F462616

General Info

Members Datasets Scaffolds Average Seq Length
551 325 511 254

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10285145|Ga0207693_102851452
Length 311
Sequence MAILDRFRLDDRVVIITGASAGLGVSFAEACAEAGADVVLAARRAEKLKETADLVRSAGRRALTVTTDVTDPRQCQAMADAAVEEFGRVDVLVNNAGVGTVVPATRETPEQFRSVIDTNLNGSYWAAQACGRIMQPGSSIVNISSVLGLTTAGLPEAAYSASKAGIIGLTRDLAQQWGFRKGIRVNAIAPGFFHSEMTDQLPPEYVANVARLNAATLASLALSPAPPSEVHLLTKQLENDSKIQWKPAPGATAYEVLWRKTTDADFPEENVQRTTEPKVDLTDSKDNVIFGVRSVDAKGHRSLIVIPEPER

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2626541554 Frankia sp. AvcI.1 Isolate Nodule
5 2643221576 Nocardioides sp. Root614 Isolate Unclassified
6 2643221590 Nocardioides sp. Root682 Isolate Unclassified
7 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
8 2671180195 Frankia sp. CcI49 Isolate Nodule
9 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
10 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
11 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
12 2687453737 Frankia sp. BMG5.36 Isolate Nodule
13 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
14 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
15 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
16 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
17 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
18 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
19 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
20 2773857922 Frankia sp. CcI49 Isolate Nodule
21 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
22 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
23 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
24 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
25 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
26 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
27 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
28 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
29 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
30 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
31 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
32 2922554459 Rhodococcus sp. 66b Isolate Unclassified
33 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
34 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
35 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
36 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
37 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
38 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
39 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
40 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
41 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
42 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
43 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
44 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
45 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
46 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
71 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
72 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
73 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
74 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
203 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
225 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
226 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
227 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
228 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
229 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
230 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
246 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
276 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
320 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
321 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
322 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
323 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
324 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
325 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 0.18
Isolates 7.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.17
Nodule 2.18
Rhizoplane 9.44
Rhizosphere 74.05
Stem 0
Stem Tuber 0
Unclassified 8.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1016435 3300001977 Bacteria 1057
2 JGI24739J22299_10043323 3300001989 Bacteria 1488
3 JGI24739J22299_10080943 3300001989 Bacteria 998
4 JGI24743J22301_10005260 3300001991 Bacteria 2151
5 JGI24743J22301_10018135 3300001991 Bacteria 1328
6 JGI24750J21931_1017300 3300002070 Bacteria 985
7 JGI24745J21846_1001374 3300002073 Bacteria 2350
8 JGI24748J21848_1007157 3300002074 Bacteria 1306
9 JGI24738J21930_10002619 3300002075 Bacteria 4640
10 JGI24738J21930_10010017 3300002075 Bacteria 2120
11 JGI24749J21850_1001821 3300002076 Bacteria 3017
12 JGI24749J21850_1014763 3300002076 Bacteria 1095
13 JGI24744J21845_10019574 3300002077 Bacteria 1338
14 JGI24034J26672_10009237 3300002239 Bacteria 1452
15 JGI24742J22300_10000474 3300002244 Bacteria 5970
16 Ga0055540_1000129 3300003792 Bacteria 76241
17 Ga0055540_1017258 3300003792 Bacteria 2020
18 Ga0070683_100008598 3300005329 Bacteria 8676
19 Ga0070683_100039018 3300005329 Bacteria 4357
20 Ga0070670_100473148 3300005331 Bacteria 1112
21 Ga0070666_10115051 3300005335 Bacteria 1863
22 Ga0070680_100077371 3300005336 Bacteria 2740
23 Ga0070682_100006879 3300005337 Bacteria 6392
24 Ga0068868_100166625 3300005338 Bacteria 1823
25 Ga0068868_100314983 3300005338 Bacteria 1332
26 Ga0070660_100121390 3300005339 Bacteria 2085
27 Ga0070689_100018088 3300005340 Bacteria 5185
28 Ga0070689_100404469 3300005340 Bacteria 1154
29 Ga0070691_10028587 3300005341 Bacteria 2606
30 Ga0070668_100144125 3300005347 Bacteria 1922
31 Ga0070668_100410414 3300005347 Bacteria 1158
32 Ga0070669_100107346 3300005353 Bacteria 2114
33 Ga0070675_100229928 3300005354 Bacteria 1617
34 Ga0070671_100000270 3300005355 Bacteria 35025
35 Ga0070674_100019096 3300005356 Bacteria 4349
36 Ga0070674_100140845 3300005356 Unclassified 1810
37 Ga0070674_100165573 3300005356 Bacteria 1681
38 Ga0070674_100333679 3300005356 Bacteria 1219
39 Ga0070673_100052077 3300005364 Bacteria 3210
40 Ga0070688_100159175 3300005365 Bacteria 1550
41 Ga0070688_100215194 3300005365 Bacteria 1351
42 Ga0070659_100135186 3300005366 Bacteria 2005
43 Ga0070667_100000519 3300005367 Bacteria 38707
44 Ga0070667_100017933 3300005367 Bacteria 5868
45 Ga0070667_100094574 3300005367 Bacteria 2575
46 Ga0070667_100330515 3300005367 Bacteria 1377
47 Ga0070703_10037517 3300005406 Bacteria 1493
48 Ga0070709_10242953 3300005434 Bacteria 1294
49 Ga0070714_100027179 3300005435 Bacteria 4735
50 Ga0070714_100279496 3300005435 Bacteria 1550
51 Ga0070714_100314249 3300005435 Bacteria 1463
52 Ga0070713_100001021 3300005436 Bacteria 17922
53 Ga0070713_100082542 3300005436 Bacteria 2745
54 Ga0070713_100432501 3300005436 Bacteria 1233
55 Ga0070710_10000886 3300005437 Bacteria 14310
56 Ga0070710_10045038 3300005437 Bacteria 2450
57 Ga0070710_10169214 3300005437 Bacteria 1360
58 Ga0070701_10015672 3300005438 Bacteria 3506
59 Ga0070711_100372043 3300005439 Bacteria 1153
60 Ga0070705_100137437 3300005440 Bacteria 1603
61 Ga0070700_100002013 3300005441 Bacteria 10324
