0466970_0054923_1090_1851 | 253 |
| 274 | 3300044765 | Ga0466970_0091699 | Ga0466970_0091699_311_1072 | 253 |
| 275 | 3300044842 | Ga0466957_0094843 | Ga0466957_0094843_415_1176 | 253 |
| 276 | 3300044842 | Ga0466957_0172622 | Ga0466957_0172622_369_1130 | 253 |
| 277 | 3300044901 | Ga0466960_0095201 | Ga0466960_0095201_140_904 | 253 |
| 278 | 3300044901 | Ga0466960_0242797 | Ga0466960_0242797_89_850 | 253 |
| 279 | 3300045049 | Ga0466959_0021896 | Ga0466959_0021896_2331_3092 | 253 |
| 280 | 3300045049 | Ga0466959_0066205 | Ga0466959_0066205_369_1130 | 253 |
| 281 | 3300045049 | Ga0466959_0112041 | Ga0466959_0112041_1092_1853 | 253 |
| 282 | 3300045976 | Ga0466967_0001676 | Ga0466967_0001676_5871_6632 | 253 |
| 283 | 3300045976 | Ga0466967_0033143 | Ga0466967_0033143_1253_2014 | 253 |
| 284 | 3300045976 | Ga0466967_0084090 | Ga0466967_0084090_2039_2800 | 253 |
| 285 | 3300045976 | Ga0466967_0098674 | Ga0466967_0098674_941_1705 | 253 |
| 286 | 3300045976 | Ga0466967_0173819 | Ga0466967_0173819_102_863 | 253 |
| 287 | 3300045976 | Ga0466967_0327179 | Ga0466967_0327179_676_1437 | 253 |
| 288 | 3300045976 | Ga0466967_0414764 | Ga0466967_0414764_405_1166 | 253 |
| 289 | 3300045976 | Ga0466967_0427075 | Ga0466967_0427075_499_1269 | 253 |
| 290 | 3300046477 | Ga0495664_0064395 | Ga0495664_0064395_201_962 | 253 |
| 291 | 3300046511 | Ga0495608_0082888 | Ga0495608_0082888_484_1248 | 253 |
| 292 | 3300046524 | Ga0495648_0211689 | Ga0495648_0211689_170_931 | 253 |
| 293 | 3300046529 | Ga0495652_0056247 | Ga0495652_0056247_1577_2341 | 253 |
| 294 | 3300046529 | Ga0495652_0108592 | Ga0495652_0108592_776_1540 | 253 |
| 295 | 3300046543 | Ga0495645_0336541 | Ga0495645_0336541_55_816 | 253 |
| 296 | 3300046559 | Ga0495667_0049186 | Ga0495667_0049186_1077_1841 | 253 |
| 297 | 3300046674 | Ga0495588_0120490 | Ga0495588_0120490_426_1187 | 253 |
| 298 | 3300046675 | Ga0495657_0015958 | Ga0495657_0015958_845_1609 | 253 |
| 299 | 3300046678 | Ga0495599_0200117 | Ga0495599_0200117_395_1159 | 253 |
| 300 | 3300047320 | Ga0495672_0216222 | Ga0495672_0216222_55_816 | 253 |
| 301 | 3300047471 | Ga0495684_0065447 | Ga0495684_0065447_805_1569 | 253 |
| 302 | 3300048904 | Ga0496101_0003048 | Ga0496101_0003048_6657_7418 | 253 |
| 303 | 3300048905 | Ga0496102_0000020 | Ga0496102_0000020_118352_119113 | 253 |
| 304 | 3300048905 | Ga0496102_0291868 | Ga0496102_0291868_106_870 | 253 |
| 305 | 3300048906 | Ga0496103_0000011 | Ga0496103_0000011_229595_230356 | 253 |
| 306 | 3300048906 | Ga0496103_0249281 | Ga0496103_0249281_170_931 | 253 |
| 307 | 3300048907 | Ga0496104_0047583 | Ga0496104_0047583_454_1215 | 253 |
| 308 | 3300048908 | Ga0496105_0282432 | Ga0496105_0282432_417_1178 | 253 |
| 309 | 3300048910 | Ga0496107_0071384 | Ga0496107_0071384_707_1468 | 253 |
