F462568

General Info

Members Datasets Scaffolds Average Seq Length
551 274 1100 453

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100001415|Ga0070670_1000014153
Length 502
Sequence MSGPLRFFRMYLETCDALGRRWSAARHLYGLEVLRFDMPRTIPPRKRMATTVATALILASVSACSDRPTAPHPSSGARTGDVVSTDVITPQLIRQLAAARGIVPLPAPPPVRPALAKLGQALAFDKILSGNRNISCMTCHLPKFATGDGKSLSVGQGGVGLGPPREPPNGNFIPRNAPPLFNLFAMRHLFWDGRVQIDAANQFHTPAGVQLTPAMQNVLEFGPVSALGLFPVTNRAEMRGAPGTDLGDVADNDFTGIWAALMRRLGAIPEYRALFLAAYPATRFEDMTFAHASNAIGAFIVDQFTFNHSPWDNFLAGDDRALTARQLAGAQAFLTLKCSICHNGSTFSDEQFHNVALPQFGPGQGNGQSLLDDFGRMNVTGDPGDQYRFRTSPLRNIDLTAPYGHDGAIVSLRDFVAHYSESDLKLQGFDPLQLELTLRGTVLPNAAAILATRDPLLQGVVIPDDLVDQLMDYMHALTDNAARDLAKSVPVRVPSKLPIDRP

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
181 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
253 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
254 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
259 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
260 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
261 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.18
Rhizosphere 97.64
Stem 0
Stem Tuber 0
Unclassified 13.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100001415 3300005331 Bacteria 19282
2 Ga0065712_10129052 3300005290 Bacteria 1572
3 Ga0070683_100002244 3300005329 Bacteria 15323
4 Ga0070683_100004369 3300005329 Bacteria 11629
5 Ga0070683_100019306 3300005329 Bacteria 6054
6 Ga0070683_100041970 3300005329 Bacteria 4211
7 Ga0070690_100071743 3300005330 Unclassified 2250
8 Ga0070670_100030869 3300005331 Bacteria 4615
9 Ga0068869_100010680 3300005334 Bacteria 5995
10 Ga0068869_100021846 3300005334 Bacteria 4404
11 Ga0070680_100001961 3300005336 Bacteria 15148
12 Ga0070680_100005950 3300005336 Bacteria 9255
13 Ga0070680_100008626 3300005336 Bacteria 7813
14 Ga0070680_100014707 3300005336 Bacteria 6120
15 Ga0070680_100052731 3300005336 Bacteria 3319
16 Ga0070682_100001994 3300005337 Bacteria 11384
17 Ga0070660_100015032 3300005339 Bacteria 5584
18 Ga0070689_100017118 3300005340 Bacteria 5318
19 Ga0070689_100046954 3300005340 Bacteria 3328
20 Ga0070691_10035512 3300005341 Bacteria 2347
21 Ga0070691_10048020 3300005341 Unclassified 2030
22 Ga0070687_100024890 3300005343 Bacteria 2865
23 Ga0070687_100042367 3300005343 Unclassified 2306
24 Ga0070661_100001154 3300005344 Bacteria 18602
25 Ga0070661_100001773 3300005344 Bacteria 14979
26 Ga0070661_100007159 3300005344 Bacteria 7692
27 Ga0070661_100018855 3300005344 Bacteria 4911
28 Ga0070661_100028749 3300005344 Bacteria 4011
29 Ga0070661_100056126 3300005344 Unclassified 2885
30 Ga0070692_10001791 3300005345 Bacteria 8027
31 Ga0070668_100026759 3300005347 Bacteria 4379
32 Ga0070668_100050431 3300005347 Bacteria 3204
33 Ga0070669_100030566 3300005353 Bacteria 3887
34 Ga0070669_100111662 3300005353 Unclassified 2075
35 Ga0070671_100015419 3300005355 Bacteria 6174
36 Ga0070688_100005429 3300005365 Bacteria 6714
37 Ga0070659_100003165 3300005366 Bacteria 11724
38 Ga0070659_100151493 3300005366 Unclassified 1892
39 Ga0070667_100023067 3300005367 Bacteria 5163
40 Ga0070709_10012367 3300005434 Bacteria 4776
41 Ga0070709_10032521 3300005434 Unclassified 3146
42 Ga0070709_10033201 3300005434 Bacteria 3119
43 Ga0070714_100013564 3300005435 Bacteria 6532
44 Ga0070713_100230078 3300005436 Bacteria 1685
45 Ga0070705_100001806 3300005440 Bacteria 11044
46 Ga0070694_100000421 3300005444 Bacteria 23116
47 Ga0070694_100001881 3300005444 Bacteria 12424
48 Ga0070694_100007280 3300005444 Bacteria 6741
49 Ga0070708_100000043 3300005445 Bacteria 82036
50 Ga0070708_100004274 3300005445 Bacteria 11226
51 Ga0070708_100120538 3300005445 Unclassified 2420
52 Ga0070663_100023913 3300005455 Bacteria 4102
53 Ga0070663_100150866 3300005455 Bacteria 1782
54 Ga0070662_100008908 3300005457 Bacteria 6541
55 Ga0070681_10003342 3300005458 Bacteria 14997
56 Ga0070681_10004263 3300005458 Bacteria 13563
57 Ga0070681_10168690 3300005458 Unclassified 2111
58 Ga0068867_100125750 3300005459 Bacteria 1987
59 Ga0070685_10014382 3300005466 Bacteria 4191
60 Ga0070707_100257322 3300005468 Bacteria 1699
61 Ga0070698_100049539 3300005471 Bacteria 4286
62 Ga0070699_100007930 3300005518 Bacteria 9222
63 Ga0070699_100018306 3300005518 Bacteria 6020
64 Ga0070679_100000924 3300005530 Bacteria 25545
65 Ga0070679_100003408 3300005530 Bacteria 14558
66 Ga0070679_100013996 3300005530 Bacteria 7690
67 Ga0070679_100039536 3300005530 Bacteria 4687
68 Ga0070679_100056012 3300005530 Bacteria 3927
69 Ga0070684_100003948 3300005535 Bacteria 11231
70 Ga0070684_100004648 3300005535 Bacteria 10478
71 Ga0070684_100009892 3300005535 Bacteria 7537
72 Ga0070684_100024071 3300005535 Bacteria 5104
73 Ga0070684_100025035 3300005535 Bacteria 5011
74 Ga0070684_100129938 3300005535 Bacteria 2272
75 Ga0070684_100208621 3300005535 Unclassified 1780
76 Ga0070697_100037230 3300005536 Unclassified 3930
77 Ga0070686_100004983 3300005544 Bacteria 7327
78 Ga0070695_100005879 3300005545 Bacteria 7239
79 Ga0070695_100006667 3300005545 Bacteria 6827
80 Ga0070695_100055051 3300005545 Unclassified 2563
81 Ga0070696_100003597 3300005546 Bacteria 10319
82 Ga0070696_100007847 3300005546 Bacteria 7125
83 Ga0070665_100319949 3300005548 Bacteria 1556
84 Ga0070704_100004373 3300005549 Bacteria 8161
