F462489

General Info

Members Datasets Scaffolds Average Seq Length
550 318 1100 241

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10079765|Ga0105242_100797652
Length 237
Sequence MLDAAPLLTVENLQAWYGESHVLHGVNFTVRAGEVVTLLGRNGAGKTTTLKSIMGIVPRRTGSIRFEGRELVGLAPYQIARAGIAFCPEERGVFGSLSVSENLVLPPVVRPGGLDLSRVFGLFPNLKERLGTRQGTKLSGGEQQMLAIGRILRTGARLLLLDEPTEGLAPVIIQQIGHTIRALKEQGFTILLVEQNFRFASTVADRYYVMEHGRVVESFANAELSANLDKLHEYLGV

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
213 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
214 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
292 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
295 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
296 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
297 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
298 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
299 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
302 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
303 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
309 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
310 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
311 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
312 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
313 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
314 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
315 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
316 2904456579 Variovorax sp. 2002 Isolate Unclassified
317 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
318 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 0.18
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.45
Nodule 0.36
Rhizoplane 4.55
Rhizosphere 82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10079765 3300009176 Bacteria 2734
2 JGI24735J21928_10023092 3300002067 Bacteria 1888
3 JGI24745J21846_1000774 3300002073 Bacteria 2926
4 Ga0055534_1025847 3300003784 Bacteria 940
5 Ga0070658_10190724 3300005327 Bacteria 1727
6 Ga0070683_100135141 3300005329 Bacteria 2335
7 Ga0070683_100576242 3300005329 Bacteria 1076
8 Ga0070690_100000344 3300005330 Bacteria 23913
9 Ga0070690_100187130 3300005330 Bacteria 1434
10 Ga0070690_100198016 3300005330 Bacteria 1396
11 Ga0070690_100242287 3300005330 Bacteria 1272
12 Ga0070690_100279322 3300005330 Bacteria 1191
13 Ga0068869_100002144 3300005334 Bacteria 11864
14 Ga0068869_100040774 3300005334 Bacteria 3322
15 Ga0068869_100635464 3300005334 Bacteria 905
16 Ga0070680_100004921 3300005336 Bacteria 10056
17 Ga0070680_100455549 3300005336 Bacteria 1093
18 Ga0070682_100041484 3300005337 Bacteria 2837
19 Ga0070682_100108094 3300005337 Bacteria 1849
20 Ga0068868_100000535 3300005338 Bacteria 25442
21 Ga0068868_100740010 3300005338 Bacteria 883
22 Ga0070660_100362073 3300005339 Bacteria 1195
23 Ga0070660_100433613 3300005339 Bacteria 1089
24 Ga0070689_100000134 3300005340 Bacteria 43133
25 Ga0070689_100014831 3300005340 Bacteria 5669
26 Ga0070689_100106609 3300005340 Bacteria 2224
27 Ga0070691_10008735 3300005341 Bacteria 4637
28 Ga0070687_100000131 3300005343 Bacteria 25941
29 Ga0070687_100032163 3300005343 Bacteria 2579
30 Ga0070687_100172372 3300005343 Bacteria 1289
31 Ga0070661_100104383 3300005344 Bacteria 2111
32 Ga0070668_100054606 3300005347 Bacteria 3081
33 Ga0070675_100048760 3300005354 Bacteria 3473
34 Ga0070675_100756245 3300005354 Bacteria 887
35 Ga0070671_100503945 3300005355 Bacteria 1041
36 Ga0070674_100232463 3300005356 Bacteria 1439
37 Ga0070673_100774378 3300005364 Bacteria 885
38 Ga0070688_100198090 3300005365 Bacteria 1403
39 Ga0070659_100141933 3300005366 Bacteria 1955
40 Ga0070703_10012807 3300005406 Bacteria 2376
41 Ga0070714_100161492 3300005435 Bacteria 2027
42 Ga0070713_100357084 3300005436 Bacteria 1357
43 Ga0070701_10000024 3300005438 Bacteria 39082
44 Ga0070701_10035946 3300005438 Bacteria 2493
45 Ga0070705_100000130 3300005440 Bacteria 43931
46 Ga0070705_100002576 3300005440 Bacteria 9092
47 Ga0070705_100177661 3300005440 Bacteria 1439
48 Ga0070700_100000530 3300005441 Bacteria 19049
49 Ga0070700_100010817 3300005441 Bacteria 5045
50 Ga0070694_100000172 3300005444 Bacteria 33434
51 Ga0070694_100000351 3300005444 Bacteria 24729
52 Ga0070708_100015757 3300005445 Bacteria 6248
53 Ga0070663_100020850 3300005455 Bacteria 4345
54 Ga0070662_100088654 3300005457 Bacteria 2319
55 Ga0070662_100424299 3300005457 Bacteria 1101
56 Ga0070681_10016370 3300005458 Bacteria 7402
57 Ga0070681_10183487 3300005458 Bacteria 2014
58 Ga0070681_10187543 3300005458 Bacteria 1988
59 Ga0070681_10431450 3300005458 Bacteria 1230
60 Ga0068867_100000272 3300005459 Bacteria 33927
61 Ga0068867_100416782 3300005459 Bacteria 1137
62 Ga0070685_10029203 3300005466 Bacteria 3061
63 Ga0070706_100093686 3300005467 Bacteria 2787
64 Ga0070706_100391596 3300005467 Bacteria 1293
65 Ga0070707_100004554 3300005468 Bacteria 12984
66 Ga0070698_100174266 3300005471 Bacteria 2091
67 Ga0070698_100307308 3300005471 Bacteria 1517
68 Ga0070699_100001046 3300005518 Bacteria 25759
69 Ga0070699_100195558 3300005518 Bacteria 1797
70 Ga0070699_100401200 3300005518 Bacteria 1240
71 Ga0070679_100059743 3300005530 Bacteria 3799
72 Ga0070679_100060461 3300005530 Bacteria 3776
73 Ga0070697_100077909 3300005536 Bacteria 2727
