F462419

General Info

Members Datasets Scaffolds Average Seq Length
549 323 494 370

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0007923|Ga0496115_0007923_4422_5627
Length 401
Sequence LVNLVILVVQGDIAAARHSGFTFRDQALGSRMAEFDFDAVVVGAGAVGLACGYALARRGLSVAVLEREAAIGQGVSSRNSEVIHGGLYYPTGSLKARLCVAGRRALYAFLEAHHVDFDRCGKIVVATTTDEVGRLDAILEQAVTNGVEGMARLTKAEALALEPELKCEGALISPQSGVFDSHGYMLALQGEIEAAGGAVVLSTPFEGAAALAGGGFKVRAGGEEPAELTCRYLVTAPGLSAQDVAAQIEGFPKAKIPKGHYGKGMYFRLAGKAPFSHLIYPPPIHGALGTHYRRDLGGQAVFGPDLTYVDTLDYSVDPAAEPAFAKYIRKFWPGLPDGALTPDYAGIRPKLHGPDEPQPDFQLDGAEAHGLPGLMALFGIESPGLTSSLAIGEEVAGRLGL

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
7 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
8 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
9 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
10 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
11 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
12 2643221583 Caulobacter sp. Root655 Isolate Unclassified
13 2643221584 Caulobacter sp. Root656 Isolate Unclassified
14 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
15 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
16 2643221640 Caulobacter sp. Root342 Isolate Unclassified
17 2643221642 Caulobacter sp. Root343 Isolate Unclassified
18 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
19 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
20 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
21 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
22 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
23 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
24 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
25 2818991435 Caulobacter henricii 536 Isolate Unclassified
26 2818991452 Burkholderia cepacia 561 Isolate Unclassified
27 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
28 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
29 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
30 2849560528 Caulobacter zeae 410 Isolate Unclassified
31 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
32 2851153111 Caulobacter radicis 736 Isolate Unclassified
33 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
34 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
35 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
36 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
37 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
38 2904564687 Burkholderia sp. 571 Isolate Unclassified
39 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
40 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
41 2928163908 Burkholderia sp. 567 Isolate Unclassified
42 2928170801 Burkholderia sp. 572 Isolate Unclassified
43 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
44 2928536128 Burkholderia sola 565 Isolate Unclassified
45 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
46 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
47 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
48 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
49 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
52 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
53 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
54 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
55 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
56 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
57 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
63 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
64 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
67 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
68 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
71 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
72 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
170 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
207 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
208 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
209 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
210 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
213 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
241 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
242 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
243 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
283 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
286 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
290 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
291 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
292 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
293 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
294 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
295 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
296 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
297 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
298 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
299 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
300 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
301 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
302 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
303 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
304 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
305 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
306 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
313 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
314 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
315 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
316 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
317 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
320 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
321 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
322 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
323 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.8
Metatranscriptomes 0.18
Isolates 10.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.23
Nodule 0.36
Rhizoplane 3.46
Rhizosphere 61.2
Stem 0
Stem Tuber 0
Unclassified 10.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10033807 3300003215 Bacteria 1681
2 JGI25153J46596_10044260 3300003215 Bacteria 1340
3 Ga0006562J51391_1104830 3300003578 Bacteria 2080
4 Ga0055527_1000775 3300003760 Bacteria 8760
5 Ga0055535_1001908 3300003761 Bacteria 8760
6 Ga0055535_1001916 3300003761 Bacteria 8729
7 Ga0055542_1001819 3300003762 Bacteria 8770
8 Ga0055529_1000512 3300003763 Bacteria 34502
9 Ga0055526_1034794 3300003771 Bacteria 1369
10 Ga0055524_1000182 3300003775 Bacteria 70730
11 Ga0055524_1009043 3300003775 Bacteria 4087
12 Ga0055536_1005132 3300003781 Bacteria 6476
13 Ga0055536_1005154 3300003781 Bacteria 6461
14 Ga0055536_1005459 3300003781 Bacteria 6210
15 Ga0055536_1005502 3300003781 Bacteria 6174
16 Ga0055528_1000872 3300003790 Bacteria 20422
17 Ga0055528_1004995 3300003790 Bacteria 6265
18 Ga0055530_10000026 3300003791 Bacteria 129960
19 Ga0055530_10005315 3300003791 Bacteria 6174
20 Ga0055530_10006802 3300003791 Bacteria 4973
21 Ga0055531_10001173 3300003794 Bacteria 20160
22 Ga0055531_10001225 3300003794 Bacteria 19553
23 Ga0055531_10001520 3300003794 Bacteria 17000
24 Ga0055531_10002761 3300003794 Bacteria 11519
25 Ga0055531_10020503 3300003794 Bacteria 2610
26 Ga0055531_10020643 3300003794 Bacteria 2595
27 Ga0065165_1000897 3300005262 Bacteria 38449
28 Ga0065165_1001209 3300005262 Bacteria 29779
29 Ga0065165_1014873 3300005262 Bacteria 2999
30 Ga0070658_10006772 3300005327 Bacteria 9275
31 Ga0070658_10280014 3300005327 Bacteria 1419
32 Ga0070683_100057221 3300005329 Bacteria 3622
33 Ga0070670_100000122 3300005331 Bacteria 72250
34 Ga0070670_100111755 3300005331 Bacteria 2355
35 Ga0068869_100224168 3300005334 Bacteria 1491
36 Ga0070666_10007276 3300005335 Bacteria 6819
37 Ga0070680_100079118 3300005336 Bacteria 2709
38 Ga0070682_100068375 3300005337 Bacteria 2265
39 Ga0070660_100032581 3300005339 Unclassified 3923
40 Ga0070691_10008886 3300005341 Bacteria 4601
41 Ga0070692_10165019 3300005345 Unclassified 1272
42 Ga0070668_100000184 3300005347 Bacteria 40584
43 Ga0070668_100000975 3300005347 Bacteria 20042
44 Ga0070668_100003575 3300005347 Bacteria 11466
45 Ga0070668_100037756 3300005347 Bacteria 3690
46 Ga0070668_100051799 3300005347 Bacteria 3164
47 Ga0070669_100012198 3300005353 Bacteria 6099
48 Ga0070669_100254337 3300005353 Bacteria 1400
49 Ga0070659_100008322 3300005366 Bacteria 7573
50 Ga0070659_100044508 3300005366 Bacteria 3475
51 Ga0070667_100000305 3300005367 Bacteria 54805
52 Ga0070667_100009069 3300005367 Bacteria 8233
53 Ga0070667_100011666 3300005367 Bacteria 7264
54 Ga0070667_100032119 3300005367 Bacteria 4378
55 Ga0070708_100081831 3300005445 Bacteria 2924
56 Ga0070663_100043467 3300005455 Bacteria 3162
57 Ga0070678_100028553 3300005456 Bacteria 3807
58 Ga0070678_100104629 3300005456 Bacteria 2202