85 Ga0070704_100007702 3300005549 Bacteria 6419
86 Ga0068855_100015197 3300005563 Bacteria 9270
87 Ga0068855_100039551 3300005563 Bacteria 5599
88 Ga0070664_100002304 3300005564 Bacteria 15336
89 Ga0070664_100003223 3300005564 Bacteria 13199
90 Ga0070664_100020453 3300005564 Bacteria 5449
91 Ga0070664_100026464 3300005564 Bacteria 4811
92 Ga0070664_100146168 3300005564 Bacteria 2085
93 Ga0068857_100000324 3300005577 Bacteria 32787
94 Ga0068857_100001499 3300005577 Bacteria 18604
95 Ga0068857_100063560 3300005577 Bacteria 3281
96 Ga0068854_100062429 3300005578 Bacteria 2701
97 Ga0068856_100009898 3300005614 Bacteria 9259
98 Ga0068856_100128570 3300005614 Unclassified 2537
99 Ga0070702_100006229 3300005615 Bacteria 5631
100 Ga0068852_100149457 3300005616 Bacteria 2171
101 Ga0068859_100008425 3300005617 Bacteria 10441
102 Ga0068859_100009556 3300005617 Bacteria 9790
103 Ga0068859_100031103 3300005617 Bacteria 5358
104 Ga0068859_100278447 3300005617 Bacteria 1765
105 Ga0068864_100011805 3300005618 Bacteria 7215
106 Ga0068864_100108976 3300005618 Bacteria 2465
107 Ga0068864_100132740 3300005618 Bacteria 2239
108 Ga0068864_100295799 3300005618 Bacteria 1514
109 Ga0068866_10053268 3300005718 Unclassified 2068
110 Ga0068870_10018799 3300005840 Bacteria 3342
111 Ga0068863_100006567 3300005841 Bacteria 11413
112 Ga0068863_100122380 3300005841 Bacteria 2481
113 Ga0068858_100022624 3300005842 Bacteria 5862
114 Ga0068858_100166751 3300005842 Bacteria 2076
115 Ga0068860_100008218 3300005843 Bacteria 10387
116 Ga0068860_100234204 3300005843 Unclassified 1785
117 Ga0081455_10042350 3300005937 Unclassified 3995
118 Ga0070717_10070962 3300006028 Bacteria 2904
119 Ga0070712_100123632 3300006175 Bacteria 1951
120 Ga0097621_100002480 3300006237 Bacteria 12639
121 Ga0075428_100009349 3300006844 Bacteria 10876
122 Ga0075428_100027675 3300006844 Bacteria 6272
123 Ga0075428_100120435 3300006844 Bacteria 2857
124 Ga0075430_100029116 3300006846 Bacteria 4688
125 Ga0075431_100006754 3300006847 Bacteria 11395
126 Ga0075431_100009955 3300006847 Bacteria 9549
127 Ga0075431_100078977 3300006847 Bacteria 3397
128 Ga0075431_100106174 3300006847 Bacteria 2897
129 Ga0075431_100123167 3300006847 Bacteria 2675
130 Ga0075431_100139347 3300006847 Unclassified 2501
131 Ga0075434_100015712 3300006871 Bacteria 7264
132 Ga0075434_100103529 3300006871 Unclassified 2855
133 Ga0075434_100160642 3300006871 Bacteria 2267
134 Ga0075429_100029624 3300006880 Bacteria 4754
135 Ga0075429_100139486 3300006880 Bacteria 2122
136 Ga0068865_100071353 3300006881 Bacteria 2464
137 Ga0068865_100164664 3300006881 Bacteria 1695
138 Ga0075436_100064005 3300006914 Bacteria 2542
139 Ga0097620_100008425 3300006931 Bacteria 10441
140 Ga0097620_100009556 3300006931 Bacteria 9790
141 Ga0097620_100031104 3300006931 Bacteria 5358
142 Ga0097620_100278455 3300006931 Bacteria 1765
143 Ga0075435_100138089 3300007076 Bacteria 2043
144 Ga0099794_10007267 3300007265 Bacteria 4540
145 Ga0105240_10054824 3300009093 Bacteria 4994
146 Ga0105240_10069100 3300009093 Bacteria 4373
147 Ga0105240_10266439 3300009093 Bacteria 1974
148 Ga0105245_10016071 3300009098 Bacteria 6520
149 Ga0114129_10023807 3300009147 Bacteria 8680
150 Ga0114129_10091784 3300009147 Bacteria 4207
151 Ga0114129_10106313 3300009147 Bacteria 3877
152 Ga0114129_10117063 3300009147 Unclassified 3672
153 Ga0114129_10247445 3300009147 Bacteria 2395
154 Ga0105243_10033872 3300009148 Bacteria 3951
155 Ga0105241_10002898 3300009174 Bacteria 12820
156 Ga0105241_10005334 3300009174 Bacteria 9498
157 Ga0105242_10023355 3300009176 Bacteria 4872
158 Ga0105242_10032627 3300009176 Bacteria 4165
159 Ga0105242_10048754 3300009176 Bacteria 3443
160 Ga0105248_10006530 3300009177 Bacteria 12788
161 Ga0105248_10194694 3300009177 Unclassified 2284
162 Ga0105248_10236305 3300009177 Unclassified 2057
163 Ga0105248_10412891 3300009177 Unclassified 1520
164 Ga0105238_10074707 3300009551 Bacteria 3382
165 Ga0105238_10165712 3300009551 Bacteria 2185
166 Ga0105249_10000009 3300009553 Bacteria 313866
167 Ga0105249_10004213 3300009553 Bacteria 12430
168 Ga0105249_10056208 3300009553 Bacteria 3603
169 Ga0105239_10074504 3300010375 Bacteria 3732
170 Ga0105239_10218341 3300010375 Bacteria 2138
171 Ga0157373_10014526 3300013100 Bacteria 5771
172 Ga0157373_10024024 3300013100 Bacteria 4417
173 Ga0157373_10037358 3300013100 Unclassified 3482
174 Ga0157370_10001370 3300013104 Bacteria 30160
175 Ga0157370_10009787 3300013104 Bacteria 10166
176 Ga0157370_10019710 3300013104 Bacteria 6754
177 Ga0157370_10029210 3300013104 Bacteria 5416
178 Ga0157369_10062904 3300013105 Bacteria 3999
179 Ga0157369_10140945 3300013105 Unclassified 2551
180 Ga0157374_10244782 3300013296 Bacteria 1764
181 Ga0157378_10101715 3300013297 Bacteria 2625
182 Ga0163162_10007056 3300013306 Bacteria 10892
183 Ga0163162_10034709 3300013306 Bacteria 5021
184 Ga0157372_10005541 3300013307 Bacteria 13424
185 Ga0157372_10013846 3300013307 Bacteria 8613
186 Ga0157372_10049673 3300013307 Bacteria 4665
187 Ga0157372_10060266 3300013307 Bacteria 4247
188 Ga0157372_10067979 3300013307 Unclassified 4006
189 Ga0157372_10281725 3300013307 Unclassified 1932
190 Ga0157375_10110538 3300013308 Bacteria 2846
191 Ga0163163_10012844 3300014325 Bacteria 7642
192 Ga0163163_10045895 3300014325 Unclassified 4290