62 Ga0070700_100015776 3300005441 Bacteria 4291
63 Ga0070700_100108210 3300005441 Bacteria 1843
64 Ga0070708_100005219 3300005445 Bacteria 10287
65 Ga0070708_100027390 3300005445 Bacteria 4889
66 Ga0070708_100164504 3300005445 Bacteria 2069
67 Ga0070663_100157177 3300005455 Bacteria 1748
68 Ga0068867_100006376 3300005459 Bacteria 8340
69 Ga0070685_10059495 3300005466 Bacteria 2231
70 Ga0070685_10133521 3300005466 Bacteria 1554
71 Ga0070706_100014393 3300005467 Bacteria 7311
72 Ga0070706_100027755 3300005467 Bacteria 5206
73 Ga0070706_100263900 3300005467 Bacteria 1607
74 Ga0070707_100022878 3300005468 Bacteria 5909
75 Ga0070707_100053905 3300005468 Bacteria 3855
76 Ga0070707_100074196 3300005468 Bacteria 3280
77 Ga0070707_100213658 3300005468 Bacteria 1880
78 Ga0070698_100020408 3300005471 Bacteria 6945
79 Ga0070698_100073794 3300005471 Bacteria 3417
80 Ga0070698_100117098 3300005471 Bacteria 2626
81 Ga0070698_100400557 3300005471 Bacteria 1306
82 Ga0070699_100001180 3300005518 Bacteria 24208
83 Ga0070679_100125377 3300005530 Bacteria 2550
84 Ga0070684_100213867 3300005535 Bacteria 1757
85 Ga0070697_100034421 3300005536 Bacteria 4084
86 Ga0070672_100005018 3300005543 Bacteria 8725
87 Ga0070672_100085830 3300005543 Bacteria 2530
88 Ga0070686_100095559 3300005544 Bacteria 1997
89 Ga0070695_100053073 3300005545 Bacteria 2606
90 Ga0070696_100087653 3300005546 Bacteria 2211
91 Ga0070693_100108396 3300005547 Bacteria 1704
92 Ga0070693_100165906 3300005547 Bacteria 1410
93 Ga0070665_100003024 3300005548 Bacteria 18135
94 Ga0070665_100290377 3300005548 Bacteria 1638
95 Ga0068857_100481814 3300005577 Bacteria 1163
96 Ga0068856_100528614 3300005614 Bacteria 1201
97 Ga0070702_100051111 3300005615 Bacteria 2365
98 Ga0068852_100029346 3300005616 Bacteria 4518
99 Ga0068859_100197406 3300005617 Bacteria 2096
100 Ga0068859_100704293 3300005617 Bacteria 1100
101 Ga0068864_100166763 3300005618 Bacteria 2006
102 Ga0068864_100385535 3300005618 Bacteria 1329
103 Ga0068864_100585082 3300005618 Bacteria 1082
104 Ga0068866_10004033 3300005718 Bacteria 6037
105 Ga0068866_10176713 3300005718 Bacteria 1258
106 Ga0068861_100007505 3300005719 Bacteria 7476
107 Ga0068861_100455866 3300005719 Bacteria 1147
108 Ga0068851_10049835 3300005834 Bacteria 2126
109 Ga0068863_100000322 3300005841 Bacteria 48726
110 Ga0068863_100004380 3300005841 Bacteria 13920
111 Ga0068863_100068275 3300005841 Bacteria 3363
112 Ga0068863_100078278 3300005841 Bacteria 3131
113 Ga0068863_100298399 3300005841 Bacteria 1563
114 Ga0068858_100759246 3300005842 Bacteria 945
115 Ga0068860_100024247 3300005843 Bacteria 5865
116 Ga0068860_100089480 3300005843 Bacteria 2931
117 Ga0068860_100346980 3300005843 Bacteria 1460
118 Ga0068860_100418331 3300005843 Bacteria 1328
119 Ga0068860_100430295 3300005843 Bacteria 1309
120 Ga0068862_100000087 3300005844 Bacteria 110040
121 Ga0068862_100125825 3300005844 Bacteria 2263
122 Ga0068862_100273281 3300005844 Bacteria 1546
123 Ga0068862_100541194 3300005844 Bacteria 1111
124 Ga0081455_10010764 3300005937 Bacteria 9245
125 Ga0070717_10037001 3300006028 Bacteria 3961
126 Ga0075368_10076953 3300006042 Bacteria 1354
127 Ga0075364_10010113 3300006051 Bacteria 5689
128 Ga0075364_10043356 3300006051 Bacteria 2925
129 Ga0075364_10051858 3300006051 Bacteria 2680
130 Ga0070715_10016478 3300006163 Bacteria 2777
131 Ga0070716_100119432 3300006173 Bacteria 1648
132 Ga0070712_100068958 3300006175 Bacteria 2521
133 Ga0070712_100204484 3300006175 Bacteria 1553
134 Ga0075367_10007920 3300006178 Bacteria 5475
135 Ga0075369_10001359 3300006186 Bacteria 8313
136 Ga0075370_10021490 3300006353 Bacteria 3535
137 Ga0075370_10059969 3300006353 Bacteria 2167
138 Ga0075370_10139803 3300006353 Unclassified 1415
139 Ga0068871_100602260 3300006358 Bacteria 999
140 Ga0075428_100266996 3300006844 Bacteria 1842
141 Ga0075430_100040540 3300006846 Bacteria 3942
142 Ga0068865_100005567 3300006881 Bacteria 7640
143 Ga0068865_100266448 3300006881 Bacteria 1359
144 Ga0097620_100000055 3300006931 Bacteria 119802
145 Ga0097620_100197422 3300006931 Bacteria 2096
146 Ga0097620_100704312 3300006931 Bacteria 1100
147 Ga0099795_10089946 3300007788 Bacteria 1188
148 Ga0105250_10012859 3300009092 Bacteria 3447
149 Ga0105240_10176840 3300009093 Bacteria 2522
150 Ga0111539_10212986 3300009094 Bacteria 2251
151 Ga0105245_10128789 3300009098 Bacteria 2372
152 Ga0105245_10232597 3300009098 Bacteria 1783
153 Ga0105247_10149142 3300009101 Bacteria 1539
154 Ga0105247_10156416 3300009101 Bacteria 1506
155 Ga0105243_10020187 3300009148 Bacteria 5052
156 Ga0105243_10683628 3300009148 Bacteria 998
157 Ga0105243_10756918 3300009148 Bacteria 953
158 Ga0105241_10268953 3300009174 Bacteria 1451
159 Ga0105248_10032784 3300009177 Bacteria 5804
160 Ga0105237_10215049 3300009545 Bacteria 1922
161 Ga0105237_10489338 3300009545 Bacteria 1236
162 Ga0105238_10126521 3300009551 Bacteria 2534
163 Ga0105249_10534976 3300009553 Bacteria 1221
164 Ga0099796_10073524 3300010159 Unclassified 1239
165 Ga0099796_10156910 3300010159 Bacteria 899
166 Ga0105239_10085466 3300010375 Bacteria 3477
167 Ga0105239_10276160 3300010375 Bacteria 1891
168 Ga0157373_10284146 3300013100 Bacteria 1173
169 Ga0157370_10153718 3300013104 Bacteria 2141
170 Ga0157369_10199570 3300013105 Bacteria 2100
171 Ga0163162_10002540 3300013306 Bacteria 17270
172 Ga0163162_10375436 3300013306 Bacteria 1555
173 Ga0157372_10558655 3300013307 Bacteria 1334
174 Ga0157375_10126026 3300013308 Bacteria 2675
175 Ga0163163_10009414 3300014325 Bacteria 8722
176 Ga0157380_10010871 3300014326 Bacteria 6564
177 Ga0157380_10208820 3300014326 Bacteria 1738
178 Ga0157380_10660754 3300014326 Bacteria 1044
179 Ga0157377_10016034 3300014745 Bacteria 3847
180 Ga0157379_10014763 3300014968 Bacteria 6851
181 Ga0157379_10113668 3300014968 Bacteria 2433
182 Ga0163161_10059970 3300017792 Bacteria 2768
183 Ga0163161_10287138 3300017792 Bacteria 1292
184 Ga0224572_1011402 3300024225 Bacteria 1682
185 Ga0209051_1000034 3300025303 Bacteria 371498
186 Ga0209051_1000616 3300025303 Bacteria 41069
187 Ga0209051_1001401 3300025303 Bacteria 20760
188 Ga0209051_1003970 3300025303 Bacteria 9401
189 Ga0209051_1015166 3300025303 Bacteria 3557
190 Ga0207656_10096492 3300025321 Bacteria 1349
191 Ga0207653_10004208 3300025885 Bacteria 4516
192 Ga0207692_10003941 3300025898 Bacteria 5828
193 Ga0207692_10104260 3300025898 Bacteria 1562
194 Ga0207692_10263977 3300025898 Bacteria 1036
195 Ga0207642_10065607 3300025899 Bacteria 1706
196 Ga0207710_10208236 3300025900 Bacteria 968
197 Ga0207688_10005203 3300025901 Bacteria 7070
198 Ga0207688_10017595 3300025901 Bacteria 3887
199 Ga0207680_10031067 3300025903 Bacteria 3022
200 Ga0207647_10052239 3300025904 Bacteria 2523
201 Ga0207685_10033167 3300025905 Bacteria 1864
202 Ga0207699_10036731 3300025906 Bacteria 2795
203 Ga0207699_10265499 3300025906 Bacteria 1188
204 Ga0207645_10014546 3300025907 Bacteria 5264
205 Ga0207643_10010630 3300025908 Bacteria 4961
206 Ga0207684_10054123 3300025910 Bacteria 3405
207 Ga0207684_10130564 3300025910 Bacteria 2156
208 Ga0207707_10167309 3300025912 Bacteria 1921
209 Ga0207671_10094053 3300025914 Bacteria 2262
210 Ga0207671_10111649 3300025914 Bacteria 2080