74 Ga0070697_100085540 3300005536 Bacteria 2601
75 Ga0070697_100429482 3300005536 Bacteria 1149
76 Ga0070672_100191344 3300005543 Bacteria 1708
77 Ga0070672_100540491 3300005543 Bacteria 1011
78 Ga0070672_100717784 3300005543 Bacteria 876
79 Ga0070686_100000135 3300005544 Bacteria 51065
80 Ga0070686_100084469 3300005544 Bacteria 2110
81 Ga0070695_100000056 3300005545 Bacteria 45852
82 Ga0070695_100000331 3300005545 Bacteria 24300
83 Ga0070696_100000119 3300005546 Bacteria 41152
84 Ga0070696_100190986 3300005546 Bacteria 1524
85 Ga0070696_100235184 3300005546 Bacteria 1380
86 Ga0070693_100000064 3300005547 Bacteria 42802
87 Ga0070693_100133801 3300005547 Bacteria 1553
88 Ga0070693_100174846 3300005547 Bacteria 1378
89 Ga0070665_100040280 3300005548 Bacteria 4696
90 Ga0070665_100152356 3300005548 Bacteria 2315
91 Ga0070704_100000186 3300005549 Bacteria 25295
92 Ga0070704_100214031 3300005549 Bacteria 1563
93 Ga0068855_100006837 3300005563 Bacteria 13838
94 Ga0070664_100281278 3300005564 Bacteria 1500
95 Ga0068857_100009295 3300005577 Bacteria 8530
96 Ga0068854_100097145 3300005578 Bacteria 2202
97 Ga0068856_100028106 3300005614 Bacteria 5489
98 Ga0068856_100045780 3300005614 Bacteria 4309
99 Ga0070702_100000292 3300005615 Bacteria 17132
100 Ga0070702_100019767 3300005615 Bacteria 3520
101 Ga0070702_100067664 3300005615 Bacteria 2099
102 Ga0068852_100053136 3300005616 Bacteria 3485
103 Ga0068852_100373909 3300005616 Bacteria 1397
104 Ga0068859_100000988 3300005617 Bacteria 29125
105 Ga0068859_100001278 3300005617 Bacteria 25750
106 Ga0068859_100140702 3300005617 Bacteria 2487
107 Ga0068864_100014140 3300005618 Bacteria 6622
108 Ga0068866_10000450 3300005718 Bacteria 18946
109 Ga0068861_100000105 3300005719 Bacteria 41802
110 Ga0068861_100094404 3300005719 Bacteria 2367
111 Ga0068861_100247426 3300005719 Bacteria 1519
112 Ga0068851_10042449 3300005834 Bacteria 2289
113 Ga0068851_10092356 3300005834 Bacteria 1595
114 Ga0068870_10228822 3300005840 Bacteria 1142
115 Ga0068863_100011184 3300005841 Bacteria 8698
116 Ga0068863_100191197 3300005841 Bacteria 1967
117 Ga0068863_100255414 3300005841 Bacteria 1694
118 Ga0068858_100001246 3300005842 Bacteria 26303
119 Ga0068858_100255105 3300005842 Bacteria 1666
120 Ga0068858_100856731 3300005842 Bacteria 888
121 Ga0068860_100002222 3300005843 Bacteria 20428
122 Ga0068860_100005235 3300005843 Bacteria 13173
123 Ga0068860_100008797 3300005843 Bacteria 10060
124 Ga0068860_100353273 3300005843 Bacteria 1447
125 Ga0068860_100368191 3300005843 Bacteria 1417
126 Ga0068860_100577925 3300005843 Bacteria 1128
127 Ga0068862_100001163 3300005844 Bacteria 24820
128 Ga0068862_100125431 3300005844 Bacteria 2266
129 Ga0068862_100730440 3300005844 Bacteria 962
130 Ga0081455_10063680 3300005937 Bacteria 3093
131 Ga0070717_10074922 3300006028 Bacteria 2830
132 Ga0075365_10247221 3300006038 Bacteria 1253
133 Ga0075368_10064133 3300006042 Bacteria 1474
134 Ga0070715_10175006 3300006163 Bacteria 1072
135 Ga0075362_10079749 3300006177 Bacteria 1508
136 Ga0075367_10083965 3300006178 Bacteria 1930
137 Ga0075366_10038821 3300006195 Bacteria 2812
138 Ga0097621_100007973 3300006237 Bacteria 7601
139 Ga0097621_100420920 3300006237 Bacteria 1199
140 Ga0068871_100000842 3300006358 Bacteria 20552
141 Ga0068871_100008260 3300006358 Bacteria 7483
142 Ga0068871_100154834 3300006358 Bacteria 1957
143 Ga0075428_100000643 3300006844 Bacteria 35894
144 Ga0075428_100106125 3300006844 Bacteria 3062
145 Ga0075430_100000052 3300006846 Bacteria 60703
146 Ga0075431_100000441 3300006847 Bacteria 33990
147 Ga0075433_10000276 3300006852 Bacteria 30320
148 Ga0075434_100000597 3300006871 Bacteria 27906
149 Ga0075434_100282901 3300006871 Bacteria 1678
150 Ga0075429_100034042 3300006880 Bacteria 4426
151 Ga0075429_100107506 3300006880 Bacteria 2438
152 Ga0068865_100000342 3300006881 Bacteria 25780
153 Ga0075436_100007341 3300006914 Bacteria 7532
154 Ga0097620_100000988 3300006931 Bacteria 29125
155 Ga0097620_100001278 3300006931 Bacteria 25750
156 Ga0097620_100140697 3300006931 Bacteria 2487
157 Ga0075435_100000328 3300007076 Bacteria 29254
158 Ga0075435_100813792 3300007076 Bacteria 814
159 Ga0099794_10000110 3300007265 Bacteria 29860
160 Ga0111539_11070914 3300009094 Bacteria 937
161 Ga0105245_10000247 3300009098 Bacteria 51408
162 Ga0105245_10060139 3300009098 Bacteria 3422
163 Ga0105245_10212486 3300009098 Bacteria 1863
164 Ga0105245_10480158 3300009098 Bacteria 1256
165 Ga0105247_10169829 3300009101 Bacteria 1449
166 Ga0114129_10002725 3300009147 Bacteria 24625
167 Ga0114129_10028184 3300009147 Bacteria 7957
168 Ga0114129_10043464 3300009147 Bacteria 6321
169 Ga0105243_10001067 3300009148 Bacteria 25084
170 Ga0105243_10105801 3300009148 Bacteria 2344
171 Ga0105242_10000982 3300009176 Bacteria 22278
172 Ga0105248_10070781 3300009177 Bacteria 3917
173 Ga0105248_11286082 3300009177 Bacteria 827
174 Ga0105238_10280638 3300009551 Bacteria 1647
175 Ga0105249_10000531 3300009553 Bacteria 35092
176 Ga0105249_10000947 3300009553 Bacteria 25676
177 Ga0105249_10081645 3300009553 Bacteria 3006
178 Ga0105239_10083290 3300010375 Bacteria 3522
179 Ga0105239_10177322 3300010375 Bacteria 2384
180 Ga0105246_10069288 3300011119 Bacteria 2477
181 Ga0105246_10527088 3300011119 Bacteria 1008
182 Ga0157313_1004514 3300012503 Bacteria 960