193 Ga0163163_10212654 3300014325 Bacteria 1983
194 Ga0182008_10005169 3300014497 Bacteria 7483
195 Ga0157377_10000461 3300014745 Bacteria 17511
196 Ga0157379_10068619 3300014968 Bacteria 3169
197 Ga0157379_10141336 3300014968 Bacteria 2170
198 Ga0157376_10008856 3300014969 Bacteria 7281
199 Ga0163161_10031039 3300017792 Bacteria 3805
200 Ga0163161_10197332 3300017792 Unclassified 1549
201 Ga0213876_10001322 3300021384 Bacteria 15562
202 Ga0207647_10077160 3300025904 Bacteria 2003
203 Ga0207699_10005221 3300025906 Bacteria 6213
204 Ga0207699_10143744 3300025906 Bacteria 1570
205 Ga0207645_10008710 3300025907 Bacteria 7063
206 Ga0207645_10109256 3300025907 Bacteria 1789
207 Ga0207643_10014702 3300025908 Bacteria 4256
208 Ga0207654_10007643 3300025911 Bacteria 5451
209 Ga0207654_10081888 3300025911 Bacteria 1945
210 Ga0207707_10000634 3300025912 Bacteria 34780
211 Ga0207707_10003135 3300025912 Bacteria 14682
212 Ga0207707_10005391 3300025912 Bacteria 11181
213 Ga0207707_10006322 3300025912 Bacteria 10344
214 Ga0207707_10008556 3300025912 Bacteria 8872
215 Ga0207695_10001585 3300025913 Bacteria 36947
216 Ga0207695_10005975 3300025913 Bacteria 15923
217 Ga0207695_10045375 3300025913 Bacteria 4666
218 Ga0207695_10224715 3300025913 Bacteria 1784
219 Ga0207693_10013849 3300025915 Bacteria 6496
220 Ga0207663_10014794 3300025916 Bacteria 4286
221 Ga0207660_10004817 3300025917 Bacteria 8780
222 Ga0207660_10013712 3300025917 Bacteria 5318
223 Ga0207660_10074487 3300025917 Bacteria 2478
224 Ga0207660_10163389 3300025917 Bacteria 1720
225 Ga0207662_10038853 3300025918 Unclassified 2790
226 Ga0207657_10015604 3300025919 Bacteria 7349
227 Ga0207657_10092736 3300025919 Bacteria 2517
228 Ga0207657_10095900 3300025919 Bacteria 2468
229 Ga0207649_10009808 3300025920 Bacteria 5246
230 Ga0207649_10012089 3300025920 Bacteria 4778
231 Ga0207652_10007095 3300025921 Bacteria 9027
232 Ga0207652_10027522 3300025921 Bacteria 4737
233 Ga0207652_10028097 3300025921 Bacteria 4691
234 Ga0207652_10104500 3300025921 Bacteria 2505
235 Ga0207652_10122824 3300025921 Bacteria 2311
236 Ga0207681_10016218 3300025923 Bacteria 4656
237 Ga0207694_10097277 3300025924 Bacteria 2329
238 Ga0207650_10016668 3300025925 Bacteria 5136
239 Ga0207650_10093088 3300025925 Bacteria 2306
240 Ga0207659_10006851 3300025926 Bacteria 7008
241 Ga0207659_10054024 3300025926 Bacteria 2867
242 Ga0207664_10050244 3300025929 Bacteria 3287
243 Ga0207644_10067421 3300025931 Bacteria 2608
244 Ga0207706_10000939 3300025933 Bacteria 29795
245 Ga0207706_10002015 3300025933 Bacteria 19881
246 Ga0207706_10057465 3300025933 Bacteria 3428
247 Ga0207706_10092769 3300025933 Bacteria 2655
248 Ga0207686_10001710 3300025934 Bacteria 12225
249 Ga0207686_10063362 3300025934 Bacteria 2351
250 Ga0207709_10007638 3300025935 Bacteria 6000
251 Ga0207670_10017451 3300025936 Bacteria 4339
252 Ga0207704_10002231 3300025938 Bacteria 8687
253 Ga0207704_10060127 3300025938 Bacteria 2349
254 Ga0207665_10070714 3300025939 Bacteria 2381
255 Ga0207691_10080223 3300025940 Bacteria 2935
256 Ga0207711_10003682 3300025941 Bacteria 13236
257 Ga0207711_10056231 3300025941 Bacteria 3380
258 Ga0207711_10104824 3300025941 Unclassified 2506
259 Ga0207711_10164308 3300025941 Bacteria 2011
260 Ga0207689_10003843 3300025942 Bacteria 13691
261 Ga0207689_10004320 3300025942 Bacteria 12941
262 Ga0207661_10000594 3300025944 Bacteria 23140
263 Ga0207661_10009850 3300025944 Bacteria 6865
264 Ga0207661_10019986 3300025944 Bacteria 4999
265 Ga0207661_10027894 3300025944 Bacteria 4319
266 Ga0207661_10059749 3300025944 Unclassified 3073
267 Ga0207661_10174078 3300025944 Bacteria 1875
268 Ga0207679_10003141 3300025945 Bacteria 10201
269 Ga0207679_10005116 3300025945 Bacteria 8203
270 Ga0207679_10117810 3300025945 Bacteria 2108
271 Ga0207679_10222086 3300025945 Bacteria 1590
272 Ga0207667_10031962 3300025949 Bacteria 5677
273 Ga0207667_10055423 3300025949 Unclassified 4167
274 Ga0207712_10004377 3300025961 Bacteria 8921
275 Ga0207712_10012960 3300025961 Bacteria 5338
276 Ga0207668_10105378 3300025972 Bacteria 2104
277 Ga0207640_10012580 3300025981 Bacteria 4825
278 Ga0207640_10067773 3300025981 Bacteria 2389
279 Ga0207658_10193850 3300025986 Unclassified 1691
280 Ga0207677_10142763 3300026023 Bacteria 1836
281 Ga0207703_10065578 3300026035 Bacteria 2985
282 Ga0207639_10114034 3300026041 Bacteria 2208
283 Ga0207639_10128062 3300026041 Bacteria 2097
284 Ga0207708_10025414 3300026075 Bacteria 4479
285 Ga0207708_10141057 3300026075 Unclassified 1890
286 Ga0207708_10179001 3300026075 Unclassified 1683
287 Ga0207702_10097099 3300026078 Unclassified 2593
288 Ga0207648_10008804 3300026089 Bacteria 9724
289 Ga0207648_10015270 3300026089 Bacteria 7065
290 Ga0207676_10010670 3300026095 Bacteria 6552
291 Ga0207676_10053837 3300026095 Bacteria 3151
292 Ga0207674_10000960 3300026116 Bacteria 37672
293 Ga0207674_10001506 3300026116 Bacteria 30062
294 Ga0207674_10002963 3300026116 Bacteria 21091
295 Ga0207674_10004056 3300026116 Bacteria 17754
296 Ga0207675_100097687 3300026118 Bacteria 2766
297 Ga0207683_10031175 3300026121 Bacteria 4627
298 Ga0207698_10007516 3300026142 Bacteria 6829
299 Ga0207698_10068841 3300026142 Bacteria 2796
300 Ga0207698_10091647 3300026142 Unclassified 2489
301 Ga0209588_1000545 3300027671 Bacteria 9684