| 310 | 3300048910 | Ga0496107_0075387 | Ga0496107_0075387_1467_2228 | 253 |
| 311 | 3300048910 | Ga0496107_0102983 | Ga0496107_0102983_1299_2060 | 253 |
| 312 | 3300048911 | Ga0496108_0046829 | Ga0496108_0046829_333_1115 | 253 |
| 313 | 3300048911 | Ga0496108_0290464 | Ga0496108_0290464_521_1282 | 253 |
| 314 | 3300048912 | Ga0496109_0097341 | Ga0496109_0097341_1805_2566 | 253 |
| 315 | 3300048912 | Ga0496109_0375849 | Ga0496109_0375849_536_1297 | 253 |
| 316 | 3300048913 | Ga0496110_0069505 | Ga0496110_0069505_543_1325 | 253 |
| 317 | 3300048913 | Ga0496110_0097720 | Ga0496110_0097720_1217_1978 | 253 |
| 318 | 3300048913 | Ga0496110_0163681 | Ga0496110_0163681_112_876 | 253 |
| 319 | 3300048913 | Ga0496110_0329234 | Ga0496110_0329234_521_1282 | 253 |
| 320 | 3300048914 | Ga0496111_0117709 | Ga0496111_0117709_311_1075 | 253 |
| 321 | 3300048915 | Ga0496112_0213272 | Ga0496112_0213272_553_1323 | 253 |
| 322 | 3300048917 | Ga0496114_0132126 | Ga0496114_0132126_1049_1810 | 253 |
| 323 | 3300048917 | Ga0496114_0169339 | Ga0496114_0169339_1003_1767 | 253 |
| 324 | 3300048919 | Ga0496116_0000067 | Ga0496116_0000067_118337_119098 | 253 |
| 325 | 3300048920 | Ga0496117_0000192 | Ga0496117_0000192_5477_6238 | 253 |
| 326 | 3300048921 | Ga0496118_0000076 | Ga0496118_0000076_118326_119087 | 253 |
| 327 | 3300048922 | Ga0496119_0000237 | Ga0496119_0000237_76166_76927 | 253 |
| 328 | 3300048924 | Ga0496121_0005722 | Ga0496121_0005722_8556_9317 | 253 |
| 329 | 3300048927 | Ga0496124_0041933 | Ga0496124_0041933_2165_2926 | 253 |
| 330 | 3300048927 | Ga0496124_0363031 | Ga0496124_0363031_213_974 | 253 |
| 331 | 3300048929 | Ga0496126_0000080 | Ga0496126_0000080_102513_103274 | 253 |
| 332 | 3300049568 | Ga0501031_0308265 | Ga0501031_0308265_146_916 | 253 |
| 333 | 3300049569 | Ga0501032_0051892 | Ga0501032_0051892_871_1632 | 253 |
| 334 | 3300049571 | Ga0501034_0058099 | Ga0501034_0058099_1826_2587 | 253 |
| 335 | 3300049572 | Ga0501036_0064777 | Ga0501036_0064777_575_1342 | 253 |
| 336 | 3300049574 | Ga0501038_0117657 | Ga0501038_0117657_608_1375 | 253 |
| 337 | 3300049575 | Ga0501039_0129041 | Ga0501039_0129041_507_1274 | 253 |
| 338 | 3300049578 | Ga0501042_0389309 | Ga0501042_0389309_37_798 | 253 |
| 339 | 3300049579 | Ga0501043_0312475 | Ga0501043_0312475_20_781 | 253 |
| 340 | 3300049580 | Ga0501046_0000489 | Ga0501046_0000489_2547_3308 | 253 |
| 341 | 3300049581 | Ga0501047_0014088 | Ga0501047_0014088_2316_3077 | 253 |
| 342 | 3300049582 | Ga0501048_0180373 | Ga0501048_0180373_92_853 | 253 |
| 343 | 3300049583 | Ga0501067_0026580 | Ga0501067_0026580_949_1710 | 253 |
| 344 | 3300049584 | Ga0501068_0184077 | Ga0501068_0184077_25_786 | 253 |
| 345 | 3300049585 | Ga0501069_0002776 | Ga0501069_0002776_7680_8441 | 253 |
| 346 | 3300049586 | Ga0501070_0004050 | Ga0501070_0004050_1325_2086 | 253 |