183 Ga0157371_10209032 3300013102 Bacteria 1400
184 Ga0157371_10265957 3300013102 Bacteria 1237
185 Ga0157369_10351279 3300013105 Bacteria 1531
186 Ga0157378_10001200 3300013297 Bacteria 23517
187 Ga0157378_10044937 3300013297 Bacteria 3923
188 Ga0157372_10170592 3300013307 Bacteria 2517
189 Ga0157375_10197035 3300013308 Bacteria 2169
190 Ga0157375_10236450 3300013308 Bacteria 1986
191 Ga0163163_10043071 3300014325 Bacteria 4424
192 Ga0163163_10302542 3300014325 Bacteria 1652
193 Ga0157380_10273218 3300014326 Bacteria 1542
194 Ga0157377_10126328 3300014745 Bacteria 1556
195 Ga0157379_10028446 3300014968 Bacteria 4971
196 Ga0157379_10148159 3300014968 Bacteria 2117
197 Ga0157379_10633649 3300014968 Bacteria 1000
198 Ga0157376_10049983 3300014969 Bacteria 3466
199 Ga0182007_10064981 3300015262 Bacteria 1196
200 Ga0206354_11420260 3300020081 Bacteria 1216
201 Ga0213872_10002500 3300021361 Bacteria 10755
202 Ga0213872_10002866 3300021361 Bacteria 9852
203 Ga0213872_10013215 3300021361 Bacteria 3871
204 Ga0213875_10006860 3300021388 Bacteria 5940
205 Ga0213875_10014497 3300021388 Bacteria 3845
206 Ga0213875_10061052 3300021388 Bacteria 1762
207 Ga0213871_10004185 3300021441 Bacteria 2865
208 Ga0209675_1006660 3300025291 Bacteria 4590
209 Ga0209675_1022704 3300025291 Bacteria 1642
210 Ga0209676_1041093 3300025292 Bacteria 1295
211 Ga0209758_1003235 3300025297 Bacteria 15130
212 Ga0207656_10105186 3300025321 Bacteria 1298
213 Ga0207653_10000896 3300025885 Bacteria 9884
214 Ga0207682_10154621 3300025893 Bacteria 1036
215 Ga0207692_10270823 3300025898 Bacteria 1024
216 Ga0207642_10063444 3300025899 Bacteria 1728
217 Ga0207710_10104747 3300025900 Bacteria 1338
218 Ga0207688_10116369 3300025901 Bacteria 1556
219 Ga0207688_10143912 3300025901 Bacteria 1404
220 Ga0207688_10144957 3300025901 Bacteria 1399
221 Ga0207647_10044043 3300025904 Bacteria 2790
222 Ga0207685_10113212 3300025905 Bacteria 1179
223 Ga0207643_10006867 3300025908 Bacteria 6108
224 Ga0207643_10046307 3300025908 Bacteria 2458
225 Ga0207643_10209345 3300025908 Bacteria 1190
226 Ga0207684_10056156 3300025910 Bacteria 3340
227 Ga0207684_10074525 3300025910 Bacteria 2883
228 Ga0207654_10056868 3300025911 Bacteria 2271
229 Ga0207707_10038305 3300025912 Bacteria 4190
230 Ga0207707_10063848 3300025912 Bacteria 3205
231 Ga0207707_10216674 3300025912 Bacteria 1667
232 Ga0207707_10254274 3300025912 Bacteria 1526
233 Ga0207693_10300593 3300025915 Bacteria 1257
234 Ga0207660_10001201 3300025917 Bacteria 17353
235 Ga0207660_10023717 3300025917 Bacteria 4146
236 Ga0207660_10122471 3300025917 Bacteria 1971
237 Ga0207660_10173621 3300025917 Bacteria 1670
238 Ga0207662_10000199 3300025918 Bacteria 28091
239 Ga0207662_10033194 3300025918 Bacteria 3007
240 Ga0207657_10082130 3300025919 Bacteria 2705
241 Ga0207657_10174329 3300025919 Bacteria 1741
242 Ga0207652_10005454 3300025921 Bacteria 10323
243 Ga0207652_10075318 3300025921 Bacteria 2941
244 Ga0207652_10185099 3300025921 Bacteria 1873
245 Ga0207652_10252396 3300025921 Bacteria 1591
246 Ga0207646_10013277 3300025922 Bacteria 7881
247 Ga0207694_10176689 3300025924 Bacteria 1730
248 Ga0207659_10118518 3300025926 Bacteria 2025
249 Ga0207659_10145998 3300025926 Bacteria 1842
250 Ga0207659_10531616 3300025926 Bacteria 998
251 Ga0207687_10000705 3300025927 Bacteria 22665
252 Ga0207687_10007051 3300025927 Bacteria 7409
253 Ga0207687_10070962 3300025927 Bacteria 2488
254 Ga0207687_10172024 3300025927 Bacteria 1671
255 Ga0207687_10260204 3300025927 Bacteria 1383
256 Ga0207687_10345156 3300025927 Bacteria 1211
257 Ga0207700_10181658 3300025928 Bacteria 1762
258 Ga0207700_10261536 3300025928 Bacteria 1482
259 Ga0207664_10021202 3300025929 Bacteria 4827
260 Ga0207644_10036808 3300025931 Bacteria 3438
261 Ga0207644_10050978 3300025931 Bacteria 2968
262 Ga0207690_10051673 3300025932 Bacteria 2750
263 Ga0207706_10169272 3300025933 Bacteria 1920
264 Ga0207706_10268266 3300025933 Bacteria 1490
265 Ga0207686_10012182 3300025934 Bacteria 4723
266 Ga0207686_10207004 3300025934 Bacteria 1408
267 Ga0207686_10558629 3300025934 Bacteria 896
268 Ga0207670_10011808 3300025936 Bacteria 5082
269 Ga0207670_10047222 3300025936 Bacteria 2866
270 Ga0207670_10061565 3300025936 Bacteria 2561
271 Ga0207670_10336552 3300025936 Bacteria 1192
272 Ga0207704_10002754 3300025938 Bacteria 7931
273 Ga0207665_10073470 3300025939 Bacteria 2339
274 Ga0207691_10015650 3300025940 Bacteria 7209
275 Ga0207691_10064494 3300025940 Bacteria 3318
276 Ga0207711_10092581 3300025941 Bacteria 2661
277 Ga0207689_10000324 3300025942 Bacteria 44284
278 Ga0207689_10016573 3300025942 Bacteria 6234
279 Ga0207689_10074039 3300025942 Bacteria 2798
280 Ga0207689_10196515 3300025942 Bacteria 1665
281 Ga0207689_10525430 3300025942 Bacteria 993
282 Ga0207661_10045842 3300025944 Bacteria 3464
283 Ga0207667_10046210 3300025949 Bacteria 4610
284 Ga0207667_10873054 3300025949 Bacteria 893
285 Ga0207712_10001518 3300025961 Bacteria 15737
286 Ga0207712_10067430 3300025961 Bacteria 2561
287 Ga0207712_10136522 3300025961 Bacteria 1876
288 Ga0207668_10118072 3300025972 Bacteria 2003
289 Ga0207668_10728854 3300025972 Bacteria 873
290 Ga0207640_10030044 3300025981 Bacteria 3343
291 Ga0207640_10033133 3300025981 Bacteria 3211
292 Ga0207677_10011090 3300026023 Bacteria 5123