211 Ga0207693_10032663 3300025915 Bacteria 4107
212 Ga0207693_10099379 3300025915 Bacteria 2282
213 Ga0207693_10285145 3300025915 Bacteria 1294
214 Ga0207662_10013789 3300025918 Bacteria 4523
215 Ga0207649_10165777 3300025920 Bacteria 1535
216 Ga0207646_10013591 3300025922 Bacteria 7775
217 Ga0207646_10024206 3300025922 Bacteria 5565
218 Ga0207646_10027978 3300025922 Bacteria 5137
219 Ga0207650_10122473 3300025925 Bacteria 2027
220 Ga0207659_10070262 3300025926 Bacteria 2553
221 Ga0207687_10093865 3300025927 Bacteria 2195
222 Ga0207687_10143583 3300025927 Bacteria 1814
223 Ga0207687_10200311 3300025927 Bacteria 1560
224 Ga0207700_10007399 3300025928 Bacteria 6705
225 Ga0207700_10069990 3300025928 Bacteria 2695
226 Ga0207700_10277201 3300025928 Bacteria 1441
227 Ga0207664_10013054 3300025929 Bacteria 5954
228 Ga0207664_10032875 3300025929 Bacteria 3980
229 Ga0207644_10009239 3300025931 Bacteria 6468
230 Ga0207690_10097019 3300025932 Bacteria 2097
231 Ga0207706_10025968 3300025933 Bacteria 5245
232 Ga0207709_10000326 3300025935 Bacteria 51484
233 Ga0207709_10009878 3300025935 Bacteria 5254
234 Ga0207709_10478123 3300025935 Bacteria 968
235 Ga0207670_10249171 3300025936 Bacteria 1372
236 Ga0207669_10013370 3300025937 Bacteria 4073
237 Ga0207669_10152284 3300025937 Bacteria 1621
238 Ga0207669_10275438 3300025937 Bacteria 1266
239 Ga0207704_10286829 3300025938 Bacteria 1254
240 Ga0207704_10432083 3300025938 Bacteria 1047
241 Ga0207665_10005355 3300025939 Bacteria 8566
242 Ga0207665_10008631 3300025939 Bacteria 6709
243 Ga0207665_10217633 3300025939 Bacteria 1398
244 Ga0207691_10001264 3300025940 Bacteria 25336
245 Ga0207691_10018114 3300025940 Bacteria 6670
246 Ga0207689_10007860 3300025942 Bacteria 9317
247 Ga0207661_10011662 3300025944 Bacteria 6378
248 Ga0207661_10095745 3300025944 Bacteria 2483
249 Ga0207661_10105679 3300025944 Bacteria 2373
250 Ga0207667_10715179 3300025949 Bacteria 1003
251 Ga0207712_10105870 3300025961 Bacteria 2100
252 Ga0207668_10148982 3300025972 Bacteria 1809
253 Ga0207668_10558485 3300025972 Bacteria 992
254 Ga0207640_10369205 3300025981 Bacteria 1159
255 Ga0207658_10000774 3300025986 Bacteria 27330
256 Ga0207658_10011542 3300025986 Bacteria 6014
257 Ga0207658_10294580 3300025986 Bacteria 1396
258 Ga0207677_10134910 3300026023 Bacteria 1880
259 Ga0207677_10271634 3300026023 Bacteria 1387
260 Ga0207703_10628482 3300026035 Bacteria 1017
261 Ga0207639_10016541 3300026041 Bacteria 5221
262 Ga0207639_10183159 3300026041 Bacteria 1783
263 Ga0207678_10035566 3300026067 Bacteria 4336
264 Ga0207678_10062050 3300026067 Bacteria 3214
265 Ga0207678_10086091 3300026067 Bacteria 2686
266 Ga0207708_10000259 3300026075 Bacteria 41740
267 Ga0207708_10035467 3300026075 Bacteria 3795
268 Ga0207708_10134749 3300026075 Bacteria 1934
269 Ga0207708_10247228 3300026075 Bacteria 1436
270 Ga0207702_10112524 3300026078 Bacteria 2423
271 Ga0207702_10316120 3300026078 Bacteria 1486
272 Ga0207641_10000451 3300026088 Bacteria 46849
273 Ga0207641_10007659 3300026088 Bacteria 8978
274 Ga0207641_10007845 3300026088 Bacteria 8864
275 Ga0207641_10182740 3300026088 Bacteria 1922
276 Ga0207641_10354635 3300026088 Bacteria 1399
277 Ga0207648_10008057 3300026089 Bacteria 10266
278 Ga0207648_10038279 3300026089 Bacteria 4221
279 Ga0207676_10722529 3300026095 Bacteria 967
280 Ga0207674_10832457 3300026116 Bacteria 890
281 Ga0207675_100023956 3300026118 Bacteria 5675
282 Ga0207675_100037603 3300026118 Bacteria 4514
283 Ga0207675_100527793 3300026118 Bacteria 1177
284 Ga0207675_100758976 3300026118 Bacteria 982
285 Ga0207683_10739548 3300026121 Bacteria 912
286 Ga0207698_10036576 3300026142 Bacteria 3605
287 Ga0268266_10014404 3300028379 Bacteria 6798
288 Ga0268266_10659981 3300028379 Bacteria 1007
289 Ga0268265_10000020 3300028380 Bacteria 275575
290 Ga0268265_10813356 3300028380 Bacteria 912
291 Ga0316181_1130982 3300030744 Bacteria 853
292 Ga0265760_10004461 3300031090 Bacteria 4018
293 Ga0265327_10001643 3300031251 Bacteria 26969
294 Ga0265327_10025928 3300031251 Bacteria 3406
295 Ga0316578_10059347 3300031728 Bacteria 2250
296 Ga0307410_10047047 3300031852 Bacteria 2881
297 Ga0307410_10309866 3300031852 Bacteria 1249
298 Ga0307409_100061770 3300031995 Bacteria 2930
299 Ga0307409_100381741 3300031995 Bacteria 1340
300 Ga0307416_100084851 3300032002 Bacteria 2693
301 Ga0307414_10259064 3300032004 Bacteria 1450
302 Ga0307414_10394244 3300032004 Bacteria 1201
303 Ga0307415_100104290 3300032126 Bacteria 2088
304 Ga0307510_10098693 3300033180 Bacteria 2723
305 Ga0373931_0067444 3300035691 Bacteria 1944
306 Ga0373931_0277452 3300035691 Bacteria 1028
307 Ga0316584_0081905 3300036712 Bacteria 2417
308 Ga0395899_0089742 3300037312 Bacteria 2229
309 Ga0395900_0538682 3300037418 Bacteria 1113
310 Ga0395898_0005642 3300037466 Bacteria 13493
311 Ga0395898_0033513 3300037466 Bacteria 5124
312 Ga0395905_0043864 3300037471 Bacteria 4196
313 Ga0395905_0460069 3300037471 Bacteria 1171
314 Ga0436364_1305262 3300037853 Bacteria 1230
315 Ga0395901_0004342 3300038443 Bacteria 14302
316 Ga0395901_0014350 3300038443 Bacteria 8067
317 Ga0436365_0556286 3300039437 Bacteria 27236
318 Ga0436365_0649704 3300039437 Bacteria 9121
319 Ga0436361_0808268 3300039447 Bacteria 1795
320 Ga0439466_0017642 3300041411 Bacteria 2570
321 Ga0439465_0009544 3300041413 Bacteria 3057
322 Ga0439465_0011440 3300041413 Bacteria 2785
323 Ga0439465_0015182 3300041413 Bacteria 2403
324 Ga0451802_0674418 3300041460 Bacteria 2478
325 Ga0451851_0962111 3300041507 Bacteria 923
326 Ga0439446_0013495 3300042156 Bacteria 2243
327 Ga0439434_0010885 3300042435 Bacteria 2686
328 Ga0439459_0010171 3300042438 Bacteria 1636
329 Ga0466972_0137161 3300044658 Bacteria 1151
330 Ga0466965_0004053 3300044683 Bacteria 6502
331 Ga0466965_0328782 3300044683 Bacteria 834
332 Ga0466966_0012519 3300044684 Bacteria 5619
333 Ga0466966_0052297 3300044684 Bacteria 2595
334 Ga0466966_0212772 3300044684 Bacteria 1168
335 Ga0466966_0372861 3300044684 Bacteria 857
336 Ga0466961_0008672 3300044693 Bacteria 6481
337 Ga0466961_0017087 3300044693 Bacteria 4659
338 Ga0466963_0053943 3300044694 Bacteria 2671
339 Ga0466963_0150474 3300044694 Bacteria 1616
340 Ga0466964_0019807 3300044706 Bacteria 2589
341 Ga0466964_0069472 3300044706 Bacteria 1486
342 Ga0466971_0132695 3300044719 Bacteria 1157
343 Ga0466968_0000471 3300044735 Bacteria 13554
344 Ga0466970_0020859 3300044765 Bacteria 3409
345 Ga0466970_0054923 3300044765 Bacteria 2127
346 Ga0466970_0091699 3300044765 Bacteria 1649
347 Ga0466957_0094843 3300044842 Bacteria 1874
348 Ga0466957_0172622 3300044842 Bacteria 1409
349 Ga0466960_0095201 3300044901 Bacteria 1525
350 Ga0466960_0242797 3300044901 Bacteria 998
351 Ga0466959_0021896 3300045049 Bacteria 4720
352 Ga0466959_0066205 3300045049 Bacteria 2621
353 Ga0466959_0112041 3300045049 Bacteria 1946
354 Ga0466967_0001676 3300045976 Bacteria 13142
355 Ga0466967_0033143 3300045976 Bacteria 4371
356 Ga0466967_0084090 3300045976 Bacteria 2879
357 Ga0466967_0098674 3300045976 Bacteria 2667
358 Ga0466967_0173819 3300045976 Bacteria 2028
359 Ga0466967_0317126 3300045976 Bacteria 1503
360 Ga0466967_0327179 3300045976 Bacteria 1479
361 Ga0466967_0414764 3300045976 Bacteria 1312