| 347 | 3300049586 | Ga0501070_0019334 | Ga0501070_0019334_1242_2003 | 253 |
| 348 | 3300049586 | Ga0501070_0212967 | Ga0501070_0212967_781_1542 | 253 |
| 349 | 3300049587 | Ga0501071_0195248 | Ga0501071_0195248_363_1130 | 253 |
| 350 | 3300049588 | Ga0501072_0021610 | Ga0501072_0021610_124_891 | 253 |
| 351 | 3300049589 | Ga0501073_0030122 | Ga0501073_0030122_2868_3629 | 253 |
| 352 | 3300049590 | Ga0501074_0012514 | Ga0501074_0012514_4158_4919 | 253 |
| 353 | 3300049590 | Ga0501074_0254250 | Ga0501074_0254250_465_1232 | 253 |
| 354 | 3300049591 | Ga0501075_0174781 | Ga0501075_0174781_384_1151 | 253 |
| 355 | 3300049741 | Ga0501079_0005400 | Ga0501079_0005400_8446_9207 | 253 |
| 356 | 3300049742 | Ga0501080_0005179 | Ga0501080_0005179_1229_1990 | 253 |
| 357 | 3300049742 | Ga0501080_0006135 | Ga0501080_0006135_3277_4038 | 253 |
| 358 | 3300049744 | Ga0501083_0372305 | Ga0501083_0372305_80_847 | 253 |
| 359 | 3300049822 | Ga0501035_0000542 | Ga0501035_0000542_2905_3666 | 253 |
| 360 | 3300049823 | Ga0501044_0000153 | Ga0501044_0000153_47996_48757 | 253 |
| 361 | 3300049823 | Ga0501044_0104873 | Ga0501044_0104873_1323_2084 | 253 |
| 362 | 3300049823 | Ga0501044_0202515 | Ga0501044_0202515_484_1245 | 253 |
| 363 | 3300049823 | Ga0501044_0549421 | Ga0501044_0549421_224_985 | 253 |
| 364 | 3300050490 | nmdc:mga03n38_16394_c1 | nmdc:mga03n38_16394_c1_245_1006 | 253 |
| 365 | 3300050490 | nmdc:mga03n38_34464_c1 | nmdc:mga03n38_34464_c1_960_1721 | 253 |
| 366 | 3300050490 | nmdc:mga03n38_85533_c1 | nmdc:mga03n38_85533_c1_709_1470 | 253 |
| 367 | 3300050491 | nmdc:mga00v17_142821_c1 | nmdc:mga00v17_142821_c1_268_1029 | 253 |
| 368 | 3300050491 | nmdc:mga00v17_223958_c1 | nmdc:mga00v17_223958_c1_153_923 | 253 |
| 369 | 3300050491 | nmdc:mga00v17_706_c1 | nmdc:mga00v17_706_c1_10937_11716 | 253 |
| 370 | 3300050491 | nmdc:mga00v17_99479_c1 | nmdc:mga00v17_99479_c1_325_1086 | 253 |
| 371 | 3300050492 | nmdc:mga0yw44_36007_c1 | nmdc:mga0yw44_36007_c1_1690_2451 | 253 |
| 372 | 3300050492 | nmdc:mga0yw44_51865_c1 | nmdc:mga0yw44_51865_c1_1366_2127 | 253 |
| 373 | 3300050494 | nmdc:mga06z11_101550_c1 | nmdc:mga06z11_101550_c1_35_796 | 253 |
| 374 | 3300050495 | nmdc:mga04h51_8892_c3 | nmdc:mga04h51_8892_c3_225_986 | 253 |
| 375 | 3300050496 | nmdc:mga07m45_13340_c1 | nmdc:mga07m45_13340_c1_2226_2987 | 253 |
| 376 | 3300050496 | nmdc:mga07m45_313795_c1 | nmdc:mga07m45_313795_c1_119_886 | 253 |
| 377 | 3300050509 | nmdc:mga0qj67_187148_c1 | nmdc:mga0qj67_187148_c1_266_1030 | 253 |
| 378 | 3300050511 | nmdc:mga08y16_93805_c1 | nmdc:mga08y16_93805_c1_959_1720 | 253 |
| 379 | 3300050516 | nmdc:mga0sz30_11352_c1 | nmdc:mga0sz30_11352_c1_732_1493 | 253 |
| 380 | 3300053077 | Ga0495601_0128855 | Ga0495601_0128855_861_1622 | 253 |
| 381 | 3300053080 | Ga0500635_0006292 | Ga0500635_0006292_1062_1823 | 253 |