293 Ga0207703_10131743 3300026035 Bacteria 2160
294 Ga0207703_10150147 3300026035 Bacteria 2031
295 Ga0207703_10194201 3300026035 Bacteria 1800
296 Ga0207703_10250462 3300026035 Bacteria 1596
297 Ga0207678_10036163 3300026067 Bacteria 4299
298 Ga0207708_10001710 3300026075 Bacteria 16237
299 Ga0207708_10020974 3300026075 Bacteria 4930
300 Ga0207708_10039434 3300026075 Bacteria 3599
301 Ga0207641_10019975 3300026088 Bacteria 5498
302 Ga0207641_10042761 3300026088 Bacteria 3802
303 Ga0207641_10196272 3300026088 Bacteria 1858
304 Ga0207641_10312727 3300026088 Bacteria 1487
305 Ga0207641_10523540 3300026088 Bacteria 1154
306 Ga0207648_10000337 3300026089 Bacteria 51505
307 Ga0207648_10033835 3300026089 Bacteria 4506
308 Ga0207648_10259604 3300026089 Bacteria 1550
309 Ga0207676_10009434 3300026095 Bacteria 6946
310 Ga0207676_10245049 3300026095 Bacteria 1610
311 Ga0207676_10470388 3300026095 Bacteria 1188
312 Ga0207674_10005273 3300026116 Bacteria 15387
313 Ga0207674_10454087 3300026116 Bacteria 1239
314 Ga0207675_100001499 3300026118 Bacteria 23380
315 Ga0207675_100076633 3300026118 Bacteria 3131
316 Ga0207675_100310112 3300026118 Bacteria 1539
317 Ga0207675_100329893 3300026118 Bacteria 1491
318 Ga0207683_10473307 3300026121 Bacteria 1156
319 Ga0207698_10021485 3300026142 Bacteria 4465
320 Ga0207698_10059015 3300026142 Bacteria 2977
321 Ga0209588_1000007 3300027671 Bacteria 183924
322 Ga0209966_1010830 3300027695 Bacteria 1654
323 Ga0209998_10043204 3300027717 Bacteria 1028
324 Ga0268266_10009256 3300028379 Bacteria 8689
325 Ga0268266_10540314 3300028379 Bacteria 1116
326 Ga0268265_10001669 3300028380 Bacteria 18128
327 Ga0268265_10013925 3300028380 Bacteria 5475
328 Ga0268265_10021359 3300028380 Bacteria 4534
329 Ga0268265_10120961 3300028380 Bacteria 2157
330 Ga0268264_10001144 3300028381 Bacteria 25934
331 Ga0268264_10002104 3300028381 Bacteria 17759
332 Ga0268264_10006706 3300028381 Bacteria 9677
333 Ga0268264_10104053 3300028381 Bacteria 2474
334 Ga0268264_10263685 3300028381 Bacteria 1606
335 Ga0268264_10427305 3300028381 Bacteria 1279
336 Ga0307517_10042025 3300028786 Bacteria 4918
337 Ga0307517_10077836 3300028786 Bacteria 2876
338 Ga0307515_10001983 3300028794 Bacteria 45325
339 Ga0265332_10081832 3300031238 Bacteria 1369
340 Ga0307513_10068288 3300031456 Bacteria 3724
341 Ga0307513_10094576 3300031456 Bacteria 3033
342 Ga0307513_10279415 3300031456 Bacteria 1448
343 Ga0307509_10000047 3300031507 Bacteria 169362
344 Ga0307509_10469442 3300031507 Bacteria 948
345 Ga0307508_10008975 3300031616 Bacteria 9213
346 Ga0307508_10433722 3300031616 Bacteria 906
347 Ga0307516_10092188 3300031730 Bacteria 2857
348 Ga0307405_10083873 3300031731 Bacteria 2090
349 Ga0307406_10660788 3300031901 Bacteria 868
350 Ga0307416_100053237 3300032002 Bacteria 3246
351 Ga0307411_10286915 3300032005 Bacteria 1313
352 Ga0307510_10206804 3300033180 Bacteria 1490
353 Ga0373938_0056531 3300034957 Bacteria 908
354 Ga0373926_0000432 3300035083 Bacteria 10833
355 Ga0373926_0066403 3300035083 Bacteria 1321
356 Ga0373934_0049648 3300035086 Bacteria 1662
357 Ga0373949_0000001 3300035090 Bacteria 103947
358 Ga0373949_0043246 3300035090 Bacteria 1114
359 Ga0373923_0042077 3300035111 Bacteria 1886
360 Ga0373936_0000012 3300035113 Bacteria 228915
361 Ga0373936_0019589 3300035113 Bacteria 2622
362 Ga0373941_0028113 3300035115 Bacteria 1648
363 Ga0373945_0000481 3300035116 Bacteria 11314
364 Ga0373954_0033473 3300035118 Bacteria 2378
365 Ga0373956_0039483 3300035119 Bacteria 2092
366 Ga0373957_0043091 3300035120 Bacteria 1704
367 Ga0373943_0049075 3300035170 Bacteria 2070
368 Ga0373961_0000007 3300035241 Bacteria 145618
369 Ga0373931_0045730 3300035691 Bacteria 2312
370 Ga0373931_0117874 3300035691 Bacteria 1514
371 Ga0373935_0017687 3300035692 Bacteria 4328
372 Ga0373927_0019448 3300035695 Bacteria 4453
373 Ga0373933_0040472 3300035724 Bacteria 2746
374 Ga0373947_0043312 3300035725 Bacteria 2689
375 Ga0373947_0101000 3300035725 Bacteria 1813
376 Ga0373937_0028789 3300036401 Bacteria 5029
377 Ga0373925_0148815 3300037068 Bacteria 1837
378 Ga0373925_0768804 3300037068 Bacteria 794
379 Ga0436364_0076289 3300037853 Bacteria 13954
380 Ga0436364_0540949 3300037853 Bacteria 18156
381 Ga0436364_0619217 3300037853 Bacteria 6463
382 Ga0436364_0993549 3300037853 Bacteria 1801
383 Ga0436364_1113069 3300037853 Bacteria 6137
384 Ga0436364_1130921 3300037853 Bacteria 1768
385 Ga0436364_1486315 3300037853 Bacteria 1004
386 Ga0436365_0010504 3300039437 Bacteria 2296
387 Ga0436365_0648597 3300039437 Bacteria 2598
388 Ga0436365_1660744 3300039437 Bacteria 4379
389 Ga0436360_0853767 3300039438 Bacteria 916
390 Ga0436360_0976283 3300039438 Bacteria 8072
391 Ga0436360_1240398 3300039438 Bacteria 764
392 Ga0436361_0199597 3300039447 Bacteria 4258
393 Ga0436361_0204159 3300039447 Bacteria 6721
394 Ga0436361_0279229 3300039447 Bacteria 20047
395 Ga0436361_0604248 3300039447 Bacteria 974
396 Ga0436361_1207796 3300039447 Bacteria 10633
397 Ga0436363_0511471 3300039450 Bacteria 1809
398 Ga0436363_1056295 3300039450 Bacteria 4502
399 Ga0436362_0606825 3300039453 Bacteria 1372
400 Ga0436362_0632567 3300039453 Bacteria 1627
401 Ga0436362_0916357 3300039453 Bacteria 2961
402 Ga0436362_1242794 3300039453 Bacteria 1045
403 Ga0439465_0118057 3300041413 Bacteria 928