59 Ga0070681_10026245 3300005458 Bacteria 5855
60 Ga0070698_100119331 3300005471 Bacteria 2598
61 Ga0070679_100055907 3300005530 Bacteria 3931
62 Ga0068853_100070781 3300005539 Bacteria 3036
63 Ga0070672_100026587 3300005543 Bacteria 4309
64 Ga0070693_100004922 3300005547 Bacteria 6375
65 Ga0070665_100000144 3300005548 Bacteria 132302
66 Ga0070665_100000476 3300005548 Bacteria 57814
67 Ga0070665_100001606 3300005548 Bacteria 26020
68 Ga0068855_100083290 3300005563 Bacteria 3705
69 Ga0068855_100299309 3300005563 Bacteria 1782
70 Ga0070664_100116176 3300005564 Bacteria 2339
71 Ga0070702_100115809 3300005615 Bacteria 1670
72 Ga0068859_100002564 3300005617 Bacteria 18451
73 Ga0068864_100000209 3300005618 Bacteria 52622
74 Ga0068864_100001107 3300005618 Bacteria 22544
75 Ga0068864_100004123 3300005618 Bacteria 11928
76 Ga0068864_100259940 3300005618 Bacteria 1615
77 Ga0068861_100245591 3300005719 Bacteria 1525
78 Ga0068863_100000061 3300005841 Bacteria 121811
79 Ga0068863_100000158 3300005841 Bacteria 71918
80 Ga0068863_100002175 3300005841 Bacteria 19429
81 Ga0068863_100116224 3300005841 Bacteria 2549
82 Ga0068863_100175911 3300005841 Bacteria 2054
83 Ga0068858_100000149 3300005842 Bacteria 73242
84 Ga0068858_100002646 3300005842 Bacteria 18033
85 Ga0068858_100022774 3300005842 Bacteria 5841
86 Ga0068858_100061726 3300005842 Bacteria 3465
87 Ga0068858_100077886 3300005842 Bacteria 3080
88 Ga0068858_100140101 3300005842 Bacteria 2270
89 Ga0068860_100000104 3300005843 Bacteria 138111
90 Ga0068860_100000123 3300005843 Bacteria 124700
91 Ga0068860_100226905 3300005843 Bacteria 1814
92 Ga0068862_100001072 3300005844 Bacteria 26218
93 Ga0068862_100016618 3300005844 Bacteria 6126
94 Ga0068862_100032830 3300005844 Bacteria 4384
95 Ga0068862_100042464 3300005844 Bacteria 3874
96 Ga0070717_10082948 3300006028 Bacteria 2694
97 Ga0075368_10005196 3300006042 Bacteria 4465
98 Ga0075363_100013630 3300006048 Bacteria 3948
99 Ga0075364_10004003 3300006051 Bacteria 8463
100 Ga0075367_10003168 3300006178 Bacteria 7756
101 Ga0075370_10016102 3300006353 Bacteria 4018
102 Ga0075370_10122378 3300006353 Bacteria 1515
103 Ga0097620_100002563 3300006931 Bacteria 18451
104 Ga0079104_1000333 3300006946 Bacteria 57718
105 Ga0105240_10004924 3300009093 Bacteria 20078
106 Ga0105240_10033745 3300009093 Bacteria 6608
107 Ga0105240_10079824 3300009093 Bacteria 4026
108 Ga0105240_10166326 3300009093 Bacteria 2615
109 Ga0105245_10091265 3300009098 Bacteria 2803
110 Ga0105243_10354192 3300009148 Unclassified 1349
111 Ga0105241_10019035 3300009174 Bacteria 5062
112 Ga0105242_10097321 3300009176 Bacteria 2488
113 Ga0105248_10002449 3300009177 Bacteria 20613
114 Ga0105248_10015538 3300009177 Bacteria 8391
115 Ga0105248_10017585 3300009177 Bacteria 7885
116 Ga0105248_10024424 3300009177 Bacteria 6720
117 Ga0105248_10059916 3300009177 Bacteria 4275
118 Ga0105248_10132600 3300009177 Bacteria 2811
119 Ga0105248_10284775 3300009177 Bacteria 1861
120 Ga0105248_10379563 3300009177 Bacteria 1591
121 Ga0105237_10298661 3300009545 Bacteria 1613
122 Ga0105238_10011556 3300009551 Bacteria 8896
123 Ga0105238_10035660 3300009551 Bacteria 5055
124 Ga0105238_10116149 3300009551 Bacteria 2655
125 Ga0105238_10180492 3300009551 Bacteria 2088
126 Ga0105249_10002602 3300009553 Bacteria 15636
127 Ga0105246_10026350 3300011119 Bacteria 3797
128 Ga0157371_10032519 3300013102 Bacteria 3753
129 Ga0157370_10026878 3300013104 Bacteria 5678
130 Ga0157370_10219524 3300013104 Bacteria 1761
131 Ga0157378_10134688 3300013297 Bacteria 2290
132 Ga0163162_10197361 3300013306 Bacteria 2141
133 Ga0163162_10274009 3300013306 Bacteria 1819
134 Ga0157372_10311191 3300013307 Bacteria 1833
135 Ga0157375_10266797 3300013308 Bacteria 1874
136 Ga0163163_10001426 3300014325 Bacteria 20233
137 Ga0163163_10021339 3300014325 Bacteria 6110
138 Ga0163163_10043473 3300014325 Bacteria 4405
139 Ga0157380_10181253 3300014326 Bacteria 1851
140 Ga0157379_10001376 3300014968 Bacteria 19905
141 Ga0157379_10033316 3300014968 Bacteria 4595
142 Ga0157379_10073380 3300014968 Bacteria 3063
143 Ga0157376_10257658 3300014969 Unclassified 1632
144 Ga0213876_10000100 3300021384 Bacteria 96803
145 Ga0213876_10007715 3300021384 Bacteria 5844
146 Ga0209672_100041 3300025228 Bacteria 278535
147 Ga0209672_100071 3300025228 Bacteria 169941
148 Ga0209147_100135 3300025229 Bacteria 118099
149 Ga0209147_100173 3300025229 Bacteria 82900
150 Ga0209147_101585 3300025229 Bacteria 7680
151 Ga0209258_100120 3300025242 Bacteria 183488
152 Ga0209258_100207 3300025242 Bacteria 119062
153 Ga0209148_1000134 3300025254 Bacteria 169941
154 Ga0209148_1001422 3300025254 Bacteria 12234
155 Ga0209148_1002326 3300025254 Bacteria 6760
156 Ga0209148_1010601 3300025254 Bacteria 1742
157 Ga0209759_1017997 3300025256 Bacteria 1721
158 Ga0209565_1000387 3300025263 Bacteria 37314
159 Ga0209455_1000241 3300025272 Bacteria 68235
160 Ga0209455_1000874 3300025272 Bacteria 15967
161 Ga0209455_1013011 3300025272 Bacteria 1956
162 Ga0209673_1000102 3300025273 Bacteria 189583
163 Ga0209673_1000910 3300025273 Bacteria 37777
164 Ga0209676_1000061 3300025292 Bacteria 332674
165 Ga0209676_1000171 3300025292 Bacteria 154045
166 Ga0209676_1000177 3300025292 Bacteria 151589
167 Ga0209564_1001157 3300025295 Bacteria 30759
168 Ga0209564_1003003 3300025295 Bacteria 12095
169 Ga0209758_1003020 3300025297 Bacteria 16072
170 Ga0209758_1004199 3300025297 Bacteria 12215
171 Ga0209758_1007492 3300025297 Bacteria 7403
172 Ga0209050_1000029 3300025298 Bacteria 465801
173 Ga0209050_1000391 3300025298 Bacteria 82421
174 Ga0209050_1000496 3300025298 Bacteria 67112
175 Ga0209050_1010471 3300025298 Bacteria 4565
176 Ga0209256_1002273 3300025299 Bacteria 16266
177 Ga0209256_1003175 3300025299 Bacteria 11916
178 Ga0209256_1005583 3300025299 Bacteria 7160
179 Ga0209051_1006417 3300025303 Bacteria 6628
180 Ga0209257_1000152 3300025304 Bacteria 189432
181 Ga0209257_1000199 3300025304 Bacteria 148045
182 Ga0209257_1000224 3300025304 Bacteria 134156
183 Ga0209257_1000253 3300025304 Bacteria 123508
184 Ga0209257_1001271 3300025304 Bacteria 30931
185 Ga0209257_1010517 3300025304 Bacteria 4664
186 Ga0207680_10007468 3300025903 Bacteria 5332
187 Ga0207647_10010083 3300025904 Bacteria 6683
188 Ga0207654_10014629 3300025911 Bacteria 4056
189 Ga0207695_10001334 3300025913 Bacteria 41893
190 Ga0207695_10001763 3300025913 Bacteria 34269
191 Ga0207695_10004631 3300025913 Bacteria 18652
192 Ga0207695_10020138 3300025913 Bacteria 7651
193 Ga0207695_10144167 3300025913 Bacteria 2327
194 Ga0207695_10167881 3300025913 Bacteria 2122
195 Ga0207695_10232843 3300025913 Bacteria 1746
196 Ga0207660_10006734 3300025917 Bacteria 7438
197 Ga0207660_10064218 3300025917 Bacteria 2649
198 Ga0207662_10062818 3300025918 Bacteria 2232
199 Ga0207657_10003160 3300025919 Bacteria 17616
200 Ga0207657_10026468 3300025919 Bacteria 5331
201 Ga0207657_10111179 3300025919 Bacteria 2263
202 Ga0207652_10075903 3300025921 Bacteria 2930
203 Ga0207652_10191530 3300025921 Bacteria 1839
204 Ga0207652_10222481 3300025921 Bacteria 1701
205 Ga0207681_10003041 3300025923 Bacteria 10544
206 Ga0207681_10220188 3300025923 Bacteria 1468
207 Ga0207694_10132109 3300025924 Bacteria 2002
208 Ga0207694_10146018 3300025924 Bacteria 1904
209 Ga0207650_10000031 3300025925 Bacteria 230128
210 Ga0207650_10074601 3300025925 Bacteria 2558
211 Ga0207650_10091449 3300025925 Bacteria 2325
212 Ga0207650_10197639 3300025925 Bacteria 1609
213 Ga0207644_10000926 3300025931 Bacteria 18647
214 Ga0207690_10000617 3300025932 Bacteria 23012
215 Ga0207690_10018428 3300025932 Bacteria 4281
216 Ga0207686_10109938 3300025934 Bacteria 1857
217 Ga0207711_10007505 3300025941 Bacteria 9119
218 Ga0207711_10009610 3300025941 Bacteria 8061
219 Ga0207711_10067795 3300025941 Bacteria 3089
220 Ga0207711_10098542 3300025941 Bacteria 2583
221 Ga0207679_10166964 3300025945 Bacteria 1808
222 Ga0207667_10009086 3300025949 Bacteria 11748
223 Ga0207667_10035529 3300025949 Bacteria 5345
224 Ga0207667_10115037 3300025949 Bacteria 2772
225 Ga0207712_10001543 3300025961 Bacteria 15578
226 Ga0207668_10000087 3300025972 Bacteria 69565
227 Ga0207668_10000175 3300025972 Bacteria 43601
228 Ga0207668_10007361 3300025972 Bacteria 6543
229 Ga0207668_10011851 3300025972 Bacteria 5315
230 Ga0207658_10000084 3300025986 Bacteria 104409
231 Ga0207658_10007826 3300025986 Bacteria 7280
232 Ga0207658_10175875 3300025986 Bacteria 1767
233 Ga0207703_10000050 3300026035 Bacteria 145849
234 Ga0207703_10002021 3300026035 Bacteria 17906
235 Ga0207639_10062524 3300026041 Bacteria 2879
236 Ga0207678_10000170 3300026067 Bacteria 54749
237 Ga0207641_10000118 3300026088 Bacteria 117721
238 Ga0207641_10001468 3300026088 Bacteria 23134
239 Ga0207641_10005259 3300026088 Bacteria 11063
240 Ga0207641_10286187 3300026088 Bacteria 1552
241 Ga0207676_10000312 3300026095 Bacteria 41651
242 Ga0207676_10001720 3300026095 Bacteria 16120
243 Ga0207676_10007002 3300026095 Bacteria 7991