| 382 | iso_pu_bacteria | 8054609563 | 8054613295 | 253 |
| 383 | 3300001977 | JGI24746J21847_1016435 | JGI24746J21847_10164352 | 254 |
| 384 | 3300001989 | JGI24739J22299_10080943 | JGI24739J22299_100809432 | 254 |
| 385 | 3300001991 | JGI24743J22301_10018135 | JGI24743J22301_100181352 | 254 |
| 386 | 3300002070 | JGI24750J21931_1017300 | JGI24750J21931_10173002 | 254 |
| 387 | 3300002073 | JGI24745J21846_1001374 | JGI24745J21846_10013742 | 254 |
| 388 | 3300002074 | JGI24748J21848_1007157 | JGI24748J21848_10071571 | 254 |
| 389 | 3300002075 | JGI24738J21930_10010017 | JGI24738J21930_100100172 | 254 |
| 390 | 3300002076 | JGI24749J21850_1014763 | JGI24749J21850_10147632 | 254 |
| 391 | 3300002077 | JGI24744J21845_10019574 | JGI24744J21845_100195742 | 254 |
| 392 | 3300002239 | JGI24034J26672_10009237 | JGI24034J26672_100092371 | 254 |
| 393 | 3300002244 | JGI24742J22300_10000474 | JGI24742J22300_100004742 | 254 |
| 394 | 3300003792 | Ga0055540_1000129 | Ga0055540_10001295 | 254 |
| 395 | 3300005335 | Ga0070666_10115051 | Ga0070666_101150512 | 254 |
| 396 | 3300005336 | Ga0070680_100077371 | Ga0070680_1000773712 | 254 |
| 397 | 3300005339 | Ga0070660_100121390 | Ga0070660_1001213903 | 254 |
| 398 | 3300005340 | Ga0070689_100018088 | Ga0070689_1000180884 | 254 |
| 399 | 3300005353 | Ga0070669_100107346 | Ga0070669_1001073462 | 254 |
| 400 | 3300005354 | Ga0070675_100229928 | Ga0070675_1002299282 | 254 |
| 401 | 3300005356 | Ga0070674_100333679 | Ga0070674_1003336791 | 254 |
| 402 | 3300005364 | Ga0070673_100052077 | Ga0070673_1000520775 | 254 |
| 403 | 3300005365 | Ga0070688_100215194 | Ga0070688_1002151941 | 254 |
| 404 | 3300005367 | Ga0070667_100000519 | Ga0070667_1000005197 | 254 |
| 405 | 3300005367 | Ga0070667_100094574 | Ga0070667_1000945742 | 254 |
| 406 | 3300005406 | Ga0070703_10037517 | Ga0070703_100375171 | 254 |
| 407 | 3300005434 | Ga0070709_10242953 | Ga0070709_102429532 | 254 |
| 408 | 3300005435 | Ga0070714_100314249 | Ga0070714_1003142491 | 254 |
| 409 | 3300005436 | Ga0070713_100082542 | Ga0070713_1000825423 | 254 |
| 410 | 3300005439 | Ga0070711_100372043 | Ga0070711_1003720431 | 254 |
| 411 | 3300005440 | Ga0070705_100137437 | Ga0070705_1001374371 | 254 |
| 412 | 3300005441 | Ga0070700_100108210 | Ga0070700_1001082102 | 254 |
| 413 | 3300005445 | Ga0070708_100164504 | Ga0070708_1001645042 | 254 |
| 414 | 3300005466 | Ga0070685_10133521 | Ga0070685_101335212 | 254 |
| 415 | 3300005467 | Ga0070706_100027755 | Ga0070706_1000277552 | 254 |
| 416 | 3300005468 | Ga0070707_100074196 | Ga0070707_1000741962 | 254 |
| 417 | 3300005471 | Ga0070698_100073794 | Ga0070698_1000737942 | 254 |
| 418 | 3300005471 | Ga0070698_100400557 | Ga0070698_1004005572 | 254 |
| 419 | 3300005543 | Ga0070672_100085830 | Ga0070672_1000858302 | 254 |