404 Ga0451807_0881976 3300041486 Bacteria 3186
405 Ga0450897_003084 3300042128 Bacteria 1309
406 Ga0439459_0033674 3300042438 Bacteria 1056
407 Ga0451577_0127560 3300042876 Bacteria 2280
408 Ga0466965_0004644 3300044683 Bacteria 6121
409 Ga0466966_0015743 3300044684 Bacteria 5001
410 Ga0453684_0097213 3300044712 Bacteria 3614
411 Ga0466970_0038987 3300044765 Bacteria 2521
412 Ga0466957_0062658 3300044842 Bacteria 2284
413 Ga0466957_0075892 3300044842 Bacteria 2086
414 Ga0466960_0004330 3300044901 Bacteria 5537
415 Ga0451576_0003830 3300045051 Bacteria 20213
416 Ga0451576_0052101 3300045051 Bacteria 4289
417 Ga0451576_0361845 3300045051 Bacteria 1519
418 Ga0466967_0562412 3300045976 Bacteria 1123
419 Ga0495603_0002192 3300046455 Bacteria 11494
420 Ga0495638_0145580 3300046460 Bacteria 1379
421 Ga0495580_0003594 3300046472 Bacteria 13147
422 Ga0495582_0052713 3300046473 Bacteria 2243
423 Ga0495639_0009906 3300046475 Bacteria 4092
424 Ga0495586_0011777 3300046535 Bacteria 4649
425 Ga0495656_0117961 3300046615 Bacteria 1249
426 Ga0495625_0133276 3300046660 Bacteria 1682
427 Ga0495623_0115420 3300046679 Bacteria 1623
428 Ga0495647_0000071 3300046681 Bacteria 24459
429 Ga0495658_0138556 3300046683 Bacteria 1486
430 Ga0495624_0269015 3300046690 Bacteria 1030
431 Ga0495649_0069761 3300046694 Bacteria 1885
432 Ga0495649_0209301 3300046694 Bacteria 1011
433 Ga0495581_0030992 3300047315 Bacteria 3098
434 Ga0495676_0078065 3300047321 Bacteria 2522
435 Ga0496100_0034572 3300048903 Bacteria 3173
436 Ga0496101_0119375 3300048904 Bacteria 1992
437 Ga0496102_0000018 3300048905 Bacteria 266847
438 Ga0496102_0000914 3300048905 Bacteria 27837
439 Ga0496103_0000188 3300048906 Bacteria 62595
440 Ga0496103_0016595 3300048906 Bacteria 4395
441 Ga0496104_0047610 3300048907 Bacteria 4041
442 Ga0496104_0105612 3300048907 Bacteria 2699
443 Ga0496104_0113164 3300048907 Bacteria 2603
444 Ga0496105_0015441 3300048908 Bacteria 6086
445 Ga0496105_0184943 3300048908 Bacteria 1705
446 Ga0496106_0000335 3300048909 Bacteria 33078
447 Ga0496106_0222620 3300048909 Bacteria 1505
448 Ga0496107_0004860 3300048910 Bacteria 9126
449 Ga0496108_0081827 3300048911 Bacteria 2737
450 Ga0496108_0148401 3300048911 Bacteria 2023
451 Ga0496108_0192347 3300048911 Bacteria 1768
452 Ga0496108_0226437 3300048911 Bacteria 1625
453 Ga0496108_0331917 3300048911 Bacteria 1326
454 Ga0496110_0024332 3300048913 Bacteria 5161
455 Ga0496110_0146779 3300048913 Bacteria 2134
456 Ga0496112_0163926 3300048915 Bacteria 2189
457 Ga0496113_0032370 3300048916 Bacteria 3801
458 Ga0496115_0037212 3300048918 Bacteria 3856
459 Ga0496116_0000694 3300048919 Bacteria 43641
460 Ga0496117_0000528 3300048920 Bacteria 62814
461 Ga0496118_0000136 3300048921 Bacteria 130016
462 Ga0496119_0001397 3300048922 Bacteria 29263
463 Ga0496120_0005051 3300048923 Bacteria 10697
464 Ga0496121_0012806 3300048924 Bacteria 9080
465 Ga0496124_0030174 3300048927 Bacteria 4816
466 Ga0496126_0000585 3300048929 Bacteria 68897
467 Ga0501034_0125510 3300049571 Bacteria 2552
468 Ga0501036_0116689 3300049572 Bacteria 2255
469 Ga0501041_0125724 3300049577 Bacteria 1596
470 Ga0501042_0348618 3300049578 Bacteria 1071
471 Ga0501043_0189336 3300049579 Bacteria 1601
472 Ga0501046_0153352 3300049580 Bacteria 1737
473 Ga0501047_0284005 3300049581 Bacteria 1499
474 Ga0501048_0229202 3300049582 Bacteria 1318
475 Ga0501068_0317378 3300049584 Bacteria 999
476 Ga0501070_0237502 3300049586 Bacteria 1492
477 Ga0501072_0021009 3300049588 Bacteria 5062
478 Ga0501074_0188710 3300049590 Bacteria 1470
479 Ga0501074_0479685 3300049590 Bacteria 881
480 Ga0501075_0467432 3300049591 Bacteria 962
481 Ga0501077_0012769 3300049593 Bacteria 5263
482 Ga0501077_0167024 3300049593 Bacteria 1398
483 Ga0501079_0096764 3300049741 Bacteria 2288
484 Ga0501079_0157697 3300049741 Bacteria 1769
485 Ga0501079_0314726 3300049741 Bacteria 1225
486 Ga0501080_0016940 3300049742 Bacteria 6729
487 Ga0501081_0107828 3300049743 Bacteria 1975
488 Ga0501081_0160322 3300049743 Bacteria 1621
489 Ga0501083_0014306 3300049744 Bacteria 5549
490 Ga0501045_0160900 3300049824 Bacteria 1671
491 nmdc:mga03683_73646_c1 3300050489 Bacteria 1464
492 nmdc:mga0yw44_137235_c1 3300050492 Bacteria 1587
493 nmdc:mga06z11_51324_c1 3300050494 Bacteria 2112
494 nmdc:mga05p37_14166_c1 3300050507 Bacteria 9571
495 nmdc:mga05p37_19161_c1 3300050507 Bacteria 8276
496 nmdc:mga05p37_6370_c1 3300050507 Bacteria 13904
497 nmdc:mga05p37_691730_c1 3300050507 Bacteria 1134
498 nmdc:mga09592_1525_c1 3300050508 Bacteria 18665
499 nmdc:mga09592_167119_c1 3300050508 Bacteria 1902
500 nmdc:mga0qj67_1874_c1 3300050509 Bacteria 14910
501 nmdc:mga0qj67_676_c1 3300050509 Bacteria 23252
502 nmdc:mga06r32_1475_c1 3300050510 Bacteria 21176
503 nmdc:mga06r32_1637_c1 3300050510 Bacteria 20211
504 nmdc:mga08y16_1196_c1 3300050511 Bacteria 25597
505 nmdc:mga08y16_197834_c1 3300050511 Bacteria 2083
506 nmdc:mga0n895_414766_c1 3300050512 Bacteria 1361
507 nmdc:mga0rr50_112120_c1 3300050513 Bacteria 2160
508 nmdc:mga0rr50_355525_c1 3300050513 Bacteria 1232
509 nmdc:mga08x19_550_c1 3300050514 Bacteria 24591
510 nmdc:mga0a205_277833_c1 3300050515 Bacteria 1551
511 nmdc:mga0a205_279082_c1 3300050515 Bacteria 1546
512 nmdc:mga0a205_584_c1 3300050515 Bacteria 28859