362 Ga0466967_0427075 3300045976 Bacteria 1292
363 Ga0495629_0199906 3300046459 Bacteria 1382
364 Ga0495641_0100906 3300046461 Bacteria 1288
365 Ga0495664_0064395 3300046477 Bacteria 2185
366 Ga0495608_0081819 3300046511 Bacteria 2098
367 Ga0495608_0082888 3300046511 Bacteria 2082
368 Ga0495648_0211689 3300046524 Bacteria 962
369 Ga0495652_0056247 3300046529 Bacteria 3342
370 Ga0495652_0108592 3300046529 Bacteria 2236
371 Ga0495645_0336541 3300046543 Bacteria 976
372 Ga0495667_0049186 3300046559 Bacteria 2783
373 Ga0495588_0120490 3300046674 Bacteria 1383
374 Ga0495657_0015958 3300046675 Bacteria 5480
375 Ga0495599_0200117 3300046678 Bacteria 1227
376 Ga0495674_0103201 3300047319 Bacteria 2425
377 Ga0495674_0130847 3300047319 Bacteria 2114
378 Ga0495672_0216222 3300047320 Bacteria 949
379 Ga0495684_0065447 3300047471 Bacteria 2763
380 Ga0496100_0001882 3300048903 Bacteria 10528
381 Ga0496100_0177002 3300048903 Bacteria 1540
382 Ga0496100_0536462 3300048903 Bacteria 904
383 Ga0496101_0000190 3300048904 Bacteria 48412
384 Ga0496101_0003048 3300048904 Bacteria 10339
385 Ga0496101_0005417 3300048904 Bacteria 8131
386 Ga0496102_0000020 3300048905 Bacteria 260823
387 Ga0496102_0291868 3300048905 Unclassified 1537
388 Ga0496102_0355879 3300048905 Bacteria 1378
389 Ga0496103_0000011 3300048906 Bacteria 304506
390 Ga0496103_0001900 3300048906 Bacteria 13581
391 Ga0496103_0249281 3300048906 Bacteria 1143
392 Ga0496104_0047583 3300048907 Bacteria 4042
393 Ga0496104_0061356 3300048907 Bacteria 3565
394 Ga0496105_0231220 3300048908 Bacteria 1503
395 Ga0496105_0282432 3300048908 Bacteria 1338
396 Ga0496106_0004364 3300048909 Bacteria 10509
397 Ga0496106_0113113 3300048909 Bacteria 2115
398 Ga0496107_0001598 3300048910 Bacteria 14103
399 Ga0496107_0071384 3300048910 Bacteria 2523
400 Ga0496107_0075387 3300048910 Bacteria 2455
401 Ga0496107_0102983 3300048910 Bacteria 2094
402 Ga0496107_0266604 3300048910 Bacteria 1274
403 Ga0496108_0025850 3300048911 Bacteria 4841
404 Ga0496108_0046829 3300048911 Bacteria 3614
405 Ga0496108_0148358 3300048911 Bacteria 2023
406 Ga0496108_0290464 3300048911 Bacteria 1423
407 Ga0496109_0005598 3300048912 Bacteria 10517
408 Ga0496109_0097341 3300048912 Bacteria 2727
409 Ga0496109_0278841 3300048912 Bacteria 1575
410 Ga0496109_0375849 3300048912 Bacteria 1342
411 Ga0496110_0007092 3300048913 Bacteria 8920
412 Ga0496110_0069505 3300048913 Bacteria 3119
413 Ga0496110_0092805 3300048913 Bacteria 2702
414 Ga0496110_0097720 3300048913 Bacteria 2631
415 Ga0496110_0163681 3300048913 Bacteria 2017
416 Ga0496110_0329234 3300048913 Bacteria 1391
417 Ga0496111_0022789 3300048914 Bacteria 4388
418 Ga0496111_0117709 3300048914 Bacteria 1961
419 Ga0496112_0003946 3300048915 Bacteria 12428
420 Ga0496112_0213272 3300048915 Bacteria 1888
421 Ga0496113_0000098 3300048916 Bacteria 36496
422 Ga0496114_0004789 3300048917 Bacteria 10535
423 Ga0496114_0020021 3300048917 Bacteria 5428
424 Ga0496114_0033900 3300048917 Bacteria 4209
425 Ga0496114_0132126 3300048917 Bacteria 2156
426 Ga0496114_0152767 3300048917 Bacteria 2003
427 Ga0496114_0169339 3300048917 Bacteria 1903
428 Ga0496115_0011453 3300048918 Bacteria 6648
429 Ga0496115_0023437 3300048918 Bacteria 4791
430 Ga0496115_0104587 3300048918 Bacteria 2323
431 Ga0496116_0000067 3300048919 Bacteria 260793
432 Ga0496116_0008100 3300048919 Bacteria 9185
433 Ga0496117_0000192 3300048920 Bacteria 124451
434 Ga0496117_0057989 3300048920 Bacteria 2684
435 Ga0496118_0000076 3300048921 Bacteria 193263
436 Ga0496118_0026894 3300048921 Bacteria 4885
437 Ga0496119_0000237 3300048922 Bacteria 77727
438 Ga0496119_0011441 3300048922 Bacteria 7349
439 Ga0496119_0052621 3300048922 Bacteria 2493
440 Ga0496120_0053513 3300048923 Bacteria 2293
441 Ga0496121_0000002 3300048924 Bacteria 1494588
442 Ga0496121_0005722 3300048924 Bacteria 15785
443 Ga0496121_0022738 3300048924 Bacteria 6067
444 Ga0496122_0000305 3300048925 Bacteria 108235
445 Ga0496122_0008120 3300048925 Bacteria 11438
446 Ga0496123_0000284 3300048926 Bacteria 99532
447 Ga0496123_0030579 3300048926 Bacteria 3939
448 Ga0496124_0000002 3300048927 Bacteria 1494588
449 Ga0496124_0041933 3300048927 Bacteria 3944
450 Ga0496124_0363031 3300048927 Bacteria 1020
451 Ga0496125_0000002 3300048928 Bacteria 1480920
452 Ga0496126_0000009 3300048929 Bacteria 750350
453 Ga0496126_0000080 3300048929 Bacteria 221672
454 Ga0496126_0002421 3300048929 Bacteria 25257
455 Ga0501031_0308265 3300049568 Bacteria 1026
456 Ga0501032_0051892 3300049569 Bacteria 2764
457 Ga0501034_0058099 3300049571 Bacteria 3888
458 Ga0501036_0064777 3300049572 Bacteria 3093
459 Ga0501038_0117657 3300049574 Bacteria 2195
460 Ga0501038_0315118 3300049574 Bacteria 1225
461 Ga0501039_0129041 3300049575 Bacteria 1984
462 Ga0501042_0389309 3300049578 Bacteria 1010
463 Ga0501043_0312475 3300049579 Bacteria 1199
464 Ga0501046_0000489 3300049580 Bacteria 39452
465 Ga0501047_0014088 3300049581 Bacteria 7599
466 Ga0501048_0180373 3300049582 Bacteria 1497
467 Ga0501067_0026580 3300049583 Bacteria 3205
468 Ga0501068_0184077 3300049584 Bacteria 1321
469 Ga0501069_0002776 3300049585 Bacteria 8948
470 Ga0501070_0004050 3300049586 Bacteria 12593
471 Ga0501070_0019334 3300049586 Bacteria 5712
472 Ga0501070_0212967 3300049586 Bacteria 1585
473 Ga0501071_0195248 3300049587 Bacteria 1519
474 Ga0501072_0021610 3300049588 Bacteria 4990
475 Ga0501073_0030122 3300049589 Bacteria 3876
476 Ga0501074_0012514 3300049590 Bacteria 6168
477 Ga0501074_0254250 3300049590 Bacteria 1249
478 Ga0501075_0174781 3300049591 Bacteria 1639
479 Ga0501079_0005400 3300049741 Bacteria 9516
480 Ga0501080_0005179 3300049742 Bacteria 11616
481 Ga0501080_0006135 3300049742 Bacteria 10780
482 Ga0501080_0022489 3300049742 Bacteria 5840
483 Ga0501083_0372305 3300049744 Bacteria 929
484 Ga0501035_0000542 3300049822 Bacteria 41925
485 Ga0501044_0000153 3300049823 Bacteria 85673
486 Ga0501044_0104873 3300049823 Bacteria 2840
487 Ga0501044_0202515 3300049823 Bacteria 1942
488 Ga0501044_0549421 3300049823 Bacteria 1052
489 nmdc:mga03n38_16394_c1 3300050490 Bacteria 2881
490 nmdc:mga03n38_34464_c1 3300050490 Bacteria 2162
491 nmdc:mga03n38_85533_c1 3300050490 Bacteria 1491
492 nmdc:mga00v17_142821_c1 3300050491 Bacteria 1536
493 nmdc:mga00v17_223958_c1 3300050491 Bacteria 1218
494 nmdc:mga00v17_706_c1 3300050491 Bacteria 18264
495 nmdc:mga00v17_99479_c1 3300050491 Bacteria 1834
496 nmdc:mga0yw44_36007_c1 3300050492 Bacteria 2914
497 nmdc:mga0yw44_51865_c1 3300050492 Bacteria 2485
498 nmdc:mga06z11_101550_c1 3300050494 Bacteria 1579
499 nmdc:mga04h51_8892_c3 3300050495 Bacteria 1611
500 nmdc:mga07m45_13340_c1 3300050496 Bacteria 4359
501 nmdc:mga07m45_313795_c1 3300050496 Bacteria 911
502 nmdc:mga0qj67_187148_c1 3300050509 Bacteria 1682
503 nmdc:mga0qj67_47743_c1 3300050509 Bacteria 3382
504 nmdc:mga06r32_547386_c1 3300050510 Bacteria 1131
505 nmdc:mga08y16_93805_c1 3300050511 Bacteria 3127
506 nmdc:mga0sz30_11352_c1 3300050516 Bacteria 3438
507 Ga0495601_0128855 3300053077 Bacteria 1647
508 Ga0500635_0006292 3300053080 Bacteria 3163
509 Ga0500583_0043402 3300053092 Bacteria 2054
510 Ga0500642_0033937 3300053130 Bacteria 2155
511 Ga0500564_023134 3300053138 Bacteria 2847

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2939582691 2939586381 246
2 3300046459 Ga0495629_0199906 Ga0495629_0199906_498_1277 248
3 3300032002 Ga0307416_100084851 Ga0307416_1000848511 249
4 iso_pu_bacteria 2523231044 2523384694 249
5 iso_pu_bacteria 2565956761 2566993509 249
6 iso_pu_bacteria 2626541554 2626634603 249
7 iso_pu_bacteria 2626541554 2626636392 249
8 iso_pu_bacteria 2643221715 2644639405 249
9 iso_pu_bacteria 2671180195 2671838516 249
10 iso_pu_bacteria 2675903059 2676484217 249
11 iso_pu_bacteria 2738541308 2738889305 249
12 iso_pu_bacteria 2738543011 2739239564 249
13 iso_pu_bacteria 2751185725 2753036081 249
14 iso_pu_bacteria 2751185792 2753323953 249
15 iso_pu_bacteria 2773857922 2774856672 249
16 iso_pu_bacteria 2842134933 2842139723 249
17 iso_pu_bacteria 2889300758 2889304758 249
18 iso_pu_bacteria 2904535858 2904537222 249
19 iso_pu_bacteria 2904765812 2904770480 249
20 iso_pu_bacteria 2904770941 2904771562 249
21 iso_pu_bacteria 2908811453 2908812353 249
22 iso_pu_bacteria 2919420072 2919422929 249
23 iso_pu_bacteria 2919432681 2919435537 249
24 iso_pu_bacteria 2922554459 2922559847 249
25 iso_pu_bacteria 2929212328 2929217592 249
26 iso_pu_bacteria 2939743619 2939746658 249
27 iso_pu_bacteria 8054913762 8054919652 249
28 iso_pu_bacteria 8054920844 8054922701 249
29 3300003792 Ga0055540_1017258 Ga0055540_10172581 250
30 3300005455 Ga0070663_100157177 Ga0070663_1001571773 250
31 3300025303 Ga0209051_1003970 Ga0209051_10039703 250
32 3300026067 Ga0207678_10062050 Ga0207678_100620503 250
33 3300041413 Ga0439465_0011440 Ga0439465_0011440_610_1362 250
34 3300042156 Ga0439446_0013495 Ga0439446_0013495_1080_1832 250
35 3300042435 Ga0439434_0010885 Ga0439434_0010885_717_1469 250
36 3300044694 Ga0466963_0053943 Ga0466963_0053943_1332_2087 250
37 3300045976 Ga0466967_0317126 Ga0466967_0317126_634_1389 250
38 3300048922 Ga0496119_0052621 Ga0496119_0052621_1230_1982 250
39 3300049574 Ga0501038_0315118 Ga0501038_0315118_412_1164 250
40 3300049742 Ga0501080_0022489 Ga0501080_0022489_3962_4714 250
41 iso_pu_bacteria 2939582691 2939586409 250
42 3300048924 Ga0496121_0022738 Ga0496121_0022738_4196_4951 251
43 iso_pu_bacteria 2508501039 2508676510 251
44 iso_pu_bacteria 2675902999 2676200588 251
45 iso_pu_bacteria 2684623035 2686534651 251
46 iso_pu_bacteria 2687453737 2689956921 251
47 iso_pu_bacteria 2773857921 2774845166 251
48 iso_pu_bacteria 2857481737 2857484007 251
49 iso_pu_bacteria 2895880812 2895887513 251
50 3300005338 Ga0068868_100314983 Ga0068868_1003149832 252
51 3300005841 Ga0068863_100004380 Ga0068863_10000438010 252
52 3300006353 Ga0075370_10139803 Ga0075370_101398032 252
53 3300009098 Ga0105245_10232597 Ga0105245_102325972 252
54 3300025303 Ga0209051_1001401 Ga0209051_100140111 252
55 3300025927 Ga0207687_10200311 Ga0207687_102003112 252
56 3300025938 Ga0207704_10432083 Ga0207704_104320832 252
57 3300026067 Ga0207678_10086091 Ga0207678_100860913 252
58 3300026088 Ga0207641_10000451 Ga0207641_1000045141 252
59 3300042438 Ga0439459_0010171 Ga0439459_0010171_827_1585 252
60 3300046461 Ga0495641_0100906 Ga0495641_0100906_297_1064 252
61 3300046511 Ga0495608_0081819 Ga0495608_0081819_1299_2066 252
62 3300047319 Ga0495674_0130847 Ga0495674_0130847_506_1273 252
63 3300048904 Ga0496101_0005417 Ga0496101_0005417_6944_7702 252
64 3300048905 Ga0496102_0355879 Ga0496102_0355879_36_803 252
65 3300048908 Ga0496105_0231220 Ga0496105_0231220_336_1103 252
66 3300048915 Ga0496112_0003946 Ga0496112_0003946_2472_3230 252
67 3300048916 Ga0496113_0000098 Ga0496113_0000098_544_1302 252
68 3300048917 Ga0496114_0020021 Ga0496114_0020021_2930_3697 252
69 3300048917 Ga0496114_0152767 Ga0496114_0152767_702_1469 252
70 3300048925 Ga0496122_0000305 Ga0496122_0000305_30962_31720 252
71 3300048926 Ga0496123_0000284 Ga0496123_0000284_44291_45049 252
72 3300048929 Ga0496126_0002421 Ga0496126_0002421_17838_18596 252
73 iso_pu_bacteria 2643221576 2643892633 252
74 iso_pu_bacteria 2643221590 2643962082 252
75 iso_pu_bacteria 2902837492 2902839922 252
76 3300001989 JGI24739J22299_10043323 JGI24739J22299_100433232 253
77 3300001991 JGI24743J22301_10005260 JGI24743J22301_100052602 253
78 3300002075 JGI24738J21930_10002619 JGI24738J21930_100026194 253
79 3300002076 JGI24749J21850_1001821 JGI24749J21850_10018213 253
80 3300005329 Ga0070683_100008598 Ga0070683_1000085983 253
81 3300005329 Ga0070683_100039018 Ga0070683_1000390184 253
82 3300005331 Ga0070670_100473148 Ga0070670_1004731482 253
83 3300005337 Ga0070682_100006879 Ga0070682_1000068797 253
84 3300005338 Ga0068868_100166625 Ga0068868_1001666252 253
85 3300005340 Ga0070689_100404469 Ga0070689_1004044691 253
86 3300005341 Ga0070691_10028587 Ga0070691_100285872 253
87 3300005347 Ga0070668_100144125 Ga0070668_1001441252 253
88 3300005347 Ga0070668_100410414 Ga0070668_1004104141 253
89 3300005355 Ga0070671_100000270 Ga0070671_10000027018 253
90 3300005356 Ga0070674_100019096 Ga0070674_1000190962 253
91 3300005356 Ga0070674_100140845 Ga0070674_1001408451 253
92 3300005356 Ga0070674_100165573 Ga0070674_1001655732 253
93 3300005365 Ga0070688_100159175 Ga0070688_1001591752 253
94 3300005366 Ga0070659_100135186 Ga0070659_1001351862 253
95 3300005367 Ga0070667_100017933 Ga0070667_1000179336 253
96 3300005367 Ga0070667_100330515 Ga0070667_1003305152 253
97 3300005435 Ga0070714_100027179 Ga0070714_1000271794 253
98 3300005435 Ga0070714_100279496 Ga0070714_1002794961 253
99 3300005436 Ga0070713_100001021 Ga0070713_10000102116 253
100 3300005436 Ga0070713_100432501 Ga0070713_1004325011 253
101 3300005437 Ga0070710_10000886 Ga0070710_100008866 253
102 3300005437 Ga0070710_10045038 Ga0070710_100450382 253
103 3300005437 Ga0070710_10169214 Ga0070710_101692142 253
104 3300005438 Ga0070701_10015672 Ga0070701_100156722 253
105 3300005441 Ga0070700_100002013 Ga0070700_1000020133 253
106 3300005441 Ga0070700_100015776 Ga0070700_1000157766 253
107 3300005445 Ga0070708_100005219 Ga0070708_10000521910 253
108 3300005445 Ga0070708_100027390 Ga0070708_1000273903 253
109 3300005459 Ga0068867_100006376 Ga0068867_1000063762 253
110 3300005466 Ga0070685_10059495 Ga0070685_100594952 253
111 3300005467 Ga0070706_100014393 Ga0070706_1000143935 253
112 3300005467 Ga0070706_100263900 Ga0070706_1002639003 253
113 3300005468 Ga0070707_100022878 Ga0070707_1000228788 253
114 3300005468 Ga0070707_100053905 Ga0070707_1000539053 253
115 3300005468 Ga0070707_100213658 Ga0070707_1002136582 253
116 3300005471 Ga0070698_100020408 Ga0070698_1000204086 253
117 3300005471 Ga0070698_100117098 Ga0070698_1001170982 253
118 3300005518 Ga0070699_100001180 Ga0070699_10000118024 253
119 3300005530 Ga0070679_100125377 Ga0070679_1001253772 253
120 3300005535 Ga0070684_100213867 Ga0070684_1002138672 253
121 3300005536 Ga0070697_100034421 Ga0070697_1000344215 253
122 3300005543 Ga0070672_100005018 Ga0070672_1000050182 253
123 3300005546 Ga0070696_100087653 Ga0070696_1000876531 253
124 3300005547 Ga0070693_100108396 Ga0070693_1001083962 253
125 3300005548 Ga0070665_100003024 Ga0070665_10000302415 253
126 3300005615 Ga0070702_100051111 Ga0070702_1000511112 253
127 3300005616 Ga0068852_100029346 Ga0068852_1000293463 253
128 3300005617 Ga0068859_100197406 Ga0068859_1001974062 253
129 3300005618 Ga0068864_100585082 Ga0068864_1005850822 253
130 3300005718 Ga0068866_10004033 Ga0068866_100040332 253
131 3300005718 Ga0068866_10176713 Ga0068866_101767131 253
132 3300005719 Ga0068861_100007505 Ga0068861_1000075054 253
133 3300005719 Ga0068861_100455866 Ga0068861_1004558661 253
134 3300005841 Ga0068863_100000322 Ga0068863_10000032242 253
135 3300005841 Ga0068863_100068275 Ga0068863_1000682753 253
136 3300005841 Ga0068863_100078278 Ga0068863_1000782785 253
137 3300005842 Ga0068858_100759246 Ga0068858_1007592462 253
138 3300005843 Ga0068860_100024247 Ga0068860_1000242473 253
139 3300005843 Ga0068860_100089480 Ga0068860_1000894801 253
140 3300005844 Ga0068862_100125825 Ga0068862_1001258251 253
141 3300005844 Ga0068862_100541194 Ga0068862_1005411942 253
142 3300006028 Ga0070717_10037001 Ga0070717_100370013 253
143 3300006042 Ga0075368_10076953 Ga0075368_100769532 253
144 3300006051 Ga0075364_10010113 Ga0075364_100101135 253
145 3300006051 Ga0075364_10043356 Ga0075364_100433564 253
146 3300006051 Ga0075364_10051858 Ga0075364_100518583 253
147 3300006173 Ga0070716_100119432 Ga0070716_1001194322 253
148 3300006175 Ga0070712_100204484 Ga0070712_1002044841 253
149 3300006178 Ga0075367_10007920 Ga0075367_100079205 253
150 3300006186 Ga0075369_10001359 Ga0075369_100013593 253
151 3300006353 Ga0075370_10021490 Ga0075370_100214904 253
152 3300006353 Ga0075370_10059969 Ga0075370_100599693 253
153 3300006358 Ga0068871_100602260 Ga0068871_1006022601 253
154 3300006844 Ga0075428_100266996 Ga0075428_1002669962 253
155 3300006881 Ga0068865_100005567 Ga0068865_1000055672 253
156 3300006881 Ga0068865_100266448 Ga0068865_1002664481 253
157 3300006931 Ga0097620_100197422 Ga0097620_1001974222 253
158 3300007788 Ga0099795_10089946 Ga0099795_100899462 253
159 3300009094 Ga0111539_10212986 Ga0111539_102129863 253
160 3300009098 Ga0105245_10128789 Ga0105245_101287892 253
161 3300009101 Ga0105247_10156416 Ga0105247_101564162 253
162 3300009148 Ga0105243_10020187 Ga0105243_100201875 253
163 3300009148 Ga0105243_10683628 Ga0105243_106836282 253
164 3300009148 Ga0105243_10756918 Ga0105243_107569181 253
165 3300009177 Ga0105248_10032784 Ga0105248_100327846 253
166 3300009553 Ga0105249_10534976 Ga0105249_105349762 253
167 3300010159 Ga0099796_10073524 Ga0099796_100735242 253
168 3300013105 Ga0157369_10199570 Ga0157369_101995703 253
169 3300013306 Ga0163162_10375436 Ga0163162_103754361 253
170 3300013308 Ga0157375_10126026 Ga0157375_101260262 253
171 3300014326 Ga0157380_10010871 Ga0157380_100108714 253
172 3300014326 Ga0157380_10208820 Ga0157380_102088202 253
173 3300014745 Ga0157377_10016034 Ga0157377_100160344 253
174 3300014968 Ga0157379_10014763 Ga0157379_100147635 253
175 3300017792 Ga0163161_10059970 Ga0163161_100599702 253
176 3300024225 Ga0224572_1011402 Ga0224572_10114022 253
177 3300025303 Ga0209051_1000616 Ga0209051_100061631 253
178 3300025303 Ga0209051_1015166 Ga0209051_10151664 253
179 3300025898 Ga0207692_10003941 Ga0207692_100039412 253
180 3300025898 Ga0207692_10104260 Ga0207692_101042601 253
181 3300025898 Ga0207692_10263977 Ga0207692_102639771 253
182 3300025899 Ga0207642_10065607 Ga0207642_100656071 253
183 3300025901 Ga0207688_10005203 Ga0207688_100052035 253
184 3300025905 Ga0207685_10033167 Ga0207685_100331672 253
185 3300025906 Ga0207699_10036731 Ga0207699_100367311 253
186 3300025906 Ga0207699_10265499 Ga0207699_102654991 253
187 3300025908 Ga0207643_10010630 Ga0207643_100106303 253
188 3300025910 Ga0207684_10054123 Ga0207684_100541233 253
189 3300025915 Ga0207693_10099379 Ga0207693_100993792 253
190 3300025915 Ga0207693_10285145 Ga0207693_102851452 253
191 3300025920 Ga0207649_10165777 Ga0207649_101657772 253
192 3300025922 Ga0207646_10013591 Ga0207646_100135919 253
193 3300025922 Ga0207646_10024206 Ga0207646_100242065 253
194 3300025925 Ga0207650_10122473 Ga0207650_101224732 253
195 3300025927 Ga0207687_10093865 Ga0207687_100938652 253
196 3300025928 Ga0207700_10007399 Ga0207700_100073994 253
197 3300025928 Ga0207700_10277201 Ga0207700_102772011 253
198 3300025929 Ga0207664_10013054 Ga0207664_100130545 253
199 3300025929 Ga0207664_10032875 Ga0207664_100328753 253
200 3300025931 Ga0207644_10009239 Ga0207644_100092394 253
201 3300025932 Ga0207690_10097019 Ga0207690_100970192 253
202 3300025935 Ga0207709_10000326 Ga0207709_1000032614 253
203 3300025935 Ga0207709_10009878 Ga0207709_100098784 253
204 3300025935 Ga0207709_10478123 Ga0207709_104781232 253
205 3300025936 Ga0207670_10249171 Ga0207670_102491712 253
206 3300025937 Ga0207669_10013370 Ga0207669_100133703 253
207 3300025937 Ga0207669_10275438 Ga0207669_102754382 253
208 3300025938 Ga0207704_10286829 Ga0207704_102868291 253
209 3300025939 Ga0207665_10005355 Ga0207665_100053559 253
210 3300025939 Ga0207665_10217633 Ga0207665_102176332 253
211 3300025940 Ga0207691_10001264 Ga0207691_100012649 253
212 3300025944 Ga0207661_10011662 Ga0207661_100116622 253
213 3300025944 Ga0207661_10095745 Ga0207661_100957452 253
214 3300025944 Ga0207661_10105679 Ga0207661_101056791 253
215 3300025961 Ga0207712_10105870 Ga0207712_101058702 253
216 3300025972 Ga0207668_10148982 Ga0207668_101489822 253
217 3300025981 Ga0207640_10369205 Ga0207640_103692051 253
218 3300025986 Ga0207658_10011542 Ga0207658_100115425 253
219 3300025986 Ga0207658_10294580 Ga0207658_102945802 253
220 3300026023 Ga0207677_10271634 Ga0207677_102716342 253
221 3300026035 Ga0207703_10628482 Ga0207703_106284821 253
222 3300026041 Ga0207639_10016541 Ga0207639_100165413 253
223 3300026075 Ga0207708_10000259 Ga0207708_100002596 253
224 3300026075 Ga0207708_10134749 Ga0207708_101347492 253
225 3300026075 Ga0207708_10247228 Ga0207708_102472281 253
226 3300026088 Ga0207641_10007659 Ga0207641_100076597 253
227 3300026088 Ga0207641_10007845 Ga0207641_100078456 253
228 3300026088 Ga0207641_10182740 Ga0207641_101827401 253
229 3300026089 Ga0207648_10008057 Ga0207648_100080575 253
230 3300026095 Ga0207676_10722529 Ga0207676_107225292 253
231 3300026118 Ga0207675_100023956 Ga0207675_1000239564 253
232 3300026118 Ga0207675_100527793 Ga0207675_1005277931 253
233 3300026118 Ga0207675_100758976 Ga0207675_1007589761 253
234 3300026142 Ga0207698_10036576 Ga0207698_100365763 253
235 3300028379 Ga0268266_10014404 Ga0268266_100144046 253
236 3300028379 Ga0268266_10659981 Ga0268266_106599812 253
237 3300030744 Ga0316181_1130982 Ga0316181_11309821 253
238 3300031090 Ga0265760_10004461 Ga0265760_100044613 253
239 3300031728 Ga0316578_10059347 Ga0316578_100593473 253
240 3300031852 Ga0307410_10047047 Ga0307410_100470473 253
241 3300031852 Ga0307410_10309866 Ga0307410_103098661 253
242 3300031995 Ga0307409_100061770 Ga0307409_1000617702 253
243 3300031995 Ga0307409_100381741 Ga0307409_1003817411 253
244 3300032004 Ga0307414_10259064 Ga0307414_102590642 253
245 3300032004 Ga0307414_10394244 Ga0307414_103942441 253
246 3300032126 Ga0307415_100104290 Ga0307415_1001042901 253
247 3300033180 Ga0307510_10098693 Ga0307510_100986931 253
248 3300035691 Ga0373931_0277452 Ga0373931_0277452_19_789 253
249 3300036712 Ga0316584_0081905 Ga0316584_0081905_1152_1913 253
250 3300037471 Ga0395905_0460069 Ga0395905_0460069_328_1089 253
251 3300039437 Ga0436365_0556286 Ga0436365_0556286_13103_13864 253
252 3300039447 Ga0436361_0808268 Ga0436361_0808268_678_1439 253
253 3300041411 Ga0439466_0017642 Ga0439466_0017642_964_1725 253
254 3300041413 Ga0439465_0009544 Ga0439465_0009544_617_1378 253
255 3300041413 Ga0439465_0015182 Ga0439465_0015182_936_1703 253
256 3300041460 Ga0451802_0674418 Ga0451802_0674418_305_1066 253
257 3300041507 Ga0451851_0962111 Ga0451851_0962111_45_806 253
258 3300044658 Ga0466972_0137161 Ga0466972_0137161_234_995 253
259 3300044683 Ga0466965_0004053 Ga0466965_0004053_1363_2124 253
260 3300044683 Ga0466965_0328782 Ga0466965_0328782_13_774 253
261 3300044684 Ga0466966_0012519 Ga0466966_0012519_849_1610 253
262 3300044684 Ga0466966_0052297 Ga0466966_0052297_520_1281 253
263 3300044684 Ga0466966_0212772 Ga0466966_0212772_317_1078 253
264 3300044684 Ga0466966_0372861 Ga0466966_0372861_83_844 253
265 3300044693 Ga0466961_0008672 Ga0466961_0008672_752_1513 253
266 3300044693 Ga0466961_0017087 Ga0466961_0017087_1617_2378 253
267 3300044694 Ga0466963_0150474 Ga0466963_0150474_815_1576 253
268 3300044706 Ga0466964_0019807 Ga0466964_0019807_1215_1976 253
269 3300044706 Ga0466964_0069472 Ga0466964_0069472_208_969 253
270 3300044719 Ga0466971_0132695 Ga0466971_0132695_147_908 253
271 3300044735 Ga0466968_0000471 Ga0466968_0000471_3116_3877 253
272 3300044765 Ga0466970_0020859 Ga0466970_0020859_1830_2591 253
273 3300044765 Ga0466970_0054923 Ga0466970_0054923_1090_1851 253
274 3300044765 Ga0466970_0091699 Ga0466970_0091699_311_1072 253
275 3300044842 Ga0466957_0094843 Ga0466957_0094843_415_1176 253
276 3300044842 Ga0466957_0172622 Ga0466957_0172622_369_1130 253
277 3300044901 Ga0466960_0095201 Ga0466960_0095201_140_904 253
278 3300044901 Ga0466960_0242797 Ga0466960_0242797_89_850 253
279 3300045049 Ga0466959_0021896 Ga0466959_0021896_2331_3092 253
280 3300045049 Ga0466959_0066205 Ga0466959_0066205_369_1130 253
281 3300045049 Ga0466959_0112041 Ga0466959_0112041_1092_1853 253
282 3300045976 Ga0466967_0001676 Ga0466967_0001676_5871_6632 253
283 3300045976 Ga0466967_0033143 Ga0466967_0033143_1253_2014 253
284 3300045976 Ga0466967_0084090 Ga0466967_0084090_2039_2800 253
285 3300045976 Ga0466967_0098674 Ga0466967_0098674_941_1705 253
286 3300045976 Ga0466967_0173819 Ga0466967_0173819_102_863 253
287 3300045976 Ga0466967_0327179 Ga0466967_0327179_676_1437 253
288 3300045976 Ga0466967_0414764 Ga0466967_0414764_405_1166 253
289 3300045976 Ga0466967_0427075 Ga0466967_0427075_499_1269 253
290 3300046477 Ga0495664_0064395 Ga0495664_0064395_201_962 253
291 3300046511 Ga0495608_0082888 Ga0495608_0082888_484_1248 253
292 3300046524 Ga0495648_0211689 Ga0495648_0211689_170_931 253
293 3300046529 Ga0495652_0056247 Ga0495652_0056247_1577_2341 253
294 3300046529 Ga0495652_0108592 Ga0495652_0108592_776_1540 253
295 3300046543 Ga0495645_0336541 Ga0495645_0336541_55_816 253
296 3300046559 Ga0495667_0049186 Ga0495667_0049186_1077_1841 253
297 3300046674 Ga0495588_0120490 Ga0495588_0120490_426_1187 253
298 3300046675 Ga0495657_0015958 Ga0495657_0015958_845_1609 253
299 3300046678 Ga0495599_0200117 Ga0495599_0200117_395_1159 253
300 3300047320 Ga0495672_0216222 Ga0495672_0216222_55_816 253
301 3300047471 Ga0495684_0065447 Ga0495684_0065447_805_1569 253
302 3300048904 Ga0496101_0003048 Ga0496101_0003048_6657_7418 253
303 3300048905 Ga0496102_0000020 Ga0496102_0000020_118352_119113 253
304 3300048905 Ga0496102_0291868 Ga0496102_0291868_106_870 253
305 3300048906 Ga0496103_0000011 Ga0496103_0000011_229595_230356 253
306 3300048906 Ga0496103_0249281 Ga0496103_0249281_170_931 253
307 3300048907 Ga0496104_0047583 Ga0496104_0047583_454_1215 253
308 3300048908 Ga0496105_0282432 Ga0496105_0282432_417_1178 253
309 3300048910 Ga0496107_0071384 Ga0496107_0071384_707_1468 253
310 3300048910 Ga0496107_0075387 Ga0496107_0075387_1467_2228 253
311 3300048910 Ga0496107_0102983 Ga0496107_0102983_1299_2060 253
312 3300048911 Ga0496108_0046829 Ga0496108_0046829_333_1115 253
313 3300048911 Ga0496108_0290464 Ga0496108_0290464_521_1282 253
314 3300048912 Ga0496109_0097341 Ga0496109_0097341_1805_2566 253
315 3300048912 Ga0496109_0375849 Ga0496109_0375849_536_1297 253
316 3300048913 Ga0496110_0069505 Ga0496110_0069505_543_1325 253
317 3300048913 Ga0496110_0097720 Ga0496110_0097720_1217_1978 253
318 3300048913 Ga0496110_0163681 Ga0496110_0163681_112_876 253
319 3300048913 Ga0496110_0329234 Ga0496110_0329234_521_1282 253
320 3300048914 Ga0496111_0117709 Ga0496111_0117709_311_1075 253
321 3300048915 Ga0496112_0213272 Ga0496112_0213272_553_1323 253
322 3300048917 Ga0496114_0132126 Ga0496114_0132126_1049_1810 253
323 3300048917 Ga0496114_0169339 Ga0496114_0169339_1003_1767 253
324 3300048919 Ga0496116_0000067 Ga0496116_0000067_118337_119098 253
325 3300048920 Ga0496117_0000192 Ga0496117_0000192_5477_6238 253
326 3300048921 Ga0496118_0000076 Ga0496118_0000076_118326_119087 253
327 3300048922 Ga0496119_0000237 Ga0496119_0000237_76166_76927 253
328 3300048924 Ga0496121_0005722 Ga0496121_0005722_8556_9317 253
329 3300048927 Ga0496124_0041933 Ga0496124_0041933_2165_2926 253
330 3300048927 Ga0496124_0363031 Ga0496124_0363031_213_974 253
331 3300048929 Ga0496126_0000080 Ga0496126_0000080_102513_103274 253
332 3300049568 Ga0501031_0308265 Ga0501031_0308265_146_916 253
333 3300049569 Ga0501032_0051892 Ga0501032_0051892_871_1632 253
334 3300049571 Ga0501034_0058099 Ga0501034_0058099_1826_2587 253
335 3300049572 Ga0501036_0064777 Ga0501036_0064777_575_1342 253
336 3300049574 Ga0501038_0117657 Ga0501038_0117657_608_1375 253
337 3300049575 Ga0501039_0129041 Ga0501039_0129041_507_1274 253
338 3300049578 Ga0501042_0389309 Ga0501042_0389309_37_798 253
339 3300049579 Ga0501043_0312475 Ga0501043_0312475_20_781 253
340 3300049580 Ga0501046_0000489 Ga0501046_0000489_2547_3308 253
341 3300049581 Ga0501047_0014088 Ga0501047_0014088_2316_3077 253
342 3300049582 Ga0501048_0180373 Ga0501048_0180373_92_853 253
343 3300049583 Ga0501067_0026580 Ga0501067_0026580_949_1710 253
344 3300049584 Ga0501068_0184077 Ga0501068_0184077_25_786 253
345 3300049585 Ga0501069_0002776 Ga0501069_0002776_7680_8441 253
346 3300049586 Ga0501070_0004050 Ga0501070_0004050_1325_2086 253
347 3300049586 Ga0501070_0019334 Ga0501070_0019334_1242_2003 253
348 3300049586 Ga0501070_0212967 Ga0501070_0212967_781_1542 253
349 3300049587 Ga0501071_0195248 Ga0501071_0195248_363_1130 253
350 3300049588 Ga0501072_0021610 Ga0501072_0021610_124_891 253
351 3300049589 Ga0501073_0030122 Ga0501073_0030122_2868_3629 253
352 3300049590 Ga0501074_0012514 Ga0501074_0012514_4158_4919 253
353 3300049590 Ga0501074_0254250 Ga0501074_0254250_465_1232 253
354 3300049591 Ga0501075_0174781 Ga0501075_0174781_384_1151 253
355 3300049741 Ga0501079_0005400 Ga0501079_0005400_8446_9207 253
356 3300049742 Ga0501080_0005179 Ga0501080_0005179_1229_1990 253
357 3300049742 Ga0501080_0006135 Ga0501080_0006135_3277_4038 253
358 3300049744 Ga0501083_0372305 Ga0501083_0372305_80_847 253
359 3300049822 Ga0501035_0000542 Ga0501035_0000542_2905_3666 253
360 3300049823 Ga0501044_0000153 Ga0501044_0000153_47996_48757 253
361 3300049823 Ga0501044_0104873 Ga0501044_0104873_1323_2084 253
362 3300049823 Ga0501044_0202515 Ga0501044_0202515_484_1245 253
363 3300049823 Ga0501044_0549421 Ga0501044_0549421_224_985 253
364 3300050490 nmdc:mga03n38_16394_c1 nmdc:mga03n38_16394_c1_245_1006 253
365 3300050490 nmdc:mga03n38_34464_c1 nmdc:mga03n38_34464_c1_960_1721 253
366 3300050490 nmdc:mga03n38_85533_c1 nmdc:mga03n38_85533_c1_709_1470 253
367 3300050491 nmdc:mga00v17_142821_c1 nmdc:mga00v17_142821_c1_268_1029 253
368 3300050491 nmdc:mga00v17_223958_c1 nmdc:mga00v17_223958_c1_153_923 253
369 3300050491 nmdc:mga00v17_706_c1 nmdc:mga00v17_706_c1_10937_11716 253
370 3300050491 nmdc:mga00v17_99479_c1 nmdc:mga00v17_99479_c1_325_1086 253
371 3300050492 nmdc:mga0yw44_36007_c1 nmdc:mga0yw44_36007_c1_1690_2451 253
372 3300050492 nmdc:mga0yw44_51865_c1 nmdc:mga0yw44_51865_c1_1366_2127 253
373 3300050494 nmdc:mga06z11_101550_c1 nmdc:mga06z11_101550_c1_35_796 253
374 3300050495 nmdc:mga04h51_8892_c3 nmdc:mga04h51_8892_c3_225_986 253
375 3300050496 nmdc:mga07m45_13340_c1 nmdc:mga07m45_13340_c1_2226_2987 253
376 3300050496 nmdc:mga07m45_313795_c1 nmdc:mga07m45_313795_c1_119_886 253
377 3300050509 nmdc:mga0qj67_187148_c1 nmdc:mga0qj67_187148_c1_266_1030 253
378 3300050511 nmdc:mga08y16_93805_c1 nmdc:mga08y16_93805_c1_959_1720 253
379 3300050516 nmdc:mga0sz30_11352_c1 nmdc:mga0sz30_11352_c1_732_1493 253
380 3300053077 Ga0495601_0128855 Ga0495601_0128855_861_1622 253
381 3300053080 Ga0500635_0006292 Ga0500635_0006292_1062_1823 253
382 iso_pu_bacteria 8054609563 8054613295 253
383 3300001977 JGI24746J21847_1016435 JGI24746J21847_10164352 254
384 3300001989 JGI24739J22299_10080943 JGI24739J22299_100809432 254
385 3300001991 JGI24743J22301_10018135 JGI24743J22301_100181352 254
386 3300002070 JGI24750J21931_1017300 JGI24750J21931_10173002 254
387 3300002073 JGI24745J21846_1001374 JGI24745J21846_10013742 254
388 3300002074 JGI24748J21848_1007157 JGI24748J21848_10071571 254
389 3300002075 JGI24738J21930_10010017 JGI24738J21930_100100172 254
390 3300002076 JGI24749J21850_1014763 JGI24749J21850_10147632 254
391 3300002077 JGI24744J21845_10019574 JGI24744J21845_100195742 254
392 3300002239 JGI24034J26672_10009237 JGI24034J26672_100092371 254
393 3300002244 JGI24742J22300_10000474 JGI24742J22300_100004742 254
394 3300003792 Ga0055540_1000129 Ga0055540_10001295 254
395 3300005335 Ga0070666_10115051 Ga0070666_101150512 254
396 3300005336 Ga0070680_100077371 Ga0070680_1000773712 254
397 3300005339 Ga0070660_100121390 Ga0070660_1001213903 254
398 3300005340 Ga0070689_100018088 Ga0070689_1000180884 254
399 3300005353 Ga0070669_100107346 Ga0070669_1001073462 254
400 3300005354 Ga0070675_100229928 Ga0070675_1002299282 254
401 3300005356 Ga0070674_100333679 Ga0070674_1003336791 254
402 3300005364 Ga0070673_100052077 Ga0070673_1000520775 254
403 3300005365 Ga0070688_100215194 Ga0070688_1002151941 254
404 3300005367 Ga0070667_100000519 Ga0070667_1000005197 254
405 3300005367 Ga0070667_100094574 Ga0070667_1000945742 254
406 3300005406 Ga0070703_10037517 Ga0070703_100375171 254
407 3300005434 Ga0070709_10242953 Ga0070709_102429532 254
408 3300005435 Ga0070714_100314249 Ga0070714_1003142491 254
409 3300005436 Ga0070713_100082542 Ga0070713_1000825423 254
410 3300005439 Ga0070711_100372043 Ga0070711_1003720431 254
411 3300005440 Ga0070705_100137437 Ga0070705_1001374371 254
412 3300005441 Ga0070700_100108210 Ga0070700_1001082102 254
413 3300005445 Ga0070708_100164504 Ga0070708_1001645042 254
414 3300005466 Ga0070685_10133521 Ga0070685_101335212 254
415 3300005467 Ga0070706_100027755 Ga0070706_1000277552 254
416 3300005468 Ga0070707_100074196 Ga0070707_1000741962 254
417 3300005471 Ga0070698_100073794 Ga0070698_1000737942 254
418 3300005471 Ga0070698_100400557 Ga0070698_1004005572 254
419 3300005543 Ga0070672_100085830 Ga0070672_1000858302 254
420 3300005544 Ga0070686_100095559 Ga0070686_1000955592 254
421 3300005545 Ga0070695_100053073 Ga0070695_1000530733 254
422 3300005547 Ga0070693_100165906 Ga0070693_1001659062 254
423 3300005548 Ga0070665_100290377 Ga0070665_1002903772 254
424 3300005577 Ga0068857_100481814 Ga0068857_1004818142 254
425 3300005614 Ga0068856_100528614 Ga0068856_1005286141 254
426 3300005617 Ga0068859_100704293 Ga0068859_1007042931 254
427 3300005618 Ga0068864_100166763 Ga0068864_1001667633 254
428 3300005618 Ga0068864_100385535 Ga0068864_1003855352 254
429 3300005834 Ga0068851_10049835 Ga0068851_100498352 254
430 3300005841 Ga0068863_100298399 Ga0068863_1002983992 254
431 3300005843 Ga0068860_100346980 Ga0068860_1003469802 254
432 3300005843 Ga0068860_100418331 Ga0068860_1004183312 254
433 3300005843 Ga0068860_100430295 Ga0068860_1004302952 254
434 3300005844 Ga0068862_100000087 Ga0068862_10000008718 254
435 3300005844 Ga0068862_100273281 Ga0068862_1002732811 254
436 3300005937 Ga0081455_10010764 Ga0081455_1001076410 254
437 3300006163 Ga0070715_10016478 Ga0070715_100164783 254
438 3300006175 Ga0070712_100068958 Ga0070712_1000689582 254
439 3300006846 Ga0075430_100040540 Ga0075430_1000405402 254
440 3300006931 Ga0097620_100000055 Ga0097620_10000005530 254
441 3300006931 Ga0097620_100704312 Ga0097620_1007043121 254
442 3300009092 Ga0105250_10012859 Ga0105250_100128592 254
443 3300009093 Ga0105240_10176840 Ga0105240_101768403 254
444 3300009101 Ga0105247_10149142 Ga0105247_101491423 254
445 3300009174 Ga0105241_10268953 Ga0105241_102689532 254
446 3300009545 Ga0105237_10215049 Ga0105237_102150492 254
447 3300009545 Ga0105237_10489338 Ga0105237_104893382 254
448 3300009551 Ga0105238_10126521 Ga0105238_101265212 254
449 3300010159 Ga0099796_10156910 Ga0099796_101569101 254
450 3300010375 Ga0105239_10085466 Ga0105239_100854664 254
451 3300010375 Ga0105239_10276160 Ga0105239_102761602 254
452 3300013100 Ga0157373_10284146 Ga0157373_102841462 254
453 3300013104 Ga0157370_10153718 Ga0157370_101537182 254
454 3300013306 Ga0163162_10002540 Ga0163162_1000254016 254
455 3300013307 Ga0157372_10558655 Ga0157372_105586552 254
456 3300014325 Ga0163163_10009414 Ga0163163_100094148 254
457 3300014326 Ga0157380_10660754 Ga0157380_106607541 254
458 3300014968 Ga0157379_10113668 Ga0157379_101136683 254
459 3300017792 Ga0163161_10287138 Ga0163161_102871381 254
460 3300025303 Ga0209051_1000034 Ga0209051_10000346 254
461 3300025321 Ga0207656_10096492 Ga0207656_100964922 254
462 3300025885 Ga0207653_10004208 Ga0207653_100042083 254
463 3300025900 Ga0207710_10208236 Ga0207710_102082362 254
464 3300025901 Ga0207688_10017595 Ga0207688_100175955 254
465 3300025903 Ga0207680_10031067 Ga0207680_100310674 254
466 3300025904 Ga0207647_10052239 Ga0207647_100522392 254
467 3300025907 Ga0207645_10014546 Ga0207645_100145464 254
468 3300025910 Ga0207684_10130564 Ga0207684_101305642 254
469 3300025912 Ga0207707_10167309 Ga0207707_101673092 254
470 3300025914 Ga0207671_10094053 Ga0207671_100940532 254
471 3300025914 Ga0207671_10111649 Ga0207671_101116492 254
472 3300025915 Ga0207693_10032663 Ga0207693_100326631 254
473 3300025918 Ga0207662_10013789 Ga0207662_100137893 254
474 3300025922 Ga0207646_10027978 Ga0207646_100279783 254
475 3300025926 Ga0207659_10070262 Ga0207659_100702622 254
476 3300025927 Ga0207687_10143583 Ga0207687_101435832 254
477 3300025928 Ga0207700_10069990 Ga0207700_100699902 254
478 3300025933 Ga0207706_10025968 Ga0207706_100259684 254
479 3300025937 Ga0207669_10152284 Ga0207669_101522842 254
480 3300025939 Ga0207665_10008631 Ga0207665_100086314 254
481 3300025940 Ga0207691_10018114 Ga0207691_100181145 254
482 3300025942 Ga0207689_10007860 Ga0207689_100078602 254
483 3300025949 Ga0207667_10715179 Ga0207667_107151791 254
484 3300025972 Ga0207668_10558485 Ga0207668_105584851 254
485 3300025986 Ga0207658_10000774 Ga0207658_100007744 254
486 3300026023 Ga0207677_10134910 Ga0207677_101349102 254
487 3300026041 Ga0207639_10183159 Ga0207639_101831592 254
488 3300026067 Ga0207678_10035566 Ga0207678_100355664 254
489 3300026075 Ga0207708_10035467 Ga0207708_100354672 254
490 3300026078 Ga0207702_10112524 Ga0207702_101125242 254
491 3300026078 Ga0207702_10316120 Ga0207702_103161201 254
492 3300026088 Ga0207641_10354635 Ga0207641_103546352 254
493 3300026089 Ga0207648_10038279 Ga0207648_100382793 254
494 3300026116 Ga0207674_10832457 Ga0207674_108324571 254
495 3300026118 Ga0207675_100037603 Ga0207675_1000376032 254
496 3300026121 Ga0207683_10739548 Ga0207683_107395481 254
497 3300028380 Ga0268265_10000020 Ga0268265_100000208 254
498 3300028380 Ga0268265_10813356 Ga0268265_108133561 254
499 3300031251 Ga0265327_10001643 Ga0265327_100016437 254
500 3300031251 Ga0265327_10025928 Ga0265327_100259282 254
501 3300035691 Ga0373931_0067444 Ga0373931_0067444_243_1007 254
502 3300037312 Ga0395899_0089742 Ga0395899_0089742_906_1670 254
503 3300037418 Ga0395900_0538682 Ga0395900_0538682_260_1024 254
504 3300037466 Ga0395898_0005642 Ga0395898_0005642_10651_11415 254
505 3300037466 Ga0395898_0033513 Ga0395898_0033513_1749_2513 254
506 3300037471 Ga0395905_0043864 Ga0395905_0043864_1671_2435 254
507 3300037853 Ga0436364_1305262 Ga0436364_1305262_242_1006 254
508 3300038443 Ga0395901_0004342 Ga0395901_0004342_4883_5647 254
509 3300038443 Ga0395901_0014350 Ga0395901_0014350_2568_3332 254
510 3300039437 Ga0436365_0649704 Ga0436365_0649704_2163_2927 254
511 3300047319 Ga0495674_0103201 Ga0495674_0103201_1422_2204 254
512 3300048903 Ga0496100_0001882 Ga0496100_0001882_6355_7137 254
513 3300048903 Ga0496100_0177002 Ga0496100_0177002_511_1275 254
514 3300048903 Ga0496100_0536462 Ga0496100_0536462_21_788 254
515 3300048904 Ga0496101_0000190 Ga0496101_0000190_41217_41999 254
516 3300048906 Ga0496103_0001900 Ga0496103_0001900_7470_8252 254
517 3300048907 Ga0496104_0061356 Ga0496104_0061356_448_1212 254
518 3300048909 Ga0496106_0004364 Ga0496106_0004364_6355_7137 254
519 3300048909 Ga0496106_0113113 Ga0496106_0113113_506_1270 254
520 3300048910 Ga0496107_0001598 Ga0496107_0001598_3359_4141 254
521 3300048910 Ga0496107_0266604 Ga0496107_0266604_240_1004 254
522 3300048911 Ga0496108_0025850 Ga0496108_0025850_3581_4363 254
523 3300048911 Ga0496108_0148358 Ga0496108_0148358_987_1754 254
524 3300048912 Ga0496109_0005598 Ga0496109_0005598_3392_4174 254
525 3300048912 Ga0496109_0278841 Ga0496109_0278841_677_1441 254
526 3300048913 Ga0496110_0007092 Ga0496110_0007092_6342_7124 254
527 3300048913 Ga0496110_0092805 Ga0496110_0092805_1722_2486 254
528 3300048914 Ga0496111_0022789 Ga0496111_0022789_234_1016 254
529 3300048917 Ga0496114_0004789 Ga0496114_0004789_6349_7131 254
530 3300048917 Ga0496114_0033900 Ga0496114_0033900_753_1517 254
531 3300048918 Ga0496115_0011453 Ga0496115_0011453_4899_5681 254
532 3300048918 Ga0496115_0023437 Ga0496115_0023437_1474_2241 254
533 3300048918 Ga0496115_0104587 Ga0496115_0104587_748_1512 254
534 3300048919 Ga0496116_0008100 Ga0496116_0008100_290_1072 254
535 3300048920 Ga0496117_0057989 Ga0496117_0057989_743_1525 254
536 3300048921 Ga0496118_0026894 Ga0496118_0026894_1328_2110 254
537 3300048922 Ga0496119_0011441 Ga0496119_0011441_3494_4276 254
538 3300048923 Ga0496120_0053513 Ga0496120_0053513_158_940 254
539 3300048924 Ga0496121_0000002 Ga0496121_0000002_314586_315368 254
540 3300048925 Ga0496122_0008120 Ga0496122_0008120_4302_5084 254
541 3300048926 Ga0496123_0030579 Ga0496123_0030579_2681_3463 254
542 3300048927 Ga0496124_0000002 Ga0496124_0000002_1179221_1180003 254
543 3300048928 Ga0496125_0000002 Ga0496125_0000002_314586_315368 254
544 3300048929 Ga0496126_0000009 Ga0496126_0000009_434983_435765 254
545 3300050509 nmdc:mga0qj67_47743_c1 nmdc:mga0qj67_47743_c1_2583_3347 254
546 3300050510 nmdc:mga06r32_547386_c1 nmdc:mga06r32_547386_c1_271_1035 254
547 3300053092 Ga0500583_0043402 Ga0500583_0043402_161_928 254
548 3300053130 Ga0500642_0033937 Ga0500642_0033937_1280_2044 254
549 3300053138 Ga0500564_023134 Ga0500564_023134_331_1113 254
550 iso_pu_bacteria 2738541264 2738668870 254
551 iso_pu_bacteria 2738541356 2739148162 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

12

205

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

18

220

0.92

PF08659

KR

KR domain

13

187

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

14

219

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9669 7 254
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9657 7 254
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9649 10 251
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9617 7 254
1vl8-assembly1.cif.gz_B crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution 0.9616 7 254
ID Description Score Start End Superfamily
1vl8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9616 7 254 3.40.50.720
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9591 6 251 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9579 10 254 3.40.50.720
5t5qC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9576 6 251 3.40.50.720
af_Q5BLE6_285_550_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 1 252 3.40.50.720
ID Description Score Start End GO Terms
AF-X7Y0U1-F1-model_v4 deleted 0.9952 60 254
AF-Q0RSM7-F1-model_v4 Putative dehydrogenase (EC 1.1.1.-) 0.9942 1 254 GO:0016616
AF-A0A7U9KQA4-F1-model_v4 Oxidoreductase 0.9937 1 253 GO:0006633
GO:0016616
GO:0048038
AF-A0A7L4Z8H6-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9907 1 254 GO:0006633
GO:0047936
GO:0048038
AF-A0A7K0JPL2-F1-model_v4 deleted 0.9898 1 254

Feature Viewer

pLDDT pTM Quality
95.22 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map