| 420 | 3300005544 | Ga0070686_100095559 | Ga0070686_1000955592 | 254 |
| 421 | 3300005545 | Ga0070695_100053073 | Ga0070695_1000530733 | 254 |
| 422 | 3300005547 | Ga0070693_100165906 | Ga0070693_1001659062 | 254 |
| 423 | 3300005548 | Ga0070665_100290377 | Ga0070665_1002903772 | 254 |
| 424 | 3300005577 | Ga0068857_100481814 | Ga0068857_1004818142 | 254 |
| 425 | 3300005614 | Ga0068856_100528614 | Ga0068856_1005286141 | 254 |
| 426 | 3300005617 | Ga0068859_100704293 | Ga0068859_1007042931 | 254 |
| 427 | 3300005618 | Ga0068864_100166763 | Ga0068864_1001667633 | 254 |
| 428 | 3300005618 | Ga0068864_100385535 | Ga0068864_1003855352 | 254 |
| 429 | 3300005834 | Ga0068851_10049835 | Ga0068851_100498352 | 254 |
| 430 | 3300005841 | Ga0068863_100298399 | Ga0068863_1002983992 | 254 |
| 431 | 3300005843 | Ga0068860_100346980 | Ga0068860_1003469802 | 254 |
| 432 | 3300005843 | Ga0068860_100418331 | Ga0068860_1004183312 | 254 |
| 433 | 3300005843 | Ga0068860_100430295 | Ga0068860_1004302952 | 254 |
| 434 | 3300005844 | Ga0068862_100000087 | Ga0068862_10000008718 | 254 |
| 435 | 3300005844 | Ga0068862_100273281 | Ga0068862_1002732811 | 254 |
| 436 | 3300005937 | Ga0081455_10010764 | Ga0081455_1001076410 | 254 |
| 437 | 3300006163 | Ga0070715_10016478 | Ga0070715_100164783 | 254 |
| 438 | 3300006175 | Ga0070712_100068958 | Ga0070712_1000689582 | 254 |
| 439 | 3300006846 | Ga0075430_100040540 | Ga0075430_1000405402 | 254 |
| 440 | 3300006931 | Ga0097620_100000055 | Ga0097620_10000005530 | 254 |
| 441 | 3300006931 | Ga0097620_100704312 | Ga0097620_1007043121 | 254 |
| 442 | 3300009092 | Ga0105250_10012859 | Ga0105250_100128592 | 254 |
| 443 | 3300009093 | Ga0105240_10176840 | Ga0105240_101768403 | 254 |
| 444 | 3300009101 | Ga0105247_10149142 | Ga0105247_101491423 | 254 |
| 445 | 3300009174 | Ga0105241_10268953 | Ga0105241_102689532 | 254 |
| 446 | 3300009545 | Ga0105237_10215049 | Ga0105237_102150492 | 254 |
| 447 | 3300009545 | Ga0105237_10489338 | Ga0105237_104893382 | 254 |
| 448 | 3300009551 | Ga0105238_10126521 | Ga0105238_101265212 | 254 |
| 449 | 3300010159 | Ga0099796_10156910 | Ga0099796_101569101 | 254 |
| 450 | 3300010375 | Ga0105239_10085466 | Ga0105239_100854664 | 254 |
| 451 | 3300010375 | Ga0105239_10276160 | Ga0105239_102761602 | 254 |
| 452 | 3300013100 | Ga0157373_10284146 | Ga0157373_102841462 | 254 |
| 453 | 3300013104 | Ga0157370_10153718 | Ga0157370_101537182 | 254 |
| 454 | 3300013306 | Ga0163162_10002540 | Ga0163162_1000254016 | 254 |
| 455 | 3300013307 | Ga0157372_10558655 | Ga0157372_105586552 | 254 |
| 456 | 3300014325 | Ga0163163_10009414 | Ga0163163_100094148 | 254 |
| 457 | 3300014326 | Ga0157380_10660754 | Ga0157380_106607541 | 254 |
| 458 | 3300014968 | Ga0157379_10113668 | Ga0157379_101136683 | 254 |