513 Ga0500635_0002738 3300053080 Bacteria 4376
514 Ga0500578_0062152 3300053086 Bacteria 2384
515 Ga0500646_0016411 3300053090 Bacteria 1933
516 Ga0500646_0040493 3300053090 Bacteria 1310
517 Ga0500566_0006693 3300053094 Bacteria 6824
518 Ga0500566_0010662 3300053094 Bacteria 5415
519 Ga0500566_0062339 3300053094 Bacteria 2108
520 Ga0500640_005977 3300053095 Bacteria 4601
521 Ga0500554_000553 3300053102 Bacteria 7693
522 Ga0500572_002595 3300053111 Bacteria 4294
523 Ga0500595_000284 3300053119 Bacteria 33560
524 Ga0500614_000059 3300053123 Bacteria 23470
525 Ga0500614_048501 3300053123 Bacteria 1107
526 Ga0500559_0044343 3300053136 Bacteria 1945
527 Ga0500579_074200 3300053143 Bacteria 1944
528 Ga0500622_0098343 3300053156 Bacteria 1444
529 Ga0500639_097531 3300053163 Bacteria 1453
530 Ga0501084_0009402 3300054114 Bacteria 8088
531 Ga0501084_0047449 3300054114 Bacteria 3597
532 Ga0590071_004689 3300059421 Bacteria 3302
533 Ga0590075_014128 3300059424 Bacteria 1952
534 Ga0501082_0001815 3300060353 Bacteria 18801
535 Ga0501082_0043257 3300060353 Bacteria 3883
536 Ga0501082_0083079 3300060353 Bacteria 2763
537 Ga0530510_0083287 3300061734 Bacteria 2329
538 Ga0530510_0150688 3300061734 Bacteria 1717
539 Ga0530510_0159529 3300061734 Bacteria 1668
540 Ga0530510_0468313 3300061734 Bacteria 954
541 2513590331 2513237087 Bacteria 5817514
542 2599101171 2597490356 Bacteria 7030811
543 2643756966 2643221547 Bacteria 4740017
544 2816503893 2816332139 Bacteria 9138787
545 2842779370 2842775625 Bacteria 5587290
546 2846954109 2846952575 Bacteria 6587527
547 2871457976 2871451962 Bacteria 7336357
548 2904461587 2904456579 Bacteria 6819253
549 2915359952 2915358134 Bacteria 6050864
550 8054478075 8054472261 Bacteria 7464355
551 Ga0105242_10079765
552 JGI24735J21928_10023092
553 JGI24745J21846_1000774
554 Ga0055534_1025847
555 Ga0070658_10190724
556 Ga0070683_100135141
557 Ga0070683_100576242
558 Ga0070690_100000344
559 Ga0070690_100187130
560 Ga0070690_100198016
561 Ga0070690_100242287
562 Ga0070690_100279322
563 Ga0068869_100002144
564 Ga0068869_100040774
565 Ga0068869_100635464
566 Ga0070680_100004921
567 Ga0070680_100455549
568 Ga0070682_100041484
569 Ga0070682_100108094
570 Ga0068868_100000535
571 Ga0068868_100740010
572 Ga0070660_100362073
573 Ga0070660_100433613
574 Ga0070689_100000134
575 Ga0070689_100014831
576 Ga0070689_100106609
577 Ga0070691_10008735
578 Ga0070687_100000131
579 Ga0070687_100032163
580 Ga0070687_100172372
581 Ga0070661_100104383
582 Ga0070668_100054606
583 Ga0070675_100048760
584 Ga0070675_100756245
585 Ga0070671_100503945
586 Ga0070674_100232463
587 Ga0070673_100774378
588 Ga0070688_100198090
589 Ga0070659_100141933
590 Ga0070703_10012807
591 Ga0070714_100161492
592 Ga0070713_100357084
593 Ga0070701_10000024
594 Ga0070701_10035946
595 Ga0070705_100000130
596 Ga0070705_100002576
597 Ga0070705_100177661
598 Ga0070700_100000530
599 Ga0070700_100010817
600 Ga0070694_100000172
601 Ga0070694_100000351
602 Ga0070708_100015757
603 Ga0070663_100020850
604 Ga0070662_100088654
605 Ga0070662_100424299
606 Ga0070681_10016370
607 Ga0070681_10183487
608 Ga0070681_10187543
609 Ga0070681_10431450
610 Ga0068867_100000272
611 Ga0068867_100416782
612 Ga0070685_10029203
613 Ga0070706_100093686
614 Ga0070706_100391596
615 Ga0070707_100004554
616 Ga0070698_100174266
617 Ga0070698_100307308
618 Ga0070699_100001046
619 Ga0070699_100195558
620 Ga0070699_100401200
621 Ga0070679_100059743
622 Ga0070679_100060461
623 Ga0070697_100077909
624 Ga0070697_100085540
625 Ga0070697_100429482
626 Ga0070672_100191344
627 Ga0070672_100540491
628 Ga0070672_100717784
629 Ga0070686_100000135
630 Ga0070686_100084469
631 Ga0070695_100000056
632 Ga0070695_100000331
633 Ga0070696_100000119
634 Ga0070696_100190986
635 Ga0070696_100235184
636 Ga0070693_100000064
637 Ga0070693_100133801
638 Ga0070693_100174846
639 Ga0070665_100040280
640 Ga0070665_100152356
641 Ga0070704_100000186
642 Ga0070704_100214031
643 Ga0068855_100006837
644 Ga0070664_100281278
645 Ga0068857_100009295
646 Ga0068854_100097145
647 Ga0068856_100028106
648 Ga0068856_100045780
649 Ga0070702_100000292
650 Ga0070702_100019767
651 Ga0070702_100067664
652 Ga0068852_100053136
653 Ga0068852_100373909
654 Ga0068859_100000988
655 Ga0068859_100001278
656 Ga0068859_100140702
657 Ga0068864_100014140
658 Ga0068866_10000450
659 Ga0068861_100000105
660 Ga0068861_100094404
661 Ga0068861_100247426
662 Ga0068851_10042449
663 Ga0068851_10092356
664 Ga0068870_10228822
665 Ga0068863_100011184
666 Ga0068863_100191197
667 Ga0068863_100255414
668 Ga0068858_100001246
669 Ga0068858_100255105
670 Ga0068858_100856731
671 Ga0068860_100002222
672 Ga0068860_100005235
673 Ga0068860_100008797
674 Ga0068860_100353273
675 Ga0068860_100368191
676 Ga0068860_100577925
677 Ga0068862_100001163
678 Ga0068862_100125431
679 Ga0068862_100730440
680 Ga0081455_10063680
681 Ga0070717_10074922
682 Ga0075365_10247221
683 Ga0075368_10064133
684 Ga0070715_10175006
685 Ga0075362_10079749
686 Ga0075367_10083965
687 Ga0075366_10038821
688 Ga0097621_100007973
689 Ga0097621_100420920
690 Ga0068871_100000842
691 Ga0068871_100008260
692 Ga0068871_100154834
693 Ga0075428_100000643
694 Ga0075428_100106125
695 Ga0075430_100000052
696 Ga0075431_100000441
697 Ga0075433_10000276
698 Ga0075434_100000597
699 Ga0075434_100282901
700 Ga0075429_100034042
701 Ga0075429_100107506
702 Ga0068865_100000342
703 Ga0075436_100007341
704 Ga0097620_100000988
705 Ga0097620_100001278
706 Ga0097620_100140697
707 Ga0075435_100000328
708 Ga0075435_100813792
709 Ga0099794_10000110
710 Ga0111539_11070914
711 Ga0105245_10000247
712 Ga0105245_10060139
713 Ga0105245_10212486
714 Ga0105245_10480158
715 Ga0105247_10169829
716 Ga0114129_10002725
717 Ga0114129_10028184
718 Ga0114129_10043464
719 Ga0105243_10001067
720 Ga0105243_10105801
721 Ga0105242_10000982
722 Ga0105248_10070781
723 Ga0105248_11286082
724 Ga0105238_10280638
725 Ga0105249_10000531
726 Ga0105249_10000947
727 Ga0105249_10081645
728 Ga0105239_10083290
729 Ga0105239_10177322
730 Ga0105246_10069288
731 Ga0105246_10527088
732 Ga0157313_1004514
733 Ga0157371_10209032
734 Ga0157371_10265957
735 Ga0157369_10351279
736 Ga0157378_10001200
737 Ga0157378_10044937
738 Ga0157372_10170592
739 Ga0157375_10197035
740 Ga0157375_10236450
741 Ga0163163_10043071
742 Ga0163163_10302542
743 Ga0157380_10273218
744 Ga0157377_10126328
745 Ga0157379_10028446
746 Ga0157379_10148159
747 Ga0157379_10633649
748 Ga0157376_10049983
749 Ga0182007_10064981
750 Ga0206354_11420260
751 Ga0213872_10002500
752 Ga0213872_10002866
753 Ga0213872_10013215
754 Ga0213875_10006860
755 Ga0213875_10014497
756 Ga0213875_10061052
757 Ga0213871_10004185
758 Ga0209675_1006660
759 Ga0209675_1022704
760 Ga0209676_1041093
761 Ga0209758_1003235
762 Ga0207656_10105186
763 Ga0207653_10000896
764 Ga0207682_10154621
765 Ga0207692_10270823
766 Ga0207642_10063444
767 Ga0207710_10104747
768 Ga0207688_10116369
769 Ga0207688_10143912
770 Ga0207688_10144957
771 Ga0207647_10044043
772 Ga0207685_10113212
773 Ga0207643_10006867
774 Ga0207643_10046307
775 Ga0207643_10209345
776 Ga0207684_10056156
777 Ga0207684_10074525
778 Ga0207654_10056868
779 Ga0207707_10038305
780 Ga0207707_10063848
781 Ga0207707_10216674
782 Ga0207707_10254274
783 Ga0207693_10300593
784 Ga0207660_10001201
785 Ga0207660_10023717
786 Ga0207660_10122471
787 Ga0207660_10173621
788 Ga0207662_10000199
789 Ga0207662_10033194
790 Ga0207657_10082130
791 Ga0207657_10174329
792 Ga0207652_10005454
793 Ga0207652_10075318
794 Ga0207652_10185099
795 Ga0207652_10252396
796 Ga0207646_10013277
797 Ga0207694_10176689
798 Ga0207659_10118518
799 Ga0207659_10145998
800 Ga0207659_10531616
801 Ga0207687_10000705
802 Ga0207687_10007051
803 Ga0207687_10070962
804 Ga0207687_10172024
805 Ga0207687_10260204
806 Ga0207687_10345156
807 Ga0207700_10181658
808 Ga0207700_10261536
809 Ga0207664_10021202
810 Ga0207644_10036808
811 Ga0207644_10050978
812 Ga0207690_10051673
813 Ga0207706_10169272
814 Ga0207706_10268266
815 Ga0207686_10012182
816 Ga0207686_10207004
817 Ga0207686_10558629
818 Ga0207670_10011808
819 Ga0207670_10047222
820 Ga0207670_10061565
821 Ga0207670_10336552
822 Ga0207704_10002754
823 Ga0207665_10073470
824 Ga0207691_10015650
825 Ga0207691_10064494
826 Ga0207711_10092581
827 Ga0207689_10000324
828 Ga0207689_10016573
829 Ga0207689_10074039
830 Ga0207689_10196515
831 Ga0207689_10525430
832 Ga0207661_10045842
833 Ga0207667_10046210
834 Ga0207667_10873054
835 Ga0207712_10001518
836 Ga0207712_10067430
837 Ga0207712_10136522
838 Ga0207668_10118072
839 Ga0207668_10728854
840 Ga0207640_10030044
841 Ga0207640_10033133
842 Ga0207677_10011090
843 Ga0207703_10131743
844 Ga0207703_10150147
845 Ga0207703_10194201
846 Ga0207703_10250462
847 Ga0207678_10036163
848 Ga0207708_10001710
849 Ga0207708_10020974
850 Ga0207708_10039434
851 Ga0207641_10019975
852 Ga0207641_10042761
853 Ga0207641_10196272
854 Ga0207641_10312727
855 Ga0207641_10523540
856 Ga0207648_10000337
857 Ga0207648_10033835
858 Ga0207648_10259604
859 Ga0207676_10009434
860 Ga0207676_10245049
861 Ga0207676_10470388
862 Ga0207674_10005273
863 Ga0207674_10454087
864 Ga0207675_100001499
865 Ga0207675_100076633
866 Ga0207675_100310112
867 Ga0207675_100329893
868 Ga0207683_10473307
869 Ga0207698_10021485
870 Ga0207698_10059015
871 Ga0209588_1000007
872 Ga0209966_1010830
873 Ga0209998_10043204
874 Ga0268266_10009256
875 Ga0268266_10540314
876 Ga0268265_10001669
877 Ga0268265_10013925
878 Ga0268265_10021359
879 Ga0268265_10120961
880 Ga0268264_10001144
881 Ga0268264_10002104
882 Ga0268264_10006706
883 Ga0268264_10104053
884 Ga0268264_10263685
885 Ga0268264_10427305
886 Ga0307517_10042025
887 Ga0307517_10077836
888 Ga0307515_10001983
889 Ga0265332_10081832
890 Ga0307513_10068288
891 Ga0307513_10094576
892 Ga0307513_10279415
893 Ga0307509_10000047
894 Ga0307509_10469442
895 Ga0307508_10008975
896 Ga0307508_10433722
897 Ga0307516_10092188
898 Ga0307405_10083873
899 Ga0307406_10660788
900 Ga0307416_100053237
901 Ga0307411_10286915
902 Ga0307510_10206804
903 Ga0373938_0056531
904 Ga0373926_0000432
905 Ga0373926_0066403
906 Ga0373934_0049648
907 Ga0373949_0000001
908 Ga0373949_0043246
909 Ga0373923_0042077
910 Ga0373936_0000012
911 Ga0373936_0019589
912 Ga0373941_0028113
913 Ga0373945_0000481
914 Ga0373954_0033473
915 Ga0373956_0039483
916 Ga0373957_0043091
917 Ga0373943_0049075
918 Ga0373961_0000007
919 Ga0373931_0045730
920 Ga0373931_0117874
921 Ga0373935_0017687
922 Ga0373927_0019448
923 Ga0373933_0040472
924 Ga0373947_0043312
925 Ga0373947_0101000
926 Ga0373937_0028789
927 Ga0373925_0148815
928 Ga0373925_0768804
929 Ga0436364_0076289
930 Ga0436364_0540949
931 Ga0436364_0619217
932 Ga0436364_0993549
933 Ga0436364_1113069
934 Ga0436364_1130921
935 Ga0436364_1486315
936 Ga0436365_0010504
937 Ga0436365_0648597
938 Ga0436365_1660744
939 Ga0436360_0853767
940 Ga0436360_0976283
941 Ga0436360_1240398
942 Ga0436361_0199597
943 Ga0436361_0204159
944 Ga0436361_0279229
945 Ga0436361_0604248
946 Ga0436361_1207796
947 Ga0436363_0511471
948 Ga0436363_1056295
949 Ga0436362_0606825
950 Ga0436362_0632567
951 Ga0436362_0916357
952 Ga0436362_1242794
953 Ga0439465_0118057
954 Ga0451807_0881976
955 Ga0450897_003084
956 Ga0439459_0033674
957 Ga0451577_0127560
958 Ga0466965_0004644
959 Ga0466966_0015743
960 Ga0453684_0097213
961 Ga0466970_0038987
962 Ga0466957_0062658
963 Ga0466957_0075892
964 Ga0466960_0004330
965 Ga0451576_0003830
966 Ga0451576_0052101
967 Ga0451576_0361845
968 Ga0466967_0562412
969 Ga0495603_0002192
970 Ga0495638_0145580
971 Ga0495580_0003594
972 Ga0495582_0052713
973 Ga0495639_0009906
974 Ga0495586_0011777
975 Ga0495656_0117961
976 Ga0495625_0133276
977 Ga0495623_0115420
978 Ga0495647_0000071
979 Ga0495658_0138556
980 Ga0495624_0269015
981 Ga0495649_0069761
982 Ga0495649_0209301
983 Ga0495581_0030992
984 Ga0495676_0078065
985 Ga0496100_0034572
986 Ga0496101_0119375
987 Ga0496102_0000018
988 Ga0496102_0000914
989 Ga0496103_0000188
990 Ga0496103_0016595
991 Ga0496104_0047610
992 Ga0496104_0105612
993 Ga0496104_0113164
994 Ga0496105_0015441
995 Ga0496105_0184943
996 Ga0496106_0000335
997 Ga0496106_0222620
998 Ga0496107_0004860
999 Ga0496108_0081827
1000 Ga0496108_0148401
1001 Ga0496108_0192347
1002 Ga0496108_0226437
1003 Ga0496108_0331917
1004 Ga0496110_0024332
1005 Ga0496110_0146779
1006 Ga0496112_0163926
1007 Ga0496113_0032370
1008 Ga0496115_0037212
1009 Ga0496116_0000694
1010 Ga0496117_0000528
1011 Ga0496118_0000136
1012 Ga0496119_0001397
1013 Ga0496120_0005051
1014 Ga0496121_0012806
1015 Ga0496124_0030174
1016 Ga0496126_0000585
1017 Ga0501034_0125510
1018 Ga0501036_0116689
1019 Ga0501041_0125724
1020 Ga0501042_0348618
1021 Ga0501043_0189336
1022 Ga0501046_0153352
1023 Ga0501047_0284005
1024 Ga0501048_0229202
1025 Ga0501068_0317378
1026 Ga0501070_0237502
1027 Ga0501072_0021009
1028 Ga0501074_0188710
1029 Ga0501074_0479685
1030 Ga0501075_0467432
1031 Ga0501077_0012769
1032 Ga0501077_0167024
1033 Ga0501079_0096764
1034 Ga0501079_0157697
1035 Ga0501079_0314726
1036 Ga0501080_0016940
1037 Ga0501081_0107828
1038 Ga0501081_0160322
1039 Ga0501083_0014306
1040 Ga0501045_0160900
1041 nmdc:mga03683_73646_c1
1042 nmdc:mga0yw44_137235_c1
1043 nmdc:mga06z11_51324_c1
1044 nmdc:mga05p37_14166_c1
1045 nmdc:mga05p37_19161_c1
1046 nmdc:mga05p37_6370_c1
1047 nmdc:mga05p37_691730_c1
1048 nmdc:mga09592_1525_c1
1049 nmdc:mga09592_167119_c1
1050 nmdc:mga0qj67_1874_c1
1051 nmdc:mga0qj67_676_c1
1052 nmdc:mga06r32_1475_c1
1053 nmdc:mga06r32_1637_c1
1054 nmdc:mga08y16_1196_c1
1055 nmdc:mga08y16_197834_c1
1056 nmdc:mga0n895_414766_c1
1057 nmdc:mga0rr50_112120_c1
1058 nmdc:mga0rr50_355525_c1
1059 nmdc:mga08x19_550_c1
1060 nmdc:mga0a205_277833_c1
1061 nmdc:mga0a205_279082_c1
1062 nmdc:mga0a205_584_c1
1063 Ga0500635_0002738
1064 Ga0500578_0062152
1065 Ga0500646_0016411
1066 Ga0500646_0040493
1067 Ga0500566_0006693
1068 Ga0500566_0010662
1069 Ga0500566_0062339
1070 Ga0500640_005977
1071 Ga0500554_000553
1072 Ga0500572_002595
1073 Ga0500595_000284
1074 Ga0500614_000059
1075 Ga0500614_048501
1076 Ga0500559_0044343
1077 Ga0500579_074200
1078 Ga0500622_0098343
1079 Ga0500639_097531
1080 Ga0501084_0009402
1081 Ga0501084_0047449
1082 Ga0590071_004689
1083 Ga0590075_014128
1084 Ga0501082_0001815
1085 Ga0501082_0043257
1086 Ga0501082_0083079
1087 Ga0530510_0083287
1088 Ga0530510_0150688
1089 Ga0530510_0159529
1090 Ga0530510_0468313
1091 2513590331
1092 2599101171
1093 2643756966
1094 2816503893
1095 2842779370
1096 2846954109
1097 2871457976
1098 2904461587
1099 2915359952
1100 8054478075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

23

166

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9014 6 232
1gaj-assembly1.cif.gz_A crystal structure of a nucleotide-free atp-binding cassette from an abc transporter 0.9003 3 226
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9 6 232
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8985 6 229
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8953 6 238
ID Description Score Start End Superfamily
af_P77257_8_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9585 4 240 3.40.50.300
af_Q6BEX0_1_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9487 2 241 3.40.50.300
af_P77257_8_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9464 4 240 3.40.50.300
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9451 3 241 3.40.50.300
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9413 3 241 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2T0UCU5-F1-model_v4 Monosaccharide ABC transporter ATP-binding protein (CUT2 family) 0.9653 6 242 GO:0005524
GO:0016887
AF-A0A6J6IZJ1-F1-model_v4 Unannotated protein 0.9641 1 246 GO:0005524
GO:0016887
AF-A0A154IK00-F1-model_v4 ABC transporter ATP-binding protein 0.9576 1 242 GO:0005524
GO:0016887
AF-A0A2U2S9Q4-F1-model_v4 ABC transporter ATP-binding protein 0.9544 1 243 GO:0005524
GO:0016887
AF-A0A6J6IZJ1-F1-model_v4 Unannotated protein 0.9489 1 246 GO:0005524
GO:0016887

Map