302 Ga0209998_10000134 3300027717 Bacteria 28816
303 Ga0209974_10016275 3300027876 Unclassified 2470
304 Ga0268265_10037372 3300028380 Unclassified 3564
305 Ga0268265_10040736 3300028380 Bacteria 3432
306 Ga0307408_100002321 3300031548 Bacteria 13477
307 Ga0307408_100076223 3300031548 Bacteria 2494
308 Ga0307408_100109724 3300031548 Unclassified 2117
309 Ga0307405_10059686 3300031731 Bacteria 2404
310 Ga0307405_10102413 3300031731 Bacteria 1923
311 Ga0307405_10105624 3300031731 Bacteria 1897
312 Ga0307413_10035761 3300031824 Bacteria 2853
313 Ga0307410_10005408 3300031852 Bacteria 6757
314 Ga0307410_10017114 3300031852 Bacteria 4343
315 Ga0307410_10037912 3300031852 Bacteria 3153
316 Ga0307410_10137682 3300031852 Bacteria 1802
317 Ga0307406_10001141 3300031901 Bacteria 14860
318 Ga0307406_10013217 3300031901 Bacteria 4725
319 Ga0307406_10048485 3300031901 Bacteria 2683
320 Ga0307407_10023376 3300031903 Unclassified 3224
321 Ga0307407_10054038 3300031903 Bacteria 2314
322 Ga0307407_10056683 3300031903 Bacteria 2270
323 Ga0307407_10069986 3300031903 Unclassified 2084
324 Ga0307407_10097843 3300031903 Bacteria 1814
325 Ga0307412_10058747 3300031911 Bacteria 2574
326 Ga0307412_10074838 3300031911 Bacteria 2321
327 Ga0307409_100004607 3300031995 Bacteria 7780
328 Ga0307409_100016450 3300031995 Bacteria 4894
329 Ga0307409_100021896 3300031995 Bacteria 4394
330 Ga0307409_100027293 3300031995 Bacteria 4044
331 Ga0307409_100035339 3300031995 Bacteria 3661
332 Ga0307416_100006019 3300032002 Bacteria 7546
333 Ga0307416_100010866 3300032002 Bacteria 6037
334 Ga0307416_100040158 3300032002 Bacteria 3632
335 Ga0307416_100044829 3300032002 Bacteria 3476
336 Ga0307416_100197308 3300032002 Bacteria 1905
337 Ga0307416_100232590 3300032002 Bacteria 1778
338 Ga0307414_10009070 3300032004 Bacteria 5693
339 Ga0307414_10010518 3300032004 Bacteria 5375
340 Ga0307414_10143447 3300032004 Bacteria 1873
341 Ga0307411_10037492 3300032005 Bacteria 3049
342 Ga0307411_10145927 3300032005 Bacteria 1751
343 Ga0307415_100016753 3300032126 Bacteria 4377
344 Ga0307415_100087452 3300032126 Bacteria 2245
345 Ga0307415_100191999 3300032126 Bacteria 1612
346 Ga0373926_0004909 3300035083 Bacteria 4392
347 Ga0373926_0022413 3300035083 Bacteria 2192
348 Ga0373934_0004285 3300035086 Bacteria 5265
349 Ga0373934_0004436 3300035086 Bacteria 5185
350 Ga0373934_0010656 3300035086 Bacteria 3453
351 Ga0373944_0002921 3300035089 Bacteria 4389
352 Ga0373923_0022568 3300035111 Unclassified 2469
353 Ga0373945_0007242 3300035116 Bacteria 3591
354 Ga0373953_0020157 3300035117 Unclassified 2490
355 Ga0373956_0017004 3300035119 Bacteria 3060
356 Ga0373957_0013717 3300035120 Bacteria 2756
357 Ga0373943_0000305 3300035170 Bacteria 20464
358 Ga0373946_0006844 3300035171 Bacteria 4148
359 Ga0373955_0001443 3300035172 Bacteria 10099
360 Ga0373955_0030483 3300035172 Unclassified 2816
361 Ga0373931_0003499 3300035691 Bacteria 7068
362 Ga0373931_0083474 3300035691 Bacteria 1767
363 Ga0373935_0006471 3300035692 Bacteria 6995
364 Ga0373927_0001674 3300035695 Bacteria 16568
365 Ga0373927_0007008 3300035695 Bacteria 7650
366 Ga0373927_0037248 3300035695 Bacteria 3162
367 Ga0373933_0001173 3300035724 Bacteria 15539
368 Ga0373933_0002316 3300035724 Bacteria 10813
369 Ga0373947_0000021 3300035725 Bacteria 89576
370 Ga0373947_0048106 3300035725 Bacteria 2558
371 Ga0373937_0004435 3300036401 Bacteria 11928
372 Ga0373937_0006167 3300036401 Bacteria 10326
373 Ga0373937_0081956 3300036401 Unclassified 2984
374 Ga0373937_0099550 3300036401 Bacteria 2696
375 Ga0373925_0000404 3300037068 Bacteria 43931
376 Ga0373925_0067744 3300037068 Bacteria 2693
377 Ga0395899_0037419 3300037312 Bacteria 3637
378 Ga0395900_0119010 3300037418 Bacteria 2711
379 Ga0395905_0135397 3300037471 Bacteria 2317
380 Ga0395901_0019576 3300038443 Bacteria 6918
381 Ga0242419_000702 3300038698 Bacteria 1885
382 Ga0242420_000073 3300038996 Bacteria 9760
383 Ga0451577_0249625 3300042876 Unclassified 1606
384 Ga0466959_0161595 3300045049 Bacteria 1575
385 Ga0451576_0007901 3300045051 Bacteria 12602
386 Ga0451576_0008589 3300045051 Bacteria 11969
387 Ga0451576_0008701 3300045051 Bacteria 11878
388 Ga0495592_0062221 3300046454 Unclassified 2741
389 Ga0495603_0002813 3300046455 Bacteria 10281
390 Ga0495629_0006731 3300046459 Bacteria 8495
391 Ga0495629_0018116 3300046459 Bacteria 5046
392 Ga0495651_0003792 3300046462 Bacteria 11561
393 Ga0495651_0023788 3300046462 Bacteria 4763
394 Ga0495651_0062356 3300046462 Bacteria 2852
395 Ga0495580_0002768 3300046472 Bacteria 15104
396 Ga0495580_0016398 3300046472 Bacteria 5559
397 Ga0495580_0055814 3300046472 Bacteria 2782
398 Ga0495580_0098864 3300046472 Unclassified 2030
399 Ga0495582_0000297 3300046473 Bacteria 27434
400 Ga0495582_0024388 3300046473 Unclassified 3308
401 Ga0495639_0000027 3300046475 Bacteria 68298
402 Ga0495639_0008195 3300046475 Bacteria 4489
403 Ga0495639_0033380 3300046475 Bacteria 2298
404 Ga0495664_0003445 3300046477 Bacteria 8605
405 Ga0495664_0025008 3300046477 Bacteria 3474
406 Ga0495594_0017262 3300046499 Unclassified 3811
407 Ga0495594_0060961 3300046499 Bacteria 2087
408 Ga0495608_0004648 3300046511 Bacteria 9812
409 Ga0495618_0037789 3300046514 Bacteria 3033
410 Ga0495618_0044162 3300046514 Unclassified 2811
411 Ga0495628_0255354 3300046516 Bacteria 1307
412 Ga0495630_0003275 3300046517 Bacteria 11301
413 Ga0495630_0004673 3300046517 Bacteria 9610
414 Ga0495630_0075573 3300046517 Unclassified 2538
415 Ga0495666_0003169 3300046526 Bacteria 8273
416 Ga0495666_0005012 3300046526 Bacteria 6700
417 Ga0495652_0002098 3300046529 Bacteria 21042
418 Ga0495652_0005462 3300046529 Bacteria 11975
419 Ga0495652_0050727 3300046529 Unclassified 3546
420 Ga0495665_0000010 3300046531 Bacteria 71277
421 Ga0495640_0056085 3300046533 Unclassified 2693
422 Ga0495586_0007841 3300046535 Bacteria 5696
423 Ga0495587_0000350 3300046536 Bacteria 32964
424 Ga0495587_0001195 3300046536 Bacteria 17168
425 Ga0495587_0002463 3300046536 Bacteria 12357
426 Ga0495587_0058553 3300046536 Unclassified 2263
427 Ga0495645_0000349 3300046543 Bacteria 32693
428 Ga0495645_0027204 3300046543 Bacteria 4153
429 Ga0495645_0039417 3300046543 Bacteria 3445
430 Ga0495645_0041824 3300046543 Unclassified 3341
431 Ga0495622_0062999 3300046557 Bacteria 1716
432 Ga0495667_0001991 3300046559 Bacteria 13532
433 Ga0495667_0105210 3300046559 Unclassified 1824
434 Ga0495634_0005261 3300046642 Bacteria 9995
435 Ga0495635_0004834 3300046663 Bacteria 9371
436 Ga0495635_0014421 3300046663 Bacteria 5529
437 Ga0495588_0000379 3300046674 Bacteria 25812
438 Ga0495657_0000625 3300046675 Bacteria 32077
439 Ga0495599_0000215 3300046678 Bacteria 36967
440 Ga0495599_0015787 3300046678 Bacteria 4687
441 Ga0495599_0024656 3300046678 Bacteria 3762
442 Ga0495599_0093473 3300046678 Unclassified 1876
443 Ga0495623_0005593 3300046679 Bacteria 8205
444 Ga0495623_0016307 3300046679 Bacteria 4799
445 Ga0495623_0074793 3300046679 Bacteria 2104
446 Ga0495646_0017398 3300046680 Unclassified 4560
447 Ga0495646_0026586 3300046680 Bacteria 3633
448 Ga0495647_0005628 3300046681 Bacteria 4116
449 Ga0495658_0000072 3300046683 Bacteria 52083
450 Ga0495658_0007846 3300046683 Bacteria 5285
451 Ga0495658_0016561 3300046683 Bacteria 3794
452 Ga0495613_0004207 3300046689 Bacteria 10775
453 Ga0495600_0005005 3300046809 Bacteria 7965
454 Ga0495600_0010017 3300046809 Bacteria 5875
455 Ga0495581_0000086 3300047315 Bacteria 37647
456 Ga0495581_0047190 3300047315 Bacteria 2490
457 Ga0495604_0005479 3300047317 Bacteria 10063
458 Ga0495604_0008559 3300047317 Bacteria 8080
459 Ga0495604_0034055 3300047317 Bacteria 4030
460 Ga0495636_0003247 3300047318 Bacteria 6307
461 Ga0495674_0015641 3300047319 Bacteria 7084
462 Ga0495674_0052060 3300047319 Unclassified 3605
463 Ga0495672_0001857 3300047320 Bacteria 20129
464 Ga0495680_0047345 3300047322 Unclassified 3383
465 Ga0495675_0009108 3300047444 Bacteria 6171
466 Ga0495675_0016318 3300047444 Bacteria 4698
467 Ga0495675_0017423 3300047444 Bacteria 4552
468 Ga0495675_0033170 3300047444 Bacteria 3295
469 Ga0495675_0055029 3300047444 Unclassified 2524
470 Ga0495684_0018077 3300047471 Bacteria 5433
471 Ga0495684_0032702 3300047471 Bacteria 3995
472 Ga0495684_0076086 3300047471 Bacteria 2550
473 Ga0495684_0116688 3300047471 Unclassified 2012
474 Ga0495593_0000651 3300047673 Bacteria 19979
475 Ga0495602_0052528 3300048088 Unclassified 3619
476 Ga0495602_0070404 3300048088 Unclassified 2993
477 Ga0495602_0083204 3300048088 Bacteria 2682
478 Ga0495614_0000022 3300048089 Bacteria 44200
479 Ga0495614_0015987 3300048089 Bacteria 3268
480 Ga0496100_0128840 3300048903 Bacteria 1780
481 Ga0496102_0321840 3300048905 Bacteria 1457
482 Ga0496104_0115631 3300048907 Unclassified 2574
483 Ga0496106_0085197 3300048909 Bacteria 2433
484 Ga0496107_0041983 3300048910 Bacteria 3286
485 Ga0496108_0031880 3300048911 Unclassified 4375
486 Ga0496108_0070064 3300048911 Bacteria 2959
487 Ga0496109_0033840 3300048912 Bacteria 4600
488 Ga0496110_0086341 3300048913 Unclassified 2801
489 Ga0496112_0041397 3300048915 Bacteria 4508
490 Ga0496112_0117896 3300048915 Bacteria 2625
491 Ga0496113_0006285 3300048916 Bacteria 7512
492 Ga0501036_0286931 3300049572 Bacteria 1377
493 Ga0501041_0013418 3300049577 Bacteria 4857
494 Ga0501048_0095422 3300049582 Bacteria 2097
495 Ga0501067_0007402 3300049583 Bacteria 6099
496 Ga0501067_0013319 3300049583 Bacteria 4553
497 Ga0501067_0014926 3300049583 Bacteria 4298
498 Ga0501067_0091839 3300049583 Bacteria 1685
499 Ga0501068_0008472 3300049584 Bacteria 5722
500 Ga0501068_0038593 3300049584 Bacteria 2862
501 Ga0501069_0006533 3300049585 Bacteria 6097
502 Ga0501070_0021862 3300049586 Bacteria 5360
503 Ga0501071_0024409 3300049587 Bacteria 4230
504 Ga0501071_0031664 3300049587 Bacteria 3751
505 Ga0501071_0055428 3300049587 Bacteria 2861
506 Ga0501072_0045478 3300049588 Bacteria 3452
507 Ga0501072_0088191 3300049588 Bacteria 2462
508 Ga0501072_0136786 3300049588 Unclassified 1953
509 Ga0501072_0222968 3300049588 Bacteria 1502
510 Ga0501073_0162032 3300049589 Bacteria 1549
511 Ga0501075_0114566 3300049591 Bacteria 2050
512 Ga0501076_0008611 3300049592 Bacteria 7484
513 Ga0501077_0001754 3300049593 Bacteria 13074
514 Ga0501077_0002110 3300049593 Bacteria 11987
515 Ga0501235_002104 3300049669 Bacteria 4280
516 Ga0501247_005072 3300049677 Bacteria 1458
517 Ga0501245_001762 3300049708 Bacteria 2842
518 Ga0501079_0046526 3300049741 Bacteria 3348
519 Ga0501080_0028475 3300049742 Bacteria 5197
520 Ga0501080_0048520 3300049742 Bacteria 3952
521 Ga0501080_0074543 3300049742 Bacteria 3156
522 Ga0501083_0006788 3300049744 Bacteria 8123
523 Ga0501267_001538 3300049764 Bacteria 1998
524 Ga0501268_005010 3300049765 Bacteria 1887
525 Ga0501272_001564 3300049769 Unclassified 2187
526 Ga0501273_001420 3300049770 Bacteria 2271
527 nmdc:mga05p37_9108_c1 3300050507 Bacteria 11732
528 nmdc:mga09592_134660_c1 3300050508 Bacteria 2128
529 nmdc:mga0qj67_51983_c1 3300050509 Bacteria 3241
530 nmdc:mga06r32_192618_c1 3300050510 Unclassified 2026
531 nmdc:mga06r32_50717_c1 3300050510 Bacteria 3969
532 nmdc:mga06r32_63373_c1 3300050510 Bacteria 3563
533 nmdc:mga06r32_89224_c1 3300050510 Bacteria 3010
534 nmdc:mga0n895_135263_c1 3300050512 Bacteria 2491
535 nmdc:mga0n895_8977_c1 3300050512 Bacteria 8713
536 nmdc:mga08x19_33427_c1 3300050514 Bacteria 3246
537 nmdc:mga08x19_4352_c1 3300050514 Bacteria 8397
538 Ga0495601_0023634 3300053077 Unclassified 3778
539 Ga0495601_0039776 3300053077 Bacteria 2945
540 Ga0495612_0010622 3300053078 Unclassified 3722
541 Ga0495612_0035941 3300053078 Bacteria 2009
542 Ga0495619_0166728 3300053085 Unclassified 1522
543 Ga0501084_0014110 3300054114 Bacteria 6617
544 Ga0501084_0028051 3300054114 Bacteria 4704
545 Ga0501084_0087531 3300054114 Bacteria 2615
546 Ga0590071_000598 3300059421 Bacteria 10346
547 Ga0501082_0040566 3300060353 Bacteria 4015
548 Ga0501082_0278771 3300060353 Unclassified 1455
549 Ga0530510_0031901 3300061734 Unclassified 3789
550 Ga0530510_0032587 3300061734 Bacteria 3750
551 Ga0070670_100001415
552 Ga0065712_10129052
553 Ga0070683_100002244
554 Ga0070683_100004369
555 Ga0070683_100019306
556 Ga0070683_100041970
557 Ga0070690_100071743
558 Ga0070670_100030869
559 Ga0068869_100010680
560 Ga0068869_100021846
561 Ga0070680_100001961
562 Ga0070680_100005950
563 Ga0070680_100008626
564 Ga0070680_100014707
565 Ga0070680_100052731
566 Ga0070682_100001994
567 Ga0070660_100015032
568 Ga0070689_100017118
569 Ga0070689_100046954
570 Ga0070691_10035512
571 Ga0070691_10048020
572 Ga0070687_100024890
573 Ga0070687_100042367
574 Ga0070661_100001154
575 Ga0070661_100001773
576 Ga0070661_100007159
577 Ga0070661_100018855
578 Ga0070661_100028749
579 Ga0070661_100056126
580 Ga0070692_10001791
581 Ga0070668_100026759
582 Ga0070668_100050431
583 Ga0070669_100030566
584 Ga0070669_100111662
585 Ga0070671_100015419
586 Ga0070688_100005429
587 Ga0070659_100003165
588 Ga0070659_100151493
589 Ga0070667_100023067
590 Ga0070709_10012367
591 Ga0070709_10032521
592 Ga0070709_10033201
593 Ga0070714_100013564
594 Ga0070713_100230078
595 Ga0070705_100001806
596 Ga0070694_100000421
597 Ga0070694_100001881
598 Ga0070694_100007280
599 Ga0070708_100000043
600 Ga0070708_100004274
601 Ga0070708_100120538
602 Ga0070663_100023913
603 Ga0070663_100150866
604 Ga0070662_100008908
605 Ga0070681_10003342
606 Ga0070681_10004263
607 Ga0070681_10168690
608 Ga0068867_100125750
609 Ga0070685_10014382
610 Ga0070707_100257322
611 Ga0070698_100049539
612 Ga0070699_100007930
613 Ga0070699_100018306
614 Ga0070679_100000924
615 Ga0070679_100003408
616 Ga0070679_100013996
617 Ga0070679_100039536
618 Ga0070679_100056012
619 Ga0070684_100003948
620 Ga0070684_100004648
621 Ga0070684_100009892
622 Ga0070684_100024071
623 Ga0070684_100025035
624 Ga0070684_100129938
625 Ga0070684_100208621
626 Ga0070697_100037230
627 Ga0070686_100004983
628 Ga0070695_100005879
629 Ga0070695_100006667
630 Ga0070695_100055051
631 Ga0070696_100003597
632 Ga0070696_100007847
633 Ga0070665_100319949
634 Ga0070704_100004373
635 Ga0070704_100007702
636 Ga0068855_100015197
637 Ga0068855_100039551
638 Ga0070664_100002304
639 Ga0070664_100003223
640 Ga0070664_100020453
641 Ga0070664_100026464
642 Ga0070664_100146168
643 Ga0068857_100000324
644 Ga0068857_100001499
645 Ga0068857_100063560
646 Ga0068854_100062429
647 Ga0068856_100009898
648 Ga0068856_100128570
649 Ga0070702_100006229
650 Ga0068852_100149457
651 Ga0068859_100008425
652 Ga0068859_100009556
653 Ga0068859_100031103
654 Ga0068859_100278447
655 Ga0068864_100011805
656 Ga0068864_100108976
657 Ga0068864_100132740
658 Ga0068864_100295799
659 Ga0068866_10053268
660 Ga0068870_10018799
661 Ga0068863_100006567
662 Ga0068863_100122380
663 Ga0068858_100022624
664 Ga0068858_100166751
665 Ga0068860_100008218
666 Ga0068860_100234204
667 Ga0081455_10042350
668 Ga0070717_10070962
669 Ga0070712_100123632
670 Ga0097621_100002480
671 Ga0075428_100009349
672 Ga0075428_100027675
673 Ga0075428_100120435
674 Ga0075430_100029116
675 Ga0075431_100006754
676 Ga0075431_100009955
677 Ga0075431_100078977
678 Ga0075431_100106174
679 Ga0075431_100123167
680 Ga0075431_100139347
681 Ga0075434_100015712
682 Ga0075434_100103529
683 Ga0075434_100160642
684 Ga0075429_100029624
685 Ga0075429_100139486
686 Ga0068865_100071353
687 Ga0068865_100164664
688 Ga0075436_100064005
689 Ga0097620_100008425
690 Ga0097620_100009556
691 Ga0097620_100031104
692 Ga0097620_100278455
693 Ga0075435_100138089
694 Ga0099794_10007267
695 Ga0105240_10054824
696 Ga0105240_10069100
697 Ga0105240_10266439
698 Ga0105245_10016071
699 Ga0114129_10023807
700 Ga0114129_10091784
701 Ga0114129_10106313
702 Ga0114129_10117063
703 Ga0114129_10247445
704 Ga0105243_10033872
705 Ga0105241_10002898
706 Ga0105241_10005334
707 Ga0105242_10023355
708 Ga0105242_10032627
709 Ga0105242_10048754
710 Ga0105248_10006530
711 Ga0105248_10194694
712 Ga0105248_10236305
713 Ga0105248_10412891
714 Ga0105238_10074707
715 Ga0105238_10165712
716 Ga0105249_10000009
717 Ga0105249_10004213
718 Ga0105249_10056208
719 Ga0105239_10074504
720 Ga0105239_10218341
721 Ga0157373_10014526
722 Ga0157373_10024024
723 Ga0157373_10037358
724 Ga0157370_10001370
725 Ga0157370_10009787
726 Ga0157370_10019710
727 Ga0157370_10029210
728 Ga0157369_10062904
729 Ga0157369_10140945
730 Ga0157374_10244782
731 Ga0157378_10101715
732 Ga0163162_10007056
733 Ga0163162_10034709
734 Ga0157372_10005541
735 Ga0157372_10013846
736 Ga0157372_10049673
737 Ga0157372_10060266
738 Ga0157372_10067979
739 Ga0157372_10281725
740 Ga0157375_10110538
741 Ga0163163_10012844
742 Ga0163163_10045895
743 Ga0163163_10212654
744 Ga0182008_10005169
745 Ga0157377_10000461
746 Ga0157379_10068619
747 Ga0157379_10141336
748 Ga0157376_10008856
749 Ga0163161_10031039
750 Ga0163161_10197332
751 Ga0213876_10001322
752 Ga0207647_10077160
753 Ga0207699_10005221
754 Ga0207699_10143744
755 Ga0207645_10008710
756 Ga0207645_10109256
757 Ga0207643_10014702
758 Ga0207654_10007643
759 Ga0207654_10081888
760 Ga0207707_10000634
761 Ga0207707_10003135
762 Ga0207707_10005391
763 Ga0207707_10006322
764 Ga0207707_10008556
765 Ga0207695_10001585
766 Ga0207695_10005975
767 Ga0207695_10045375
768 Ga0207695_10224715
769 Ga0207693_10013849
770 Ga0207663_10014794
771 Ga0207660_10004817
772 Ga0207660_10013712
773 Ga0207660_10074487
774 Ga0207660_10163389
775 Ga0207662_10038853
776 Ga0207657_10015604
777 Ga0207657_10092736
778 Ga0207657_10095900
779 Ga0207649_10009808
780 Ga0207649_10012089
781 Ga0207652_10007095
782 Ga0207652_10027522
783 Ga0207652_10028097
784 Ga0207652_10104500
785 Ga0207652_10122824
786 Ga0207681_10016218
787 Ga0207694_10097277
788 Ga0207650_10016668
789 Ga0207650_10093088
790 Ga0207659_10006851
791 Ga0207659_10054024
792 Ga0207664_10050244
793 Ga0207644_10067421
794 Ga0207706_10000939
795 Ga0207706_10002015
796 Ga0207706_10057465
797 Ga0207706_10092769
798 Ga0207686_10001710
799 Ga0207686_10063362
800 Ga0207709_10007638
801 Ga0207670_10017451
802 Ga0207704_10002231
803 Ga0207704_10060127
804 Ga0207665_10070714
805 Ga0207691_10080223
806 Ga0207711_10003682
807 Ga0207711_10056231
808 Ga0207711_10104824
809 Ga0207711_10164308
810 Ga0207689_10003843
811 Ga0207689_10004320
812 Ga0207661_10000594
813 Ga0207661_10009850
814 Ga0207661_10019986
815 Ga0207661_10027894
816 Ga0207661_10059749
817 Ga0207661_10174078
818 Ga0207679_10003141
819 Ga0207679_10005116
820 Ga0207679_10117810
821 Ga0207679_10222086
822 Ga0207667_10031962
823 Ga0207667_10055423
824 Ga0207712_10004377
825 Ga0207712_10012960
826 Ga0207668_10105378
827 Ga0207640_10012580
828 Ga0207640_10067773
829 Ga0207658_10193850
830 Ga0207677_10142763
831 Ga0207703_10065578
832 Ga0207639_10114034
833 Ga0207639_10128062
834 Ga0207708_10025414
835 Ga0207708_10141057
836 Ga0207708_10179001
837 Ga0207702_10097099
838 Ga0207648_10008804
839 Ga0207648_10015270
840 Ga0207676_10010670
841 Ga0207676_10053837
842 Ga0207674_10000960
843 Ga0207674_10001506
844 Ga0207674_10002963
845 Ga0207674_10004056
846 Ga0207675_100097687
847 Ga0207683_10031175
848 Ga0207698_10007516
849 Ga0207698_10068841
850 Ga0207698_10091647
851 Ga0209588_1000545
852 Ga0209998_10000134
853 Ga0209974_10016275
854 Ga0268265_10037372
855 Ga0268265_10040736
856 Ga0307408_100002321
857 Ga0307408_100076223
858 Ga0307408_100109724
859 Ga0307405_10059686
860 Ga0307405_10102413
861 Ga0307405_10105624
862 Ga0307413_10035761
863 Ga0307410_10005408
864 Ga0307410_10017114
865 Ga0307410_10037912
866 Ga0307410_10137682
867 Ga0307406_10001141
868 Ga0307406_10013217
869 Ga0307406_10048485
870 Ga0307407_10023376
871 Ga0307407_10054038
872 Ga0307407_10056683
873 Ga0307407_10069986
874 Ga0307407_10097843
875 Ga0307412_10058747
876 Ga0307412_10074838
877 Ga0307409_100004607
878 Ga0307409_100016450
879 Ga0307409_100021896
880 Ga0307409_100027293
881 Ga0307409_100035339
882 Ga0307416_100006019
883 Ga0307416_100010866
884 Ga0307416_100040158
885 Ga0307416_100044829
886 Ga0307416_100197308
887 Ga0307416_100232590
888 Ga0307414_10009070
889 Ga0307414_10010518
890 Ga0307414_10143447
891 Ga0307411_10037492
892 Ga0307411_10145927
893 Ga0307415_100016753
894 Ga0307415_100087452
895 Ga0307415_100191999
896 Ga0373926_0004909
897 Ga0373926_0022413
898 Ga0373934_0004285
899 Ga0373934_0004436
900 Ga0373934_0010656
901 Ga0373944_0002921
902 Ga0373923_0022568
903 Ga0373945_0007242
904 Ga0373953_0020157
905 Ga0373956_0017004
906 Ga0373957_0013717
907 Ga0373943_0000305
908 Ga0373946_0006844
909 Ga0373955_0001443
910 Ga0373955_0030483
911 Ga0373931_0003499
912 Ga0373931_0083474
913 Ga0373935_0006471
914 Ga0373927_0001674
915 Ga0373927_0007008
916 Ga0373927_0037248
917 Ga0373933_0001173
918 Ga0373933_0002316
919 Ga0373947_0000021
920 Ga0373947_0048106
921 Ga0373937_0004435
922 Ga0373937_0006167
923 Ga0373937_0081956
924 Ga0373937_0099550
925 Ga0373925_0000404
926 Ga0373925_0067744
927 Ga0395899_0037419
928 Ga0395900_0119010
929 Ga0395905_0135397
930 Ga0395901_0019576
931 Ga0242419_000702
932 Ga0242420_000073
933 Ga0451577_0249625
934 Ga0466959_0161595
935 Ga0451576_0007901
936 Ga0451576_0008589
937 Ga0451576_0008701
938 Ga0495592_0062221
939 Ga0495603_0002813
940 Ga0495629_0006731
941 Ga0495629_0018116
942 Ga0495651_0003792
943 Ga0495651_0023788
944 Ga0495651_0062356
945 Ga0495580_0002768
946 Ga0495580_0016398
947 Ga0495580_0055814
948 Ga0495580_0098864
949 Ga0495582_0000297
950 Ga0495582_0024388
951 Ga0495639_0000027
952 Ga0495639_0008195
953 Ga0495639_0033380
954 Ga0495664_0003445
955 Ga0495664_0025008
956 Ga0495594_0017262
957 Ga0495594_0060961
958 Ga0495608_0004648
959 Ga0495618_0037789
960 Ga0495618_0044162
961 Ga0495628_0255354
962 Ga0495630_0003275
963 Ga0495630_0004673
964 Ga0495630_0075573
965 Ga0495666_0003169
966 Ga0495666_0005012
967 Ga0495652_0002098
968 Ga0495652_0005462
969 Ga0495652_0050727
970 Ga0495665_0000010
971 Ga0495640_0056085
972 Ga0495586_0007841
973 Ga0495587_0000350
974 Ga0495587_0001195
975 Ga0495587_0002463
976 Ga0495587_0058553
977 Ga0495645_0000349
978 Ga0495645_0027204
979 Ga0495645_0039417
980 Ga0495645_0041824
981 Ga0495622_0062999
982 Ga0495667_0001991
983 Ga0495667_0105210
984 Ga0495634_0005261
985 Ga0495635_0004834
986 Ga0495635_0014421
987 Ga0495588_0000379
988 Ga0495657_0000625
989 Ga0495599_0000215
990 Ga0495599_0015787
991 Ga0495599_0024656
992 Ga0495599_0093473
993 Ga0495623_0005593
994 Ga0495623_0016307
995 Ga0495623_0074793
996 Ga0495646_0017398
997 Ga0495646_0026586
998 Ga0495647_0005628
999 Ga0495658_0000072
1000 Ga0495658_0007846
1001 Ga0495658_0016561
1002 Ga0495613_0004207
1003 Ga0495600_0005005
1004 Ga0495600_0010017
1005 Ga0495581_0000086
1006 Ga0495581_0047190
1007 Ga0495604_0005479
1008 Ga0495604_0008559
1009 Ga0495604_0034055
1010 Ga0495636_0003247
1011 Ga0495674_0015641
1012 Ga0495674_0052060
1013 Ga0495672_0001857
1014 Ga0495680_0047345
1015 Ga0495675_0009108
1016 Ga0495675_0016318
1017 Ga0495675_0017423
1018 Ga0495675_0033170
1019 Ga0495675_0055029
1020 Ga0495684_0018077
1021 Ga0495684_0032702
1022 Ga0495684_0076086
1023 Ga0495684_0116688
1024 Ga0495593_0000651
1025 Ga0495602_0052528
1026 Ga0495602_0070404
1027 Ga0495602_0083204
1028 Ga0495614_0000022
1029 Ga0495614_0015987
1030 Ga0496100_0128840
1031 Ga0496102_0321840
1032 Ga0496104_0115631
1033 Ga0496106_0085197
1034 Ga0496107_0041983
1035 Ga0496108_0031880
1036 Ga0496108_0070064
1037 Ga0496109_0033840
1038 Ga0496110_0086341
1039 Ga0496112_0041397
1040 Ga0496112_0117896
1041 Ga0496113_0006285
1042 Ga0501036_0286931
1043 Ga0501041_0013418
1044 Ga0501048_0095422
1045 Ga0501067_0007402
1046 Ga0501067_0013319
1047 Ga0501067_0014926
1048 Ga0501067_0091839
1049 Ga0501068_0008472
1050 Ga0501068_0038593
1051 Ga0501069_0006533
1052 Ga0501070_0021862
1053 Ga0501071_0024409
1054 Ga0501071_0031664
1055 Ga0501071_0055428
1056 Ga0501072_0045478
1057 Ga0501072_0088191
1058 Ga0501072_0136786
1059 Ga0501072_0222968
1060 Ga0501073_0162032
1061 Ga0501075_0114566
1062 Ga0501076_0008611
1063 Ga0501077_0001754
1064 Ga0501077_0002110
1065 Ga0501235_002104
1066 Ga0501247_005072
1067 Ga0501245_001762
1068 Ga0501079_0046526
1069 Ga0501080_0028475
1070 Ga0501080_0048520
1071 Ga0501080_0074543
1072 Ga0501083_0006788
1073 Ga0501267_001538
1074 Ga0501268_005010
1075 Ga0501272_001564
1076 Ga0501273_001420
1077 nmdc:mga05p37_9108_c1
1078 nmdc:mga09592_134660_c1
1079 nmdc:mga0qj67_51983_c1
1080 nmdc:mga06r32_192618_c1
1081 nmdc:mga06r32_50717_c1
1082 nmdc:mga06r32_63373_c1
1083 nmdc:mga06r32_89224_c1
1084 nmdc:mga0n895_135263_c1
1085 nmdc:mga0n895_8977_c1
1086 nmdc:mga08x19_33427_c1
1087 nmdc:mga08x19_4352_c1
1088 Ga0495601_0023634
1089 Ga0495601_0039776
1090 Ga0495612_0010622
1091 Ga0495612_0035941
1092 Ga0495619_0166728
1093 Ga0501084_0014110
1094 Ga0501084_0028051
1095 Ga0501084_0087531
1096 Ga0590071_000598
1097 Ga0501082_0040566
1098 Ga0501082_0278771
1099 Ga0530510_0031901
1100 Ga0530510_0032587

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03150

CCP_MauG

Di-haem cytochrome c peroxidase

113

320

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o5c-assembly2.cif.gz_C cytochrome c peroxidase bccp of shewanella oneidensis 0.8134 53 401
6fu3-assembly1.cif.gz_B structure of the mixed-valence, active form, of cytochrome c peroxidase from obligate human pathogenic bacterium neisseria gonorrhoeae 0.7973 39 401
1iqc-assembly2.cif.gz_D crystal structure of di-heme peroxidase from nitrosomonas europaea 0.7868 51 413
1zzh-assembly3.cif.gz_D structure of the fully oxidized di-heme cytochrome c peroxidase from r. capsulatus 0.7762 42 370
2vhd-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form 0.7753 40 406
ID Description Score Start End Superfamily
4aanA02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.869 56 253 1.10.760.10
3o5cD02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8192 64 273 1.10.760.10
3o5cD02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8096 64 273 1.10.760.10
6fu3B02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7678 43 273 1.10.760.10
4aanA02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7585 56 253 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A850G9X4-F1-model_v4 Cytochrome c domain-containing protein 0.9687 54 406 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A7X3PI45-F1-model_v4 Cytochrome c domain-containing protein 0.9641 39 416 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A6L8CL79-F1-model_v4 deleted 0.9609 98 416
AF-A0A7Y4SWY2-F1-model_v4 Cytochrome-c peroxidase 0.9415 34 409 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A1Y0I630-F1-model_v4 Di-heme cytochrome c peroxidase 0.9408 39 413 GO:0004130
GO:0009055
GO:0020037
GO:0046872

Map