| 459 | 3300017792 | Ga0163161_10287138 | Ga0163161_102871381 | 254 |
| 460 | 3300025303 | Ga0209051_1000034 | Ga0209051_10000346 | 254 |
| 461 | 3300025321 | Ga0207656_10096492 | Ga0207656_100964922 | 254 |
| 462 | 3300025885 | Ga0207653_10004208 | Ga0207653_100042083 | 254 |
| 463 | 3300025900 | Ga0207710_10208236 | Ga0207710_102082362 | 254 |
| 464 | 3300025901 | Ga0207688_10017595 | Ga0207688_100175955 | 254 |
| 465 | 3300025903 | Ga0207680_10031067 | Ga0207680_100310674 | 254 |
| 466 | 3300025904 | Ga0207647_10052239 | Ga0207647_100522392 | 254 |
| 467 | 3300025907 | Ga0207645_10014546 | Ga0207645_100145464 | 254 |
| 468 | 3300025910 | Ga0207684_10130564 | Ga0207684_101305642 | 254 |
| 469 | 3300025912 | Ga0207707_10167309 | Ga0207707_101673092 | 254 |
| 470 | 3300025914 | Ga0207671_10094053 | Ga0207671_100940532 | 254 |
| 471 | 3300025914 | Ga0207671_10111649 | Ga0207671_101116492 | 254 |
| 472 | 3300025915 | Ga0207693_10032663 | Ga0207693_100326631 | 254 |
| 473 | 3300025918 | Ga0207662_10013789 | Ga0207662_100137893 | 254 |
| 474 | 3300025922 | Ga0207646_10027978 | Ga0207646_100279783 | 254 |
| 475 | 3300025926 | Ga0207659_10070262 | Ga0207659_100702622 | 254 |
| 476 | 3300025927 | Ga0207687_10143583 | Ga0207687_101435832 | 254 |
| 477 | 3300025928 | Ga0207700_10069990 | Ga0207700_100699902 | 254 |
| 478 | 3300025933 | Ga0207706_10025968 | Ga0207706_100259684 | 254 |
| 479 | 3300025937 | Ga0207669_10152284 | Ga0207669_101522842 | 254 |
| 480 | 3300025939 | Ga0207665_10008631 | Ga0207665_100086314 | 254 |
| 481 | 3300025940 | Ga0207691_10018114 | Ga0207691_100181145 | 254 |
| 482 | 3300025942 | Ga0207689_10007860 | Ga0207689_100078602 | 254 |
| 483 | 3300025949 | Ga0207667_10715179 | Ga0207667_107151791 | 254 |
| 484 | 3300025972 | Ga0207668_10558485 | Ga0207668_105584851 | 254 |
| 485 | 3300025986 | Ga0207658_10000774 | Ga0207658_100007744 | 254 |
| 486 | 3300026023 | Ga0207677_10134910 | Ga0207677_101349102 | 254 |
| 487 | 3300026041 | Ga0207639_10183159 | Ga0207639_101831592 | 254 |
| 488 | 3300026067 | Ga0207678_10035566 | Ga0207678_100355664 | 254 |
| 489 | 3300026075 | Ga0207708_10035467 | Ga0207708_100354672 | 254 |
| 490 | 3300026078 | Ga0207702_10112524 | Ga0207702_101125242 | 254 |
| 491 | 3300026078 | Ga0207702_10316120 | Ga0207702_103161201 | 254 |
| 492 | 3300026088 | Ga0207641_10354635 | Ga0207641_103546352 | 254 |
| 493 | 3300026089 | Ga0207648_10038279 | Ga0207648_100382793 | 254 |
| 494 | 3300026116 | Ga0207674_10832457 | Ga0207674_108324571 | 254 |
| 495 | 3300026118 | Ga0207675_100037603 | Ga0207675_1000376032 | 254 |
| 496 | 3300026121 | Ga0207683_10739548 | Ga0207683_107395481 | 254 |
| 497 | 3300028380 | Ga0268265_10000020 | Ga0268265_100000208 | 254 |
| 498 | 3300028380 | Ga0268265_10813356 | Ga0268265_108133561 | 254 |
| 499 | 3300031251 | Ga0265327_10001643 | Ga0265327_100016437 | 254 |