244 Ga0207676_10031604 3300026095 Bacteria 3982
245 Ga0207675_100375166 3300026118 Bacteria 1398
246 Ga0207683_10064548 3300026121 Unclassified 3226
247 Ga0207683_10069660 3300026121 Bacteria 3106
248 Ga0207698_10098572 3300026142 Bacteria 2415
249 Ga0209281_1000322 3300027111 Bacteria 84374
250 Ga0209371_1000345 3300027312 Bacteria 50863
251 Ga0209981_1000704 3300027378 Bacteria 4234
252 Ga0209983_1003451 3300027665 Bacteria 3378
253 Ga0268266_10000003 3300028379 Bacteria 1701703
254 Ga0268266_10003116 3300028379 Bacteria 16874
255 Ga0268266_10023839 3300028379 Bacteria 5207
256 Ga0268266_10051906 3300028379 Bacteria 3521
257 Ga0268265_10002030 3300028380 Bacteria 15880
258 Ga0268265_10002515 3300028380 Bacteria 13726
259 Ga0268265_10187001 3300028380 Bacteria 1785
260 Ga0268264_10000008 3300028381 Bacteria 773387
261 Ga0268264_10000861 3300028381 Bacteria 32169
262 Ga0268264_10152516 3300028381 Bacteria 2073
263 Ga0268264_10317486 3300028381 Bacteria 1472
264 Ga0265337_1020561 3300028556 Bacteria 2067
265 Ga0307517_10042468 3300028786 Bacteria 4875
266 Ga0307517_10054017 3300028786 Bacteria 3985
267 Ga0307515_10035862 3300028794 Bacteria 8049
268 Ga0307515_10043180 3300028794 Bacteria 7019
269 Ga0265338_10019965 3300028800 Bacteria 7074
270 Ga0265338_10248755 3300028800 Bacteria 1312
271 Ga0268256_1000465 3300030500 Bacteria 35284
272 Ga0307511_10009196 3300030521 Bacteria 9845
273 Ga0265327_10000240 3300031251 Bacteria 109753
274 Ga0307513_10000069 3300031456 Bacteria 140558
275 Ga0307408_100185554 3300031548 Bacteria 1672
276 Ga0265314_10009023 3300031711 Bacteria 8477
277 Ga0307516_10000001 3300031730 Bacteria 510338
278 Ga0307406_10000538 3300031901 Bacteria 21814
279 Ga0307407_10060144 3300031903 Bacteria 2216
280 Ga0307409_100093541 3300031995 Bacteria 2471
281 Ga0307414_10019748 3300032004 Bacteria 4183
282 Ga0307414_10034042 3300032004 Bacteria 3373
283 Ga0307414_10064678 3300032004 Bacteria 2605
284 Ga0307414_10212758 3300032004 Bacteria 1581
285 Ga0307510_10025518 3300033180 Bacteria 6813
286 Ga0373950_0000029 3300034818 Bacteria 165216
287 Ga0373944_0024046 3300035089 Bacteria 1782
288 Ga0373936_0007880 3300035113 Bacteria 4001
289 Ga0373931_0059950 3300035691 Bacteria 2048
290 Ga0373927_0000200 3300035695 Bacteria 48402
291 Ga0373947_0041625 3300035725 Bacteria 2740
292 Ga0373925_0000032 3300037068 Bacteria 145357
293 Ga0395899_0031323 3300037312 Bacteria 3997
294 Ga0395899_0131014 3300037312 Bacteria 1790
295 Ga0395900_0004165 3300037418 Bacteria 15390
296 Ga0395898_0019154 3300037466 Bacteria 6968
297 Ga0395898_0021197 3300037466 Bacteria 6592
298 Ga0395898_0041761 3300037466 Bacteria 4527
299 Ga0395898_0293641 3300037466 Bacteria 1551
300 Ga0395905_0042277 3300037471 Bacteria 4276
301 Ga0395905_0091556 3300037471 Bacteria 2851
302 Ga0395905_0144398 3300037471 Bacteria 2239
303 Ga0395901_0036435 3300038443 Bacteria 5085
304 Ga0395901_0083157 3300038443 Bacteria 3346
305 Ga0395901_0085631 3300038443 Bacteria 3294
306 Ga0395901_0116987 3300038443 Bacteria 2801
307 Ga0395901_0323230 3300038443 Bacteria 1596
308 Ga0436365_0839510 3300039437 Bacteria 4702
309 Ga0436365_1147484 3300039437 Bacteria 3289
310 Ga0436365_1234943 3300039437 Bacteria 63250
311 Ga0436365_1447472 3300039437 Bacteria 1806
312 Ga0436361_0705091 3300039447 Bacteria 6452
313 Ga0439431_0027231 3300041997 Bacteria 1404
314 Ga0450919_000793 3300042121 Bacteria 4057
315 Ga0439446_0031567 3300042156 Bacteria 1533
316 Ga0439435_0016814 3300042436 Bacteria 1841
317 Ga0450901_002437 3300042533 Bacteria 2007
318 Ga0466966_0057193 3300044684 Bacteria 2466
319 Ga0495627_000282 3300046453 Bacteria 51175
320 Ga0495590_0005337 3300046457 Bacteria 5102
321 Ga0495638_0000301 3300046460 Bacteria 63603
322 Ga0495638_0000370 3300046460 Bacteria 55689
323 Ga0495638_0001482 3300046460 Bacteria 21206
324 Ga0495638_0011153 3300046460 Bacteria 6207
325 Ga0495638_0018049 3300046460 Bacteria 4694
326 Ga0495638_0072303 3300046460 Bacteria 2108
327 Ga0495638_0175700 3300046460 Bacteria 1225
328 Ga0495650_0000068 3300046471 Bacteria 266671
329 Ga0495607_0046110 3300046501 Bacteria 2562
330 Ga0495583_0000002 3300046506 Bacteria 782521
331 Ga0495606_0005676 3300046507 Bacteria 11812
332 Ga0495610_0000111 3300046512 Bacteria 95122
333 Ga0495610_0004129 3300046512 Bacteria 10863
334 Ga0495610_0007150 3300046512 Bacteria 7523
335 Ga0495616_0000143 3300046513 Bacteria 62451
336 Ga0495616_0050644 3300046513 Bacteria 2076
337 Ga0495620_0014948 3300046515 Bacteria 3930
338 Ga0495620_0022993 3300046515 Bacteria 2990
339 Ga0495631_0001910 3300046518 Bacteria 12282
340 Ga0495632_0003546 3300046519 Bacteria 11032
341 Ga0495632_0036120 3300046519 Bacteria 2515
342 Ga0495637_0008347 3300046520 Bacteria 5092
343 Ga0495637_0010923 3300046520 Bacteria 4376
344 Ga0495643_0043018 3300046522 Bacteria 2459
345 Ga0495648_0000281 3300046524 Bacteria 57761
346 Ga0495654_0000051 3300046530 Bacteria 145932
347 Ga0495621_0021039 3300046539 Bacteria 2147
348 Ga0495597_0009340 3300046542 Bacteria 4850
349 Ga0495597_0028024 3300046542 Bacteria 2580
350 Ga0495645_0060234 3300046543 Bacteria 2752
351 Ga0495622_0000427 3300046557 Bacteria 27809
352 Ga0495633_0000371 3300046558 Bacteria 48203
353 Ga0495668_0000026 3300046616 Bacteria 297287
354 Ga0495668_0004266 3300046616 Bacteria 10261
355 Ga0495668_0010124 3300046616 Bacteria 5735
356 Ga0495668_0049988 3300046616 Bacteria 2318
357 Ga0495668_0051464 3300046616 Bacteria 2280
358 Ga0495625_0000198 3300046660 Bacteria 95530
359 Ga0495625_0003180 3300046660 Bacteria 16710
360 Ga0495625_0088461 3300046660 Bacteria 2146
361 Ga0495625_0111912 3300046660 Bacteria 1865
362 Ga0495669_0000147 3300046684 Bacteria 45027
363 Ga0495669_0001558 3300046684 Bacteria 9426
364 Ga0495649_0004201 3300046694 Bacteria 9450
365 Ga0495589_0043923 3300046794 Bacteria 2224
366 Ga0495660_0046690 3300046810 Bacteria 2374
367 Ga0495672_0000541 3300047320 Bacteria 42921
368 Ga0495683_0025961 3300047323 Bacteria 3000
369 Ga0495677_0015874 3300047445 Bacteria 2734
370 Ga0495677_0036714 3300047445 Bacteria 1790
371 Ga0495679_005277 3300047446 Bacteria 5762
372 Ga0495673_0000267 3300047469 Bacteria 72453
373 Ga0495673_0000287 3300047469 Bacteria 67754
374 Ga0495673_0002888 3300047469 Bacteria 11669
375 Ga0495686_0000857 3300047472 Bacteria 39041
376 Ga0495686_0005174 3300047472 Bacteria 10384
377 Ga0495686_0029607 3300047472 Bacteria 3561
378 Ga0495686_0031328 3300047472 Bacteria 3449
379 Ga0495686_0059689 3300047472 Bacteria 2373
380 Ga0495602_0218374 3300048088 Bacteria 1441
381 Ga0496100_0053996 3300048903 Bacteria 2619
382 Ga0496102_0013407 3300048905 Bacteria 7100
383 Ga0496102_0059918 3300048905 Bacteria 3482
384 Ga0496103_0041529 3300048906 Bacteria 2827
385 Ga0496104_0165882 3300048907 Bacteria 2118
386 Ga0496106_0157954 3300048909 Bacteria 1792
387 Ga0496107_0000038 3300048910 Bacteria 78077
388 Ga0496109_0035918 3300048912 Bacteria 4474
389 Ga0496112_0077565 3300048915 Bacteria 3286
390 Ga0496112_0110636 3300048915 Bacteria 2717
391 Ga0496115_0001272 3300048918 Bacteria 18065
392 Ga0496115_0007923 3300048918 Bacteria 7836
393 Ga0496115_0013375 3300048918 Bacteria 6207
394 Ga0496115_0070770 3300048918 Bacteria 2828
395 Ga0496115_0119069 3300048918 Bacteria 2172
396 Ga0496118_0003882 3300048921 Bacteria 18351
397 Ga0496119_0013411 3300048922 Bacteria 6533
398 Ga0496121_0000059 3300048924 Bacteria 278177
399 Ga0496121_0004382 3300048924 Bacteria 19068
400 Ga0496123_0000539 3300048926 Bacteria 65166
401 Ga0496124_0000174 3300048927 Bacteria 129228
402 Ga0496124_0101365 3300048927 Bacteria 2333
403 Ga0496125_0002919 3300048928 Bacteria 21512
404 Ga0496125_0033660 3300048928 Bacteria 4531
405 Ga0496126_0053791 3300048929 Bacteria 3650
406 Ga0495678_000903 3300049459 Bacteria 26225
407 Ga0501033_0004104 3300049570 Bacteria 11736
408 Ga0501033_0005597 3300049570 Bacteria 9922
409 Ga0501033_0156084 3300049570 Bacteria 1645
410 Ga0501034_0011241 3300049571 Bacteria 9293
411 Ga0501034_0039637 3300049571 Bacteria 4771
412 Ga0501034_0153497 3300049571 Bacteria 2278
413 Ga0501034_0191289 3300049571 Bacteria 2008
414 Ga0501036_0227844 3300049572 Bacteria 1564
415 Ga0501037_0020658 3300049573 Bacteria 4862
416 Ga0501037_0032255 3300049573 Bacteria 3868
417 Ga0501037_0105102 3300049573 Bacteria 2035
418 Ga0501037_0154732 3300049573 Bacteria 1637
419 Ga0501038_0016786 3300049574 Bacteria 6629
420 Ga0501038_0117574 3300049574 Bacteria 2196
421 Ga0501043_0244687 3300049579 Bacteria 1383
422 Ga0501047_0004809 3300049581 Bacteria 12701
423 Ga0501047_0131256 3300049581 Bacteria 2386
424 Ga0501067_0000296 3300049583 Bacteria 27251
425 Ga0501067_0129068 3300049583 Bacteria 1407
426 Ga0501072_0147161 3300049588 Bacteria 1878
427 Ga0501073_0012269 3300049589 Bacteria 6253
428 Ga0501074_0275888 3300049590 Bacteria 1195
429 Ga0501080_0088245 3300049742 Bacteria 2881
430 Ga0501044_0030102 3300049823 Bacteria 5721
431 Ga0501044_0050755 3300049823 Bacteria 4279
432 Ga0501044_0156935 3300049823 Bacteria 2254
433 Ga0501044_0231013 3300049823 Bacteria 1797
434 nmdc:mga03n38_5714_c1 3300050490 Bacteria 4261
435 nmdc:mga00v17_1117_c2 3300050491 Bacteria 10891
436 nmdc:mga06z11_13245_c1 3300050494 Bacteria 3615
437 nmdc:mga04h51_60448_c1 3300050495 Bacteria 1297
438 nmdc:mga07m45_13056_c1 3300050496 Bacteria 4398
439 nmdc:mga0sz30_15848_c1 3300050516 Bacteria 2983
440 Ga0500635_0000599 3300053080 Bacteria 9546
441 Ga0500578_0000070 3300053086 Bacteria 113202
442 Ga0500578_0161289 3300053086 Bacteria 1391
443 Ga0500643_012503 3300053087 Bacteria 3037
444 Ga0500643_030289 3300053087 Bacteria 1658
445 Ga0500644_0000082 3300053088 Bacteria 58141
446 Ga0500644_0001237 3300053088 Bacteria 7059
447 Ga0500647_0030076 3300053091 Bacteria 2578
448 Ga0500583_0027412 3300053092 Bacteria 2459
449 Ga0500651_0003336 3300053093 Bacteria 8762
450 Ga0500651_0007515 3300053093 Bacteria 6366
451 Ga0500641_0001479 3300053096 Bacteria 8374
452 Ga0500554_001713 3300053102 Bacteria 4221
453 Ga0500555_007119 3300053103 Bacteria 3181
454 Ga0500556_0005519 3300053104 Bacteria 3571
455 Ga0500556_0016127 3300053104 Bacteria 2319
456 Ga0500562_000622 3300053108 Bacteria 8550
457 Ga0500562_000896 3300053108 Bacteria 7240
458 Ga0500562_002141 3300053108 Bacteria 4936
459 Ga0500569_012577 3300053109 Bacteria 2051
460 Ga0500594_0000120 3300053118 Bacteria 21836
461 Ga0500595_001693 3300053119 Bacteria 11555
462 Ga0500595_006197 3300053119 Bacteria 5111
463 Ga0500607_044660 3300053121 Bacteria 2383
464 Ga0500608_000072 3300053122 Bacteria 43162
465 Ga0500608_002228 3300053122 Bacteria 6999
466 Ga0500614_003165 3300053123 Bacteria 3573
467 Ga0500614_011167 3300053123 Bacteria 1940
468 Ga0500618_000918 3300053125 Bacteria 15288
469 Ga0500658_0001583 3300053134 Bacteria 9094
470 Ga0500559_0000304 3300053136 Bacteria 37380
471 Ga0500559_0001209 3300053136 Bacteria 15366
472 Ga0500559_0003432 3300053136 Bacteria 7798
473 Ga0500559_0003709 3300053136 Bacteria 7444
474 Ga0500564_000232 3300053138 Bacteria 15491
475 Ga0500573_0027039 3300053140 Bacteria 3298
476 Ga0500577_0013611 3300053142 Bacteria 2490
477 Ga0500590_002644 3300053148 Bacteria 8043
478 Ga0500590_119503 3300053148 Bacteria 1237
479 Ga0500616_0039431 3300053153 Bacteria 2547
480 Ga0500619_011277 3300053154 Bacteria 2293
481 Ga0500622_0001700 3300053156 Bacteria 17076
482 Ga0500622_0013037 3300053156 Bacteria 4491
483 Ga0500622_0014520 3300053156 Bacteria 4228
484 Ga0500622_0026985 3300053156 Bacteria 3028
485 Ga0500636_0000040 3300053177 Bacteria 69881
486 Ga0500637_0028647 3300053178 Bacteria 3082
487 Ga0500576_065181 3300053725 Bacteria 1581
488 Ga0500625_003760 3300053729 Bacteria 6064
489 Ga0500645_002263 3300053730 Bacteria 8751
490 Ga0500645_002570 3300053730 Bacteria 7989
491 Ga0500609_000110 3300053731 Bacteria 10836
492 Ga0500596_000885 3300053735 Bacteria 5973
493 Ga0500601_004456 3300053737 Bacteria 1526
494 Ga0501082_0003752 3300060353 Bacteria 13276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0323230 Ga0395901_0323230_20_1018 323
2 3300048918 Ga0496115_0119069 Ga0496115_0119069_1178_2161 327
3 3300028800 Ga0265338_10248755 Ga0265338_102487551 332
4 3300046539 Ga0495621_0021039 Ga0495621_0021039_304_1419 336
5 3300031711 Ga0265314_10009023 Ga0265314_100090235 341
6 3300031548 Ga0307408_100185554 Ga0307408_1001855542 342
7 3300049571 Ga0501034_0011241 Ga0501034_0011241_6746_7855 347
8 3300035725 Ga0373947_0041625 Ga0373947_0041625_1399_2511 350
9 3300037466 Ga0395898_0021197 Ga0395898_0021197_1322_2434 351
10 3300037471 Ga0395905_0091556 Ga0395905_0091556_1590_2702 351
11 3300049581 Ga0501047_0004809 Ga0501047_0004809_7503_8627 352
12 3300005843 Ga0068860_100000104 Ga0068860_10000010489 354
13 3300028381 Ga0268264_10000008 Ga0268264_10000008397 354
14 3300037471 Ga0395905_0144398 Ga0395905_0144398_632_1756 355
15 3300042436 Ga0439435_0016814 Ga0439435_0016814_752_1819 355
16 iso_pu_bacteria 2842698319 2842703053 357
17 3300046684 Ga0495669_0001558 Ga0495669_0001558_95_1225 359
18 3300047445 Ga0495677_0015874 Ga0495677_0015874_779_1909 359
19 3300049571 Ga0501034_0153497 Ga0501034_0153497_971_2083 359
20 3300038443 Ga0395901_0083157 Ga0395901_0083157_1126_2238 360
21 3300042156 Ga0439446_0031567 Ga0439446_0031567_33_1145 360
22 3300049573 Ga0501037_0020658 Ga0501037_0020658_1221_2321 360
23 3300049574 Ga0501038_0117574 Ga0501038_0117574_92_1192 360
24 3300049823 Ga0501044_0156935 Ga0501044_0156935_172_1272 360
25 3300006946 Ga0079104_1000333 Ga0079104_10003336 362
26 3300027111 Ga0209281_1000322 Ga0209281_10003226 362
27 3300032004 Ga0307414_10019748 Ga0307414_100197484 362
28 3300035089 Ga0373944_0024046 Ga0373944_0024046_545_1684 362
29 3300035695 Ga0373927_0000200 Ga0373927_0000200_1649_2788 362
30 3300037068 Ga0373925_0000032 Ga0373925_0000032_12115_13254 362
31 iso_pu_bacteria 2978969890 2978972651 363
32 3300009093 Ga0105240_10033745 Ga0105240_100337453 364
33 3300009551 Ga0105238_10035660 Ga0105238_100356604 364
34 3300025913 Ga0207695_10167881 Ga0207695_101678812 364
35 3300025921 Ga0207652_10191530 Ga0207652_101915301 364
36 3300025924 Ga0207694_10146018 Ga0207694_101460182 364
37 3300037312 Ga0395899_0031323 Ga0395899_0031323_167_1285 364
38 3300037466 Ga0395898_0019154 Ga0395898_0019154_3961_5079 364
39 3300038443 Ga0395901_0116987 Ga0395901_0116987_443_1561 364
40 3300044684 Ga0466966_0057193 Ga0466966_0057193_358_1476 364
41 3300049570 Ga0501033_0156084 Ga0501033_0156084_460_1578 364
42 3300049573 Ga0501037_0032255 Ga0501037_0032255_2597_3694 364
43 3300049581 Ga0501047_0131256 Ga0501047_0131256_380_1498 364
44 3300053177 Ga0500636_0000040 Ga0500636_0000040_64409_65518 364
45 iso_pu_bacteria 2599185239 2599740044 364
46 iso_pu_bacteria 2599185240 2599744368 364
47 iso_pu_bacteria 2599185355 2600206405 364
48 iso_pu_bacteria 2643221644 2644248968 364
49 iso_pu_bacteria 2675903129 2676744755 364
50 iso_pu_bacteria 2818991452 2819635989 364
51 iso_pu_bacteria 2863421361 2863426272 364
52 iso_pu_bacteria 2870068957 2870069865 364
53 iso_pu_bacteria 2904564687 2904567913 364
54 iso_pu_bacteria 2904571731 2904574685 364
55 iso_pu_bacteria 2928157003 2928161800 364
56 iso_pu_bacteria 2928163908 2928169916 364
57 iso_pu_bacteria 2928170801 2928176810 364
58 iso_pu_bacteria 2928536128 2928539223 364
59 iso_pu_bacteria 2981990288 2981993034 364
60 iso_pu_bacteria 641736154 642416636 364
61 iso_pu_bacteria 8018845410 8018850821 364
62 iso_pu_bacteria 8020945358 8020951484 364
63 iso_pu_bacteria 8021120328 8021127400 364
64 iso_pu_bacteria 8039098773 8039098832 364
65 iso_pu_bacteria 2643221574 2643883569 365
66 iso_pu_bacteria 2643221699 2644551896 365
67 iso_pu_bacteria 2643221699 2644553070 365
68 iso_pu_bacteria 2928972540 2928974843 365
69 iso_pu_bacteria 2977240413 2977242113 365
70 3300021384 Ga0213876_10007715 Ga0213876_100077152 366
71 3300025918 Ga0207662_10062818 Ga0207662_100628183 366
72 3300039437 Ga0436365_0839510 Ga0436365_0839510_3380_4480 366
73 iso_pu_bacteria 2510917020 2511121997 366
74 iso_pu_bacteria 2582581279 2585147906 366
75 iso_pu_bacteria 2585428106 2587918331 366
76 iso_pu_bacteria 2643221598 2643998493 366
77 iso_pu_bacteria 2643221614 2644086625 366
78 iso_pu_bacteria 2643221640 2644227777 366
79 iso_pu_bacteria 2643221642 2644233962 366
80 iso_pu_bacteria 2643221661 2644341579 366
81 iso_pu_bacteria 2643221666 2644367866 366
82 iso_pu_bacteria 2849560528 2849562511 366
83 iso_pu_bacteria 2849573788 2849574975 366
84 iso_pu_bacteria 2851153111 2851155761 366
85 iso_pu_bacteria 2884960567 2884962273 366
86 iso_pu_bacteria 2928531327 2928533079 366
87 3300005327 Ga0070658_10006772 Ga0070658_100067724 367
88 3300005329 Ga0070683_100057221 Ga0070683_1000572214 367
89 3300005334 Ga0068869_100224168 Ga0068869_1002241681 367
90 3300005337 Ga0070682_100068375 Ga0070682_1000683752 367
91 3300005339 Ga0070660_100032581 Ga0070660_1000325813 367
92 3300005345 Ga0070692_10165019 Ga0070692_101650191 367
93 3300005366 Ga0070659_100044508 Ga0070659_1000445083 367
94 3300005455 Ga0070663_100043467 Ga0070663_1000434672 367
95 3300005456 Ga0070678_100028553 Ga0070678_1000285532 367
96 3300005458 Ga0070681_10026245 Ga0070681_100262454 367
97 3300005543 Ga0070672_100026587 Ga0070672_1000265872 367
98 3300005547 Ga0070693_100004922 Ga0070693_1000049224 367
99 3300005564 Ga0070664_100116176 Ga0070664_1001161762 367
100 3300005615 Ga0070702_100115809 Ga0070702_1001158091 367
101 3300005842 Ga0068858_100022774 Ga0068858_1000227741 367
102 3300005842 Ga0068858_100061726 Ga0068858_1000617264 367
103 3300005843 Ga0068860_100226905 Ga0068860_1002269052 367
104 3300009098 Ga0105245_10091265 Ga0105245_100912652 367
105 3300009148 Ga0105243_10354192 Ga0105243_103541921 367
106 3300009174 Ga0105241_10019035 Ga0105241_100190354 367
107 3300009545 Ga0105237_10298661 Ga0105237_102986612 367
108 3300011119 Ga0105246_10026350 Ga0105246_100263504 367
109 3300013104 Ga0157370_10219524 Ga0157370_102195241 367
110 3300013297 Ga0157378_10134688 Ga0157378_101346882 367
111 3300014969 Ga0157376_10257658 Ga0157376_102576581 367
112 3300025904 Ga0207647_10010083 Ga0207647_100100839 367
113 3300025911 Ga0207654_10014629 Ga0207654_100146293 367
114 3300025917 Ga0207660_10064218 Ga0207660_100642181 367
115 3300025919 Ga0207657_10026468 Ga0207657_100264682 367
116 3300025921 Ga0207652_10075903 Ga0207652_100759032 367
117 3300025932 Ga0207690_10018428 Ga0207690_100184283 367
118 3300025945 Ga0207679_10166964 Ga0207679_101669642 367
119 3300026041 Ga0207639_10062524 Ga0207639_100625241 367
120 3300026067 Ga0207678_10000170 Ga0207678_100001704 367
121 3300026121 Ga0207683_10064548 Ga0207683_100645481 367
122 3300048905 Ga0496102_0013407 Ga0496102_0013407_4744_5868 367
123 3300048906 Ga0496103_0041529 Ga0496103_0041529_559_1683 367
124 3300048907 Ga0496104_0165882 Ga0496104_0165882_111_1235 367
125 3300048918 Ga0496115_0013375 Ga0496115_0013375_3486_4610 367
126 3300048927 Ga0496124_0000174 Ga0496124_0000174_60959_62062 367
127 3300049571 Ga0501034_0039637 Ga0501034_0039637_527_1633 367
128 3300049571 Ga0501034_0191289 Ga0501034_0191289_771_1877 367
129 3300049572 Ga0501036_0227844 Ga0501036_0227844_209_1315 367
130 3300049573 Ga0501037_0154732 Ga0501037_0154732_446_1552 367
131 3300049574 Ga0501038_0016786 Ga0501038_0016786_2556_3662 367
132 3300049583 Ga0501067_0129068 Ga0501067_0129068_75_1184 367
133 3300049588 Ga0501072_0147161 Ga0501072_0147161_49_1155 367
134 3300049590 Ga0501074_0275888 Ga0501074_0275888_14_1120 367
135 3300049742 Ga0501080_0088245 Ga0501080_0088245_910_2016 367
136 3300049823 Ga0501044_0030102 Ga0501044_0030102_3513_4619 367
137 3300049823 Ga0501044_0231013 Ga0501044_0231013_330_1436 367
138 3300060353 Ga0501082_0003752 Ga0501082_0003752_1007_2119 367
139 iso_pu_bacteria 2582581280 2585151802 367
140 iso_pu_bacteria 2582581293 2585194712 367
141 iso_pu_bacteria 2643221545 2643748432 367
142 iso_pu_bacteria 2643221552 2643779391 367
143 iso_pu_bacteria 2643221583 2643924145 367
144 iso_pu_bacteria 2643221691 2644510105 367
145 iso_pu_bacteria 2791355048 2792462725 367
146 iso_pu_bacteria 2818991435 2819540115 367
147 iso_pu_bacteria 2818991454 2819649153 367
148 iso_pu_bacteria 2843744320 2843749547 367
149 iso_pu_bacteria 2857504554 2857505462 367
150 iso_pu_bacteria 2898329390 2898332308 367
151 iso_pu_bacteria 2941485952 2941487497 367
152 3300003760 Ga0055527_1000775 Ga0055527_10007754 368
153 3300003761 Ga0055535_1001908 Ga0055535_10019084 368
154 3300003761 Ga0055535_1001916 Ga0055535_10019164 368
155 3300003762 Ga0055542_1001819 Ga0055542_10018195 368
156 3300003763 Ga0055529_1000512 Ga0055529_100051224 368
157 3300003775 Ga0055524_1000182 Ga0055524_100018257 368
158 3300003790 Ga0055528_1000872 Ga0055528_100087216 368
159 3300013104 Ga0157370_10026878 Ga0157370_100268786 368
160 3300025228 Ga0209672_100041 Ga0209672_100041157 368
161 3300025228 Ga0209672_100071 Ga0209672_10007177 368
162 3300025229 Ga0209147_100135 Ga0209147_10013541 368
163 3300025229 Ga0209147_100173 Ga0209147_1001736 368
164 3300025229 Ga0209147_101585 Ga0209147_1015853 368
165 3300025242 Ga0209258_100120 Ga0209258_10012041 368
166 3300025242 Ga0209258_100207 Ga0209258_10020777 368
167 3300025254 Ga0209148_1000134 Ga0209148_100013493 368
168 3300025254 Ga0209148_1002326 Ga0209148_10023264 368
169 3300025256 Ga0209759_1017997 Ga0209759_10179972 368
170 3300025272 Ga0209455_1000241 Ga0209455_100024124 368
171 3300025272 Ga0209455_1000874 Ga0209455_100087414 368
172 3300025273 Ga0209673_1000102 Ga0209673_1000102145 368
173 3300025295 Ga0209564_1003003 Ga0209564_10030032 368
174 3300025298 Ga0209050_1010471 Ga0209050_10104712 368
175 3300025913 Ga0207695_10001334 Ga0207695_1000133436 368
176 3300027312 Ga0209371_1000345 Ga0209371_100034531 368
177 3300030500 Ga0268256_1000465 Ga0268256_100046515 368
178 3300039437 Ga0436365_1147484 Ga0436365_1147484_16_1125 368
179 3300042121 Ga0450919_000793 Ga0450919_000793_2003_3133 368
180 3300046524 Ga0495648_0000281 Ga0495648_0000281_41453_42559 368
181 3300047469 Ga0495673_0000267 Ga0495673_0000267_40400_41506 368
182 3300053088 Ga0500644_0000082 Ga0500644_0000082_19800_20906 368
183 3300053138 Ga0500564_000232 Ga0500564_000232_4740_5846 368
184 3300003578 Ga0006562J51391_1104830 Ga0006562J51391_11048302 369
185 3300003781 Ga0055536_1005132 Ga0055536_10051329 369
186 3300003781 Ga0055536_1005459 Ga0055536_10054594 369
187 3300003794 Ga0055531_10020503 Ga0055531_100205032 369
188 3300005336 Ga0070680_100079118 Ga0070680_1000791182 369
189 3300005445 Ga0070708_100081831 Ga0070708_1000818312 369
190 3300005563 Ga0068855_100083290 Ga0068855_1000832904 369
191 3300005841 Ga0068863_100175911 Ga0068863_1001759112 369
192 3300005844 Ga0068862_100042464 Ga0068862_1000424644 369
193 3300006042 Ga0075368_10005196 Ga0075368_100051962 369
194 3300006048 Ga0075363_100013630 Ga0075363_1000136302 369
195 3300006051 Ga0075364_10004003 Ga0075364_100040035 369
196 3300006178 Ga0075367_10003168 Ga0075367_100031682 369
197 3300006353 Ga0075370_10016102 Ga0075370_100161023 369
198 3300006353 Ga0075370_10122378 Ga0075370_101223782 369
199 3300009093 Ga0105240_10166326 Ga0105240_101663262 369
200 3300013307 Ga0157372_10311191 Ga0157372_103111912 369
201 3300021384 Ga0213876_10000100 Ga0213876_1000010082 369
202 3300025292 Ga0209676_1000061 Ga0209676_1000061163 369
203 3300025304 Ga0209257_1000199 Ga0209257_1000199154 369
204 3300025304 Ga0209257_1001271 Ga0209257_100127110 369
205 3300025913 Ga0207695_10020138 Ga0207695_100201382 369
206 3300025925 Ga0207650_10197639 Ga0207650_101976391 369
207 3300025949 Ga0207667_10115037 Ga0207667_101150372 369
208 3300025972 Ga0207668_10011851 Ga0207668_100118515 369
209 3300026142 Ga0207698_10098572 Ga0207698_100985722 369
210 3300028380 Ga0268265_10187001 Ga0268265_101870012 369
211 3300028556 Ga0265337_1020561 Ga0265337_10205612 369
212 3300028800 Ga0265338_10019965 Ga0265338_100199653 369
213 3300031456 Ga0307513_10000069 Ga0307513_1000006978 369
214 3300031901 Ga0307406_10000538 Ga0307406_100005385 369
215 3300032004 Ga0307414_10034042 Ga0307414_100340423 369
216 3300032004 Ga0307414_10064678 Ga0307414_100646783 369
217 3300032004 Ga0307414_10212758 Ga0307414_102127582 369
218 3300034818 Ga0373950_0000029 Ga0373950_0000029_78251_79372 369
219 3300035691 Ga0373931_0059950 Ga0373931_0059950_147_1256 369
220 3300037312 Ga0395899_0131014 Ga0395899_0131014_433_1563 369
221 3300037466 Ga0395898_0293641 Ga0395898_0293641_78_1208 369
222 3300039437 Ga0436365_1234943 Ga0436365_1234943_9558_10697 369
223 3300039447 Ga0436361_0705091 Ga0436361_0705091_4769_5923 369
224 3300041997 Ga0439431_0027231 Ga0439431_0027231_126_1247 369
225 3300046558 Ga0495633_0000371 Ga0495633_0000371_13369_14484 369
226 3300048926 Ga0496123_0000539 Ga0496123_0000539_40930_42045 369
227 3300049570 Ga0501033_0004104 Ga0501033_0004104_10550_11677 369
228 3300049583 Ga0501067_0000296 Ga0501067_0000296_16732_17853 369
229 3300049589 Ga0501073_0012269 Ga0501073_0012269_2292_3413 369
230 3300050490 nmdc:mga03n38_5714_c1 nmdc:mga03n38_5714_c1_2904_4013 369
231 3300050491 nmdc:mga00v17_1117_c2 nmdc:mga00v17_1117_c2_3428_4537 369
232 3300050494 nmdc:mga06z11_13245_c1 nmdc:mga06z11_13245_c1_2140_3249 369
233 3300050495 nmdc:mga04h51_60448_c1 nmdc:mga04h51_60448_c1_135_1244 369
234 3300050496 nmdc:mga07m45_13056_c1 nmdc:mga07m45_13056_c1_2538_3647 369
235 3300053088 Ga0500644_0001237 Ga0500644_0001237_1711_2823 369
236 3300053093 Ga0500651_0003336 Ga0500651_0003336_2562_3674 369
237 3300053108 Ga0500562_002141 Ga0500562_002141_3265_4374 369
238 3300003215 JGI25153J46596_10044260 JGI25153J46596_100442601 370
239 3300003791 Ga0055530_10000026 Ga0055530_100000264 370
240 3300003794 Ga0055531_10002761 Ga0055531_100027615 370
241 3300005262 Ga0065165_1000897 Ga0065165_10008971 370
242 3300005262 Ga0065165_1014873 Ga0065165_10148733 370
243 3300005327 Ga0070658_10280014 Ga0070658_102800141 370
244 3300005331 Ga0070670_100000122 Ga0070670_10000012245 370
245 3300005331 Ga0070670_100111755 Ga0070670_1001117552 370
246 3300005335 Ga0070666_10007276 Ga0070666_100072762 370
247 3300005341 Ga0070691_10008886 Ga0070691_100088864 370
248 3300005347 Ga0070668_100000184 Ga0070668_10000018422 370
249 3300005347 Ga0070668_100000975 Ga0070668_1000009755 370
250 3300005347 Ga0070668_100003575 Ga0070668_1000035755 370
251 3300005347 Ga0070668_100037756 Ga0070668_1000377563 370
252 3300005347 Ga0070668_100051799 Ga0070668_1000517992 370
253 3300005353 Ga0070669_100012198 Ga0070669_1000121983 370
254 3300005353 Ga0070669_100254337 Ga0070669_1002543371 370
255 3300005366 Ga0070659_100008322 Ga0070659_1000083227 370
256 3300005367 Ga0070667_100000305 Ga0070667_10000030526 370
257 3300005367 Ga0070667_100009069 Ga0070667_1000090694 370
258 3300005367 Ga0070667_100011666 Ga0070667_1000116665 370
259 3300005367 Ga0070667_100032119 Ga0070667_1000321192 370
260 3300005456 Ga0070678_100104629 Ga0070678_1001046292 370
261 3300005471 Ga0070698_100119331 Ga0070698_1001193311 370
262 3300005530 Ga0070679_100055907 Ga0070679_1000559072 370
263 3300005539 Ga0068853_100070781 Ga0068853_1000707812 370
264 3300005548 Ga0070665_100000144 Ga0070665_10000014497 370
265 3300005548 Ga0070665_100000476 Ga0070665_10000047622 370
266 3300005548 Ga0070665_100001606 Ga0070665_1000016062 370
267 3300005563 Ga0068855_100299309 Ga0068855_1002993092 370
268 3300005617 Ga0068859_100002564 Ga0068859_10000256411 370
269 3300005618 Ga0068864_100000209 Ga0068864_10000020917 370
270 3300005618 Ga0068864_100001107 Ga0068864_1000011079 370
271 3300005618 Ga0068864_100004123 Ga0068864_1000041235 370
272 3300005618 Ga0068864_100259940 Ga0068864_1002599402 370
273 3300005719 Ga0068861_100245591 Ga0068861_1002455911 370
274 3300005841 Ga0068863_100000061 Ga0068863_10000006119 370
275 3300005841 Ga0068863_100000158 Ga0068863_10000015815 370
276 3300005841 Ga0068863_100002175 Ga0068863_1000021755 370
277 3300005841 Ga0068863_100116224 Ga0068863_1001162242 370
278 3300005842 Ga0068858_100000149 Ga0068858_10000014926 370
279 3300005842 Ga0068858_100002646 Ga0068858_1000026462 370
280 3300005842 Ga0068858_100077886 Ga0068858_1000778862 370
281 3300005842 Ga0068858_100140101 Ga0068858_1001401012 370
282 3300005843 Ga0068860_100000123 Ga0068860_100000123100 370
283 3300005844 Ga0068862_100001072 Ga0068862_10000107218 370
284 3300005844 Ga0068862_100016618 Ga0068862_1000166185 370
285 3300005844 Ga0068862_100032830 Ga0068862_1000328302 370
286 3300006028 Ga0070717_10082948 Ga0070717_100829481 370
287 3300006931 Ga0097620_100002563 Ga0097620_10000256311 370
288 3300009093 Ga0105240_10004924 Ga0105240_100049244 370
289 3300009093 Ga0105240_10079824 Ga0105240_100798243 370
290 3300009176 Ga0105242_10097321 Ga0105242_100973213 370
291 3300009177 Ga0105248_10002449 Ga0105248_1000244917 370
292 3300009177 Ga0105248_10015538 Ga0105248_100155382 370
293 3300009177 Ga0105248_10017585 Ga0105248_100175853 370
294 3300009177 Ga0105248_10024424 Ga0105248_100244244 370
295 3300009177 Ga0105248_10059916 Ga0105248_100599163 370
296 3300009177 Ga0105248_10132600 Ga0105248_101326002 370
297 3300009177 Ga0105248_10284775 Ga0105248_102847752 370
298 3300009177 Ga0105248_10379563 Ga0105248_103795632 370
299 3300009551 Ga0105238_10011556 Ga0105238_100115562 370
300 3300009551 Ga0105238_10116149 Ga0105238_101161493 370
301 3300009551 Ga0105238_10180492 Ga0105238_101804922 370
302 3300009553 Ga0105249_10002602 Ga0105249_1000260212 370
303 3300013306 Ga0163162_10197361 Ga0163162_101973612 370
304 3300013306 Ga0163162_10274009 Ga0163162_102740092 370
305 3300013308 Ga0157375_10266797 Ga0157375_102667972 370
306 3300014325 Ga0163163_10001426 Ga0163163_100014265 370
307 3300014325 Ga0163163_10021339 Ga0163163_100213392 370
308 3300014325 Ga0163163_10043473 Ga0163163_100434731 370
309 3300014326 Ga0157380_10181253 Ga0157380_101812532 370
310 3300014968 Ga0157379_10001376 Ga0157379_1000137611 370
311 3300014968 Ga0157379_10033316 Ga0157379_100333165 370
312 3300014968 Ga0157379_10073380 Ga0157379_100733806 370
313 3300025254 Ga0209148_1001422 Ga0209148_10014225 370
314 3300025254 Ga0209148_1010601 Ga0209148_10106012 370
315 3300025272 Ga0209455_1013011 Ga0209455_10130111 370
316 3300025297 Ga0209758_1004199 Ga0209758_10041994 370
317 3300025298 Ga0209050_1000029 Ga0209050_1000029292 370
318 3300025299 Ga0209256_1005583 Ga0209256_10055834 370
319 3300025304 Ga0209257_1000152 Ga0209257_100015224 370
320 3300025903 Ga0207680_10007468 Ga0207680_100074682 370
321 3300025913 Ga0207695_10001763 Ga0207695_1000176326 370
322 3300025913 Ga0207695_10004631 Ga0207695_100046317 370
323 3300025913 Ga0207695_10144167 Ga0207695_101441673 370
324 3300025913 Ga0207695_10232843 Ga0207695_102328431 370
325 3300025917 Ga0207660_10006734 Ga0207660_100067347 370
326 3300025919 Ga0207657_10003160 Ga0207657_1000316020 370
327 3300025919 Ga0207657_10111179 Ga0207657_101111792 370
328 3300025921 Ga0207652_10222481 Ga0207652_102224812 370
329 3300025923 Ga0207681_10003041 Ga0207681_100030413 370
330 3300025923 Ga0207681_10220188 Ga0207681_102201882 370
331 3300025924 Ga0207694_10132109 Ga0207694_101321092 370
332 3300025925 Ga0207650_10000031 Ga0207650_1000003125 370
333 3300025925 Ga0207650_10074601 Ga0207650_100746012 370
334 3300025925 Ga0207650_10091449 Ga0207650_100914492 370
335 3300025931 Ga0207644_10000926 Ga0207644_100009267 370
336 3300025932 Ga0207690_10000617 Ga0207690_1000061719 370
337 3300025934 Ga0207686_10109938 Ga0207686_101099381 370
338 3300025941 Ga0207711_10007505 Ga0207711_100075052 370
339 3300025941 Ga0207711_10009610 Ga0207711_100096104 370
340 3300025941 Ga0207711_10067795 Ga0207711_100677952 370
341 3300025941 Ga0207711_10098542 Ga0207711_100985423 370
342 3300025949 Ga0207667_10009086 Ga0207667_100090865 370
343 3300025949 Ga0207667_10035529 Ga0207667_100355296 370
344 3300025961 Ga0207712_10001543 Ga0207712_1000154310 370
345 3300025972 Ga0207668_10000087 Ga0207668_1000008752 370
346 3300025972 Ga0207668_10000175 Ga0207668_1000017518 370
347 3300025972 Ga0207668_10007361 Ga0207668_100073614 370
348 3300025986 Ga0207658_10000084 Ga0207658_1000008462 370
349 3300025986 Ga0207658_10007826 Ga0207658_100078264 370
350 3300025986 Ga0207658_10175875 Ga0207658_101758752 370
351 3300026035 Ga0207703_10000050 Ga0207703_1000005048 370
352 3300026035 Ga0207703_10002021 Ga0207703_100020212 370
353 3300026088 Ga0207641_10000118 Ga0207641_1000011894 370
354 3300026088 Ga0207641_10001468 Ga0207641_100014682 370
355 3300026088 Ga0207641_10005259 Ga0207641_100052595 370
356 3300026088 Ga0207641_10286187 Ga0207641_102861872 370
357 3300026095 Ga0207676_10000312 Ga0207676_1000031214 370
358 3300026095 Ga0207676_10001720 Ga0207676_1000172012 370
359 3300026095 Ga0207676_10007002 Ga0207676_100070024 370
360 3300026095 Ga0207676_10031604 Ga0207676_100316044 370
361 3300026118 Ga0207675_100375166 Ga0207675_1003751661 370
362 3300026121 Ga0207683_10069660 Ga0207683_100696603 370
363 3300027378 Ga0209981_1000704 Ga0209981_10007042 370
364 3300027665 Ga0209983_1003451 Ga0209983_10034512 370
365 3300028379 Ga0268266_10000003 Ga0268266_10000003389 370
366 3300028379 Ga0268266_10003116 Ga0268266_100031165 370
367 3300028379 Ga0268266_10023839 Ga0268266_100238392 370
368 3300028379 Ga0268266_10051906 Ga0268266_100519063 370
369 3300028380 Ga0268265_10002030 Ga0268265_1000203011 370
370 3300028380 Ga0268265_10002515 Ga0268265_100025159 370
371 3300028381 Ga0268264_10000861 Ga0268264_1000086125 370
372 3300028381 Ga0268264_10152516 Ga0268264_101525162 370
373 3300028381 Ga0268264_10317486 Ga0268264_103174862 370
374 3300028786 Ga0307517_10042468 Ga0307517_100424684 370
375 3300028786 Ga0307517_10054017 Ga0307517_100540172 370
376 3300030521 Ga0307511_10009196 Ga0307511_100091969 370
377 3300031251 Ga0265327_10000240 Ga0265327_1000024097 370
378 3300031730 Ga0307516_10000001 Ga0307516_1000000171 370
379 3300031903 Ga0307407_10060144 Ga0307407_100601442 370
380 3300031995 Ga0307409_100093541 Ga0307409_1000935414 370
381 3300033180 Ga0307510_10025518 Ga0307510_100255183 370
382 3300035113 Ga0373936_0007880 Ga0373936_0007880_1583_2695 370
383 3300037418 Ga0395900_0004165 Ga0395900_0004165_13844_14956 370
384 3300037466 Ga0395898_0041761 Ga0395898_0041761_343_1455 370
385 3300037471 Ga0395905_0042277 Ga0395905_0042277_416_1528 370
386 3300038443 Ga0395901_0036435 Ga0395901_0036435_2891_4003 370
387 3300038443 Ga0395901_0085631 Ga0395901_0085631_343_1455 370
388 3300046460 Ga0495638_0072303 Ga0495638_0072303_138_1250 370
389 3300046507 Ga0495606_0005676 Ga0495606_0005676_9010_10125 370
390 3300046515 Ga0495620_0014948 Ga0495620_0014948_2345_3457 370
391 3300046522 Ga0495643_0043018 Ga0495643_0043018_249_1361 370
392 3300046543 Ga0495645_0060234 Ga0495645_0060234_462_1574 370
393 3300046557 Ga0495622_0000427 Ga0495622_0000427_8212_9324 370
394 3300046616 Ga0495668_0000026 Ga0495668_0000026_39938_41062 370
395 3300046616 Ga0495668_0010124 Ga0495668_0010124_1787_2899 370
396 3300046616 Ga0495668_0049988 Ga0495668_0049988_527_1639 370
397 3300046684 Ga0495669_0000147 Ga0495669_0000147_21127_22239 370
398 3300047445 Ga0495677_0036714 Ga0495677_0036714_155_1267 370
399 3300047472 Ga0495686_0005174 Ga0495686_0005174_1288_2412 370
400 3300048088 Ga0495602_0218374 Ga0495602_0218374_17_1129 370
401 3300048903 Ga0496100_0053996 Ga0496100_0053996_652_1764 370
402 3300048905 Ga0496102_0059918 Ga0496102_0059918_1087_2199 370
403 3300048909 Ga0496106_0157954 Ga0496106_0157954_47_1159 370
404 3300048912 Ga0496109_0035918 Ga0496109_0035918_988_2100 370
405 3300048915 Ga0496112_0077565 Ga0496112_0077565_1583_2695 370
406 3300048915 Ga0496112_0110636 Ga0496112_0110636_639_1751 370
407 3300048918 Ga0496115_0001272 Ga0496115_0001272_16204_17316 370
408 3300048921 Ga0496118_0003882 Ga0496118_0003882_663_1775 370
409 3300048922 Ga0496119_0013411 Ga0496119_0013411_1745_2857 370
410 3300048924 Ga0496121_0000059 Ga0496121_0000059_160978_162090 370
411 3300049570 Ga0501033_0005597 Ga0501033_0005597_5766_6890 370
412 3300049573 Ga0501037_0105102 Ga0501037_0105102_243_1367 370
413 3300049579 Ga0501043_0244687 Ga0501043_0244687_97_1221 370
414 3300049823 Ga0501044_0050755 Ga0501044_0050755_257_1381 370
415 3300053080 Ga0500635_0000599 Ga0500635_0000599_6605_7717 370
416 3300053086 Ga0500578_0161289 Ga0500578_0161289_66_1178 370
417 3300053087 Ga0500643_012503 Ga0500643_012503_473_1597 370
418 3300053087 Ga0500643_030289 Ga0500643_030289_429_1541 370
419 3300053091 Ga0500647_0030076 Ga0500647_0030076_64_1176 370
420 3300053092 Ga0500583_0027412 Ga0500583_0027412_174_1286 370
421 3300053093 Ga0500651_0007515 Ga0500651_0007515_1801_2913 370
422 3300053096 Ga0500641_0001479 Ga0500641_0001479_1011_2132 370
423 3300053103 Ga0500555_007119 Ga0500555_007119_551_1663 370
424 3300053104 Ga0500556_0016127 Ga0500556_0016127_625_1737 370
425 3300053108 Ga0500562_000622 Ga0500562_000622_391_1503 370
426 3300053109 Ga0500569_012577 Ga0500569_012577_414_1526 370
427 3300053119 Ga0500595_001693 Ga0500595_001693_9938_11050 370
428 3300053121 Ga0500607_044660 Ga0500607_044660_977_2089 370
429 3300053122 Ga0500608_002228 Ga0500608_002228_5611_6723 370
430 3300053123 Ga0500614_011167 Ga0500614_011167_548_1660 370
431 3300053136 Ga0500559_0003709 Ga0500559_0003709_4534_5646 370
432 3300053140 Ga0500573_0027039 Ga0500573_0027039_920_2032 370
433 3300053148 Ga0500590_002644 Ga0500590_002644_2761_3873 370
434 3300053148 Ga0500590_119503 Ga0500590_119503_100_1212 370
435 3300053154 Ga0500619_011277 Ga0500619_011277_215_1327 370
436 3300053156 Ga0500622_0013037 Ga0500622_0013037_1182_2294 370
437 3300053178 Ga0500637_0028647 Ga0500637_0028647_444_1556 370
438 3300053725 Ga0500576_065181 Ga0500576_065181_91_1203 370
439 3300053729 Ga0500625_003760 Ga0500625_003760_363_1475 370
440 3300053730 Ga0500645_002570 Ga0500645_002570_6014_7126 370
441 3300053735 Ga0500596_000885 Ga0500596_000885_1789_2901 370
442 3300053737 Ga0500601_004456 Ga0500601_004456_358_1470 370
443 3300003215 JGI25153J46596_10033807 JGI25153J46596_100338072 371
444 3300003771 Ga0055526_1034794 Ga0055526_10347941 371
445 3300003775 Ga0055524_1009043 Ga0055524_10090433 371
446 3300003781 Ga0055536_1005154 Ga0055536_10051543 371
447 3300003781 Ga0055536_1005502 Ga0055536_10055023 371
448 3300003790 Ga0055528_1004995 Ga0055528_10049954 371
449 3300003791 Ga0055530_10005315 Ga0055530_100053153 371
450 3300003791 Ga0055530_10006802 Ga0055530_100068024 371
451 3300003794 Ga0055531_10001173 Ga0055531_100011734 371
452 3300003794 Ga0055531_10001225 Ga0055531_100012255 371
453 3300003794 Ga0055531_10001520 Ga0055531_100015204 371
454 3300003794 Ga0055531_10020643 Ga0055531_100206433 371
455 3300005262 Ga0065165_1001209 Ga0065165_10012094 371
456 3300013102 Ga0157371_10032519 Ga0157371_100325194 371
457 3300025263 Ga0209565_1000387 Ga0209565_100038738 371
458 3300025273 Ga0209673_1000910 Ga0209673_100091025 371
459 3300025292 Ga0209676_1000171 Ga0209676_100017139 371
460 3300025292 Ga0209676_1000177 Ga0209676_100017783 371
461 3300025295 Ga0209564_1001157 Ga0209564_10011575 371
462 3300025297 Ga0209758_1003020 Ga0209758_10030204 371
463 3300025297 Ga0209758_1007492 Ga0209758_10074924 371
464 3300025298 Ga0209050_1000391 Ga0209050_100039143 371
465 3300025298 Ga0209050_1000496 Ga0209050_100049618 371
466 3300025299 Ga0209256_1002273 Ga0209256_100227312 371
467 3300025299 Ga0209256_1003175 Ga0209256_10031758 371
468 3300025303 Ga0209051_1006417 Ga0209051_10064172 371
469 3300025304 Ga0209257_1000224 Ga0209257_100022420 371
470 3300025304 Ga0209257_1000253 Ga0209257_100025394 371
471 3300025304 Ga0209257_1010517 Ga0209257_10105173 371
472 3300028794 Ga0307515_10035862 Ga0307515_100358624 371
473 3300028794 Ga0307515_10043180 Ga0307515_100431802 371
474 3300039437 Ga0436365_1447472 Ga0436365_1447472_84_1199 371
475 3300042533 Ga0450901_002437 Ga0450901_002437_794_1909 371
476 3300046453 Ga0495627_000282 Ga0495627_000282_49874_50989 371
477 3300046457 Ga0495590_0005337 Ga0495590_0005337_3428_4549 371
478 3300046460 Ga0495638_0000301 Ga0495638_0000301_56718_57833 371
479 3300046460 Ga0495638_0000370 Ga0495638_0000370_22877_24010 371
480 3300046460 Ga0495638_0001482 Ga0495638_0001482_8529_9644 371
481 3300046460 Ga0495638_0011153 Ga0495638_0011153_1071_2186 371
482 3300046460 Ga0495638_0018049 Ga0495638_0018049_1019_2134 371
483 3300046460 Ga0495638_0175700 Ga0495638_0175700_38_1153 371
484 3300046471 Ga0495650_0000068 Ga0495650_0000068_228548_229663 371
485 3300046501 Ga0495607_0046110 Ga0495607_0046110_1104_2219 371
486 3300046506 Ga0495583_0000002 Ga0495583_0000002_750620_751735 371
487 3300046512 Ga0495610_0000111 Ga0495610_0000111_30895_32010 371
488 3300046512 Ga0495610_0004129 Ga0495610_0004129_5357_6490 371
489 3300046512 Ga0495610_0007150 Ga0495610_0007150_2782_3897 371
490 3300046513 Ga0495616_0000143 Ga0495616_0000143_59073_60188 371
491 3300046513 Ga0495616_0050644 Ga0495616_0050644_44_1198 371
492 3300046515 Ga0495620_0022993 Ga0495620_0022993_512_1666 371
493 3300046518 Ga0495631_0001910 Ga0495631_0001910_8432_9565 371
494 3300046519 Ga0495632_0003546 Ga0495632_0003546_4270_5385 371
495 3300046519 Ga0495632_0036120 Ga0495632_0036120_433_1548 371
496 3300046520 Ga0495637_0008347 Ga0495637_0008347_3800_4915 371
497 3300046520 Ga0495637_0010923 Ga0495637_0010923_2431_3546 371
498 3300046530 Ga0495654_0000051 Ga0495654_0000051_107770_108885 371
499 3300046542 Ga0495597_0009340 Ga0495597_0009340_2908_4023 371
500 3300046542 Ga0495597_0028024 Ga0495597_0028024_1204_2337 371
501 3300046616 Ga0495668_0004266 Ga0495668_0004266_8196_9329 371
502 3300046616 Ga0495668_0051464 Ga0495668_0051464_1070_2185 371
503 3300046660 Ga0495625_0000198 Ga0495625_0000198_32340_33455 371
504 3300046660 Ga0495625_0003180 Ga0495625_0003180_3008_4123 371
505 3300046660 Ga0495625_0088461 Ga0495625_0088461_513_1628 371
506 3300046660 Ga0495625_0111912 Ga0495625_0111912_492_1646 371
507 3300046694 Ga0495649_0004201 Ga0495649_0004201_134_1258 371
508 3300046794 Ga0495589_0043923 Ga0495589_0043923_884_1999 371
509 3300046810 Ga0495660_0046690 Ga0495660_0046690_586_1701 371
510 3300047320 Ga0495672_0000541 Ga0495672_0000541_39700_40815 371
511 3300047323 Ga0495683_0025961 Ga0495683_0025961_495_1610 371
512 3300047446 Ga0495679_005277 Ga0495679_005277_263_1378 371
513 3300047469 Ga0495673_0000287 Ga0495673_0000287_32460_33575 371
514 3300047469 Ga0495673_0002888 Ga0495673_0002888_6233_7348 371
515 3300047472 Ga0495686_0000857 Ga0495686_0000857_25790_26923 371
516 3300047472 Ga0495686_0029607 Ga0495686_0029607_2013_3128 371
517 3300047472 Ga0495686_0031328 Ga0495686_0031328_433_1548 371
518 3300047472 Ga0495686_0059689 Ga0495686_0059689_26_1144 371
519 3300048910 Ga0496107_0000038 Ga0496107_0000038_34703_35821 371
520 3300048918 Ga0496115_0007923 Ga0496115_0007923_4422_5627 371
521 3300048918 Ga0496115_0070770 Ga0496115_0070770_1619_2734 371
522 3300048924 Ga0496121_0004382 Ga0496121_0004382_4904_6022 371
523 3300048927 Ga0496124_0101365 Ga0496124_0101365_1080_2198 371
524 3300048928 Ga0496125_0002919 Ga0496125_0002919_11483_12601 371
525 3300048928 Ga0496125_0033660 Ga0496125_0033660_256_1374 371
526 3300048929 Ga0496126_0053791 Ga0496126_0053791_1401_2519 371
527 3300049459 Ga0495678_000903 Ga0495678_000903_15689_16822 371
528 3300050516 nmdc:mga0sz30_15848_c1 nmdc:mga0sz30_15848_c1_1552_2670 371
529 3300053086 Ga0500578_0000070 Ga0500578_0000070_24740_25873 371
530 3300053102 Ga0500554_001713 Ga0500554_001713_1855_2970 371
531 3300053104 Ga0500556_0005519 Ga0500556_0005519_1987_3102 371
532 3300053108 Ga0500562_000896 Ga0500562_000896_3385_4506 371
533 3300053118 Ga0500594_0000120 Ga0500594_0000120_14665_15798 371
534 3300053119 Ga0500595_006197 Ga0500595_006197_3038_4213 371
535 3300053122 Ga0500608_000072 Ga0500608_000072_306_1424 371
536 3300053123 Ga0500614_003165 Ga0500614_003165_2416_3531 371
537 3300053125 Ga0500618_000918 Ga0500618_000918_13771_14886 371
538 3300053134 Ga0500658_0001583 Ga0500658_0001583_507_1622 371
539 3300053136 Ga0500559_0000304 Ga0500559_0000304_31438_32553 371
540 3300053136 Ga0500559_0001209 Ga0500559_0001209_8036_9154 371
541 3300053136 Ga0500559_0003432 Ga0500559_0003432_2054_3169 371
542 3300053142 Ga0500577_0013611 Ga0500577_0013611_148_1263 371
543 3300053153 Ga0500616_0039431 Ga0500616_0039431_1011_2165 371
544 3300053156 Ga0500622_0001700 Ga0500622_0001700_3407_4540 371
545 3300053156 Ga0500622_0014520 Ga0500622_0014520_139_1257 371
546 3300053156 Ga0500622_0026985 Ga0500622_0026985_237_1352 371
547 3300053730 Ga0500645_002263 Ga0500645_002263_7028_8143 371
548 3300053731 Ga0500609_000110 Ga0500609_000110_8542_9657 371
549 iso_pu_bacteria 2643221584 2643930778 371

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01946

Thi4

Thi4 family

27

80

0.92

PF00890

FAD_binding_2

FAD binding domain

38

87

0.91

PF01266

DAO

FAD dependent oxidoreductase

38

398

0.87

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

41

95

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dme-assembly1.cif.gz_B crystal structure of conserved exported protein from bordetella pertussis. northeast structural genomics target ber141 0.971 6 369
3dme-assembly1.cif.gz_B crystal structure of conserved exported protein from bordetella pertussis. northeast structural genomics target ber141 0.9632 6 369
3ado-assembly1.cif.gz_A crystal structure of the rabbit l-gulonate 3-dehydrogenase 0.9623 8 39
4b3h-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex 0.9602 9 38
2zya-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate 0.9446 7 37
ID Description Score Start End Superfamily
3lxdA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9803 8 41 3.50.50.60
1vkzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9716 9 35 3.40.50.20
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.964 8 369 3.50.50.60
4b3jB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9613 9 38 3.40.50.720
3dmeB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9605 6 369 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A519Q1P8-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9946 51 369 GO:0047545
AF-A0A4Q3TWP1-F1-model_v4 FAD-dependent oxidoreductase 0.9868 3 203 GO:0047545
AF-E0TE93-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9793 1 371 GO:0047545
AF-A0A4Q3TWP1-F1-model_v4 FAD-dependent oxidoreductase 0.9771 3 203 GO:0047545
AF-E0TE93-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9767 1 371 GO:0047545

Feature Viewer

pLDDT pTM Quality
94.23 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map