| 500 | 3300031251 | Ga0265327_10025928 | Ga0265327_100259282 | 254 |
| 501 | 3300035691 | Ga0373931_0067444 | Ga0373931_0067444_243_1007 | 254 |
| 502 | 3300037312 | Ga0395899_0089742 | Ga0395899_0089742_906_1670 | 254 |
| 503 | 3300037418 | Ga0395900_0538682 | Ga0395900_0538682_260_1024 | 254 |
| 504 | 3300037466 | Ga0395898_0005642 | Ga0395898_0005642_10651_11415 | 254 |
| 505 | 3300037466 | Ga0395898_0033513 | Ga0395898_0033513_1749_2513 | 254 |
| 506 | 3300037471 | Ga0395905_0043864 | Ga0395905_0043864_1671_2435 | 254 |
| 507 | 3300037853 | Ga0436364_1305262 | Ga0436364_1305262_242_1006 | 254 |
| 508 | 3300038443 | Ga0395901_0004342 | Ga0395901_0004342_4883_5647 | 254 |
| 509 | 3300038443 | Ga0395901_0014350 | Ga0395901_0014350_2568_3332 | 254 |
| 510 | 3300039437 | Ga0436365_0649704 | Ga0436365_0649704_2163_2927 | 254 |
| 511 | 3300047319 | Ga0495674_0103201 | Ga0495674_0103201_1422_2204 | 254 |
| 512 | 3300048903 | Ga0496100_0001882 | Ga0496100_0001882_6355_7137 | 254 |
| 513 | 3300048903 | Ga0496100_0177002 | Ga0496100_0177002_511_1275 | 254 |
| 514 | 3300048903 | Ga0496100_0536462 | Ga0496100_0536462_21_788 | 254 |
| 515 | 3300048904 | Ga0496101_0000190 | Ga0496101_0000190_41217_41999 | 254 |
| 516 | 3300048906 | Ga0496103_0001900 | Ga0496103_0001900_7470_8252 | 254 |
| 517 | 3300048907 | Ga0496104_0061356 | Ga0496104_0061356_448_1212 | 254 |
| 518 | 3300048909 | Ga0496106_0004364 | Ga0496106_0004364_6355_7137 | 254 |
| 519 | 3300048909 | Ga0496106_0113113 | Ga0496106_0113113_506_1270 | 254 |
| 520 | 3300048910 | Ga0496107_0001598 | Ga0496107_0001598_3359_4141 | 254 |
| 521 | 3300048910 | Ga0496107_0266604 | Ga0496107_0266604_240_1004 | 254 |
| 522 | 3300048911 | Ga0496108_0025850 | Ga0496108_0025850_3581_4363 | 254 |
| 523 | 3300048911 | Ga0496108_0148358 | Ga0496108_0148358_987_1754 | 254 |
| 524 | 3300048912 | Ga0496109_0005598 | Ga0496109_0005598_3392_4174 | 254 |
| 525 | 3300048912 | Ga0496109_0278841 | Ga0496109_0278841_677_1441 | 254 |
| 526 | 3300048913 | Ga0496110_0007092 | Ga0496110_0007092_6342_7124 | 254 |
| 527 | 3300048913 | Ga0496110_0092805 | Ga0496110_0092805_1722_2486 | 254 |
| 528 | 3300048914 | Ga0496111_0022789 | Ga0496111_0022789_234_1016 | 254 |
| 529 | 3300048917 | Ga0496114_0004789 | Ga0496114_0004789_6349_7131 | 254 |
| 530 | 3300048917 | Ga0496114_0033900 | Ga0496114_0033900_753_1517 | 254 |
| 531 | 3300048918 | Ga0496115_0011453 | Ga0496115_0011453_4899_5681 | 254 |
| 532 | 3300048918 | Ga0496115_0023437 | Ga0496115_0023437_1474_2241 | 254 |
| 533 | 3300048918 | Ga0496115_0104587 | Ga0496115_0104587_748_1512 | 254 |
| 534 | 3300048919 | Ga0496116_0008100 | Ga0496116_0008100_290_1072 | 254 |
| 535 | 3300048920 | Ga0496117_0057989 | Ga0496117_0057989_743_1525 | 254 |
| 536 | 3300048921 | Ga0496118_0026894 | Ga0496118_0026894_1328_2110 | 254 |
| 537 | 3300048922 | Ga0496119_0011441 | Ga0496119_0011441_3494_4276 | 254 |
| 538 | 3300048923 | Ga0496120_0053513 | Ga0496120_0053513_158_940 | 254 |
| 539 | 3300048924 | Ga0496121_0000002 | Ga0496121_0000002_314586_315368 | 254 |
| 540 | 3300048925 | Ga0496122_0008120 | Ga0496122_0008120_4302_5084 | 254 |
| 541 | 3300048926 | Ga0496123_0030579 | Ga0496123_0030579_2681_3463 | 254 |
| 542 | 3300048927 | Ga0496124_0000002 | Ga0496124_0000002_1179221_1180003 | 254 |
| 543 | 3300048928 | Ga0496125_0000002 | Ga0496125_0000002_314586_315368 | 254 |
| 544 | 3300048929 | Ga0496126_0000009 | Ga0496126_0000009_434983_435765 | 254 |
| 545 | 3300050509 | nmdc:mga0qj67_47743_c1 | nmdc:mga0qj67_47743_c1_2583_3347 | 254 |
| 546 | 3300050510 | nmdc:mga06r32_547386_c1 | nmdc:mga06r32_547386_c1_271_1035 | 254 |
| 547 | 3300053092 | Ga0500583_0043402 | Ga0500583_0043402_161_928 | 254 |
| 548 | 3300053130 | Ga0500642_0033937 | Ga0500642_0033937_1280_2044 | 254 |
| 549 | 3300053138 | Ga0500564_023134 | Ga0500564_023134_331_1113 | 254 |
| 550 | iso_pu_bacteria | 2738541264 | 2738668870 | 254 |
| 551 | iso_pu_bacteria | 2738541356 | 2739148162 | 254 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bmn-assembly1.cif.gz_D | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.9669 | 7 | 254 |
| 4i5d-assembly1.cif.gz_A | crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form | 0.9657 | 7 | 254 |
| 4jro-assembly1.cif.gz_C | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.9649 | 10 | 251 |
| 6ihi-assembly1.cif.gz_B | crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o | 0.9617 | 7 | 254 |
| 1vl8-assembly1.cif.gz_B | crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution | 0.9616 | 7 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vl8B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9616 | 7 | 254 | 3.40.50.720 |
| 3v2gA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9591 | 6 | 251 | 3.40.50.720 |
| 4urfA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9579 | 10 | 254 | 3.40.50.720 |
| 5t5qC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9576 | 6 | 251 | 3.40.50.720 |
| af_Q5BLE6_285_550_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9571 | 1 | 252 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X7Y0U1-F1-model_v4 | deleted | 0.9952 | 60 | 254 |
|
| AF-Q0RSM7-F1-model_v4 | Putative dehydrogenase (EC 1.1.1.-) | 0.9942 | 1 | 254 |
GO:0016616
|
| AF-A0A7U9KQA4-F1-model_v4 | Oxidoreductase | 0.9937 | 1 | 253 |
GO:0006633
GO:0016616 GO:0048038 |
| AF-A0A7L4Z8H6-F1-model_v4 | Glucose 1-dehydrogenase (EC 1.1.1.47) | 0.9907 | 1 | 254 |
GO:0006633
GO:0047936 GO:0048038 |
| AF-A0A7K0JPL2-F1-model_v4 | deleted | 0.9898 | 1 | 254 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar