F462328

General Info

Members Datasets Scaffolds Average Seq Length
549 177 549 118

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_101569452|Ga0070696_1015694522
Length 116
Sequence VSEQPVLVLISCDPRHSGRAFEAMRIGVGIVAGENAVTFVLTGPAVHLLDAETDDLVDGDIAKFRENLKRLAIPFHVDRGSLPPDPDWNAEGHPVVPVTRDEISELVRAARRLIVF

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
104 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
105 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
106 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
107 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
113 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.73
Rhizosphere 99.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10116046 3300005295 Bacteria 2250
2 Ga0065707_10239192 3300005295 Bacteria 1161
3 Ga0068869_100097332 3300005334 Bacteria 2222
4 Ga0068869_100217534 3300005334 Bacteria 1513
5 Ga0070680_100040075 3300005336 Bacteria 3791
6 Ga0070680_100438654 3300005336 Bacteria 1115
7 Ga0070680_101061863 3300005336 Bacteria 700
8 Ga0070680_101370516 3300005336 Bacteria 612
9 Ga0070680_101410020 3300005336 Unclassified 603
10 Ga0070660_100304901 3300005339 Bacteria 1306
11 Ga0070691_10000885 3300005341 Bacteria 12151
12 Ga0070687_100807182 3300005343 Bacteria 665
13 Ga0070692_10023010 3300005345 Bacteria 3050
14 Ga0070669_100028862 3300005353 Bacteria 3997
15 Ga0070669_100515904 3300005353 Bacteria 993
16 Ga0070669_100691486 3300005353 Bacteria 861
17 Ga0070671_100860630 3300005355 Bacteria 791
18 Ga0070703_10015942 3300005406 Bacteria 2154
19 Ga0070701_11275704 3300005438 Bacteria 524
20 Ga0070705_100003128 3300005440 Bacteria 8135
21 Ga0070705_100371670 3300005440 Unclassified 1049
22 Ga0070705_100408744 3300005440 Bacteria 1007
23 Ga0070705_100799922 3300005440 Bacteria 750
24 Ga0070694_100017456 3300005444 Bacteria 4537
25 Ga0070694_100474994 3300005444 Bacteria 991
26 Ga0070694_100507138 3300005444 Bacteria 961
27 Ga0070694_100787154 3300005444 Bacteria 779
28 Ga0070708_100002329 3300005445 Bacteria 14699
29 Ga0070708_100017838 3300005445 Bacteria 5931
30 Ga0070708_100093316 3300005445 Bacteria 2744
31 Ga0070708_100776411 3300005445 Bacteria 901
32 Ga0070662_100267323 3300005457 Bacteria 1379
33 Ga0070681_10245487 3300005458 Bacteria 1703
34 Ga0068867_100079905 3300005459 Bacteria 2462
35 Ga0068867_100535841 3300005459 Bacteria 1012
36 Ga0068867_100691991 3300005459 Bacteria 899
37 Ga0070706_100050342 3300005467 Bacteria 3844
38 Ga0070706_100170999 3300005467 Bacteria 2029
39 Ga0070707_100000579 3300005468 Bacteria 36811
40 Ga0070707_100012309 3300005468 Bacteria 7987
41 Ga0070707_100265628 3300005468 Bacteria 1669
42 Ga0070707_101621198 3300005468 Bacteria 614
43 Ga0070698_100038920 3300005471 Bacteria 4899
44 Ga0070699_100000936 3300005518 Bacteria 27208
45 Ga0070697_100044912 3300005536 Bacteria 3579
46 Ga0070697_100059129 3300005536 Bacteria 3120
47 Ga0070697_100106514 3300005536 Bacteria 2332
48 Ga0070697_100379093 3300005536 Bacteria 1225
49 Ga0070697_100504697 3300005536 Unclassified 1058
50 Ga0070697_100724471 3300005536 Bacteria 878
51 Ga0070697_101093555 3300005536 Bacteria 709
52 Ga0070697_101464490 3300005536 Unclassified 610
53 Ga0070672_100007790 3300005543 Bacteria 7307
54 Ga0070672_100302379 3300005543 Unclassified 1356
55 Ga0070695_100035672 3300005545 Bacteria 3124
56 Ga0070695_100064210 3300005545 Bacteria 2388
57 Ga0070696_100067021 3300005546 Bacteria 2519
58 Ga0070696_100532146 3300005546 Bacteria 939
59 Ga0070696_101204744 3300005546 Unclassified 640
60 Ga0070696_101569452 3300005546 Bacteria 565
61 Ga0070693_100318759 3300005547 Unclassified 1054
62 Ga0070704_100038552 3300005549 Bacteria 3274
63 Ga0070704_100089318 3300005549 Bacteria 2292
64 Ga0070704_100113753 3300005549 Bacteria 2064
65 Ga0070704_100223925 3300005549 Bacteria 1531
66 Ga0070704_100498261 3300005549 Bacteria 1056
67 Ga0070704_101416272 3300005549 Bacteria 638
68 Ga0068854_101487781 3300005578 Bacteria 614
69 Ga0068859_101949462 3300005617 Bacteria 649
70 Ga0068866_10556680 3300005718 Bacteria 768
71 Ga0068861_100912606 3300005719 Bacteria 833
72 Ga0068861_101835464 3300005719 Unclassified 602
73 Ga0068863_100087045 3300005841 Bacteria 2960
74 Ga0068860_100687068 3300005843 Bacteria 1033
75 Ga0068860_100881197 3300005843 Bacteria 911
76 Ga0068862_100625520 3300005844 Unclassified 1036
77 Ga0068862_101354887 3300005844 Bacteria 714
78 Ga0081455_10670157 3300005937 Unclassified 665
79 Ga0081455_10772685 3300005937 Bacteria 605
80 Ga0081540_1201101 3300005983 Bacteria 724
81 Ga0081539_10000002 3300005985 Bacteria 601032
82 Ga0070716_100640688 3300006173 Bacteria 804
83 Ga0075428_100000032 3300006844 Bacteria 118320
84 Ga0075428_100001207 3300006844 Bacteria 27623
85 Ga0075428_100003481 3300006844 Bacteria 17227
86 Ga0075428_100030338 3300006844 Bacteria 5980
87 Ga0075428_100049588 3300006844 Bacteria 4606
88 Ga0075428_100084930 3300006844 Bacteria 3453
89 Ga0075428_100318646 3300006844 Archaea 1671
90 Ga0075428_100323382 3300006844 Bacteria 1657
91 Ga0075428_100693812 3300006844 Bacteria 1085
92 Ga0075430_100000097 3300006846 Bacteria 51729
93 Ga0075430_100004723 3300006846 Bacteria 11456
94 Ga0075430_100033122 3300006846 Bacteria 4386
95 Ga0075430_100048444 3300006846 Bacteria 3588
96 Ga0075430_100062076 3300006846 Bacteria 3140
97 Ga0075431_100000049 3300006847 Bacteria 63960
98 Ga0075431_100000199 3300006847 Bacteria 44112
99 Ga0075431_100000537 3300006847 Bacteria 31847
100 Ga0075431_100004054 3300006847 Bacteria 14277
101 Ga0075431_100043133 3300006847 Bacteria 4655
102 Ga0075431_100046220 3300006847 Bacteria 4489
103 Ga0075431_100088257 3300006847 Bacteria 3200
104 Ga0075431_100112266 3300006847 Bacteria 2813
105 Ga0075431_100287089 3300006847 Bacteria 1665
106 Ga0075431_100314244 3300006847 Bacteria 1581
107 Ga0075431_100413305 3300006847 Bacteria 1349
108 Ga0075433_10000995 3300006852 Bacteria 20128
109 Ga0075433_10008986 3300006852 Bacteria 7980
110 Ga0075433_10011320 3300006852 Bacteria 7180
111 Ga0075433_10035944 3300006852 Bacteria 4264
112 Ga0075433_10044878 3300006852 Bacteria 3841
113 Ga0075433_10094874 3300006852 Bacteria 2640
114 Ga0075433_10101488 3300006852 Bacteria 2548
115 Ga0075433_10342586 3300006852 Bacteria 1321
116 Ga0075433_11066938 3300006852 Bacteria 703
117 Ga0075434_100002030 3300006871 Bacteria 17571
118 Ga0075434_100006385 3300006871 Bacteria 10806
119 Ga0075434_100022423 3300006871 Bacteria 6150
120 Ga0075434_100032218 3300006871 Bacteria 5167
121 Ga0075434_100052936 3300006871 Bacteria 4034
122 Ga0075434_100122180 3300006871 Bacteria 2620
123 Ga0075434_100154124 3300006871 Bacteria 2318
124 Ga0075434_100211205 3300006871 Bacteria 1961
125 Ga0075434_100237837 3300006871 Bacteria 1841
126 Ga0075434_100256782 3300006871 Bacteria 1766
127 Ga0075434_100432986 3300006871 Bacteria 1336
128 Ga0075434_100480371 3300006871 Bacteria 1264
129 Ga0075434_101264962 3300006871 Unclassified 749
130 Ga0075434_102397948 3300006871 Bacteria 530
131 Ga0075429_100000032 3300006880 Bacteria 64062
132 Ga0075429_100003383 3300006880 Bacteria 13598
133 Ga0075429_100007768 3300006880 Bacteria 9313
134 Ga0075429_100017245 3300006880 Bacteria 6246
135 Ga0075429_100017803 3300006880 Bacteria 6145
136 Ga0075429_100024639 3300006880 Bacteria 5222
137 Ga0075429_100082940 3300006880 Bacteria 2795
138 Ga0075429_100487455 3300006880 Unclassified 1080
139 Ga0075429_100880069 3300006880 Archaea 784
140 Ga0075429_101343521 3300006880 Bacteria 623
141 Ga0068865_100733625 3300006881 Bacteria 847
142 Ga0075436_100013559 3300006914 Bacteria 5582
143 Ga0075436_100024487 3300006914 Bacteria 4149
144 Ga0075436_100620467 3300006914 Bacteria 797
145 Ga0075436_100701818 3300006914 Bacteria 749
146 Ga0097620_101949475 3300006931 Bacteria 649
147 Ga0075435_100013384 3300007076 Bacteria 6100
148 Ga0075435_100017458 3300007076 Bacteria 5434
149 Ga0075435_100098971 3300007076 Bacteria 2414
150 Ga0075435_100101652 3300007076 Bacteria 2382
151 Ga0075435_100101673 3300007076 Bacteria 2382
152 Ga0075435_100122298 3300007076 Bacteria 2173
153 Ga0075435_100172976 3300007076 Bacteria 1823
154 Ga0075435_100178381 3300007076 Bacteria 1795
155 Ga0075435_100195029 3300007076 Bacteria 1715
156 Ga0075435_100993552 3300007076 Bacteria 733
157 Ga0075435_102048792 3300007076 Bacteria 502
158 Ga0099794_10004439 3300007265 Bacteria 5516
159 Ga0099794_10141320 3300007265 Unclassified 1219
160 Ga0099794_10308333 3300007265 Bacteria 820
161 Ga0111539_10004676 3300009094 Bacteria 17886
162 Ga0111539_10005166 3300009094 Bacteria 16919
163 Ga0111539_10050238 3300009094 Bacteria 4968
164 Ga0111539_10220806 3300009094 Bacteria 2207
165 Ga0111539_10964241 3300009094 Bacteria 991
166 Ga0111539_11413892 3300009094 Bacteria 807
167 Ga0105245_11949603 3300009098 Bacteria 641
168 Ga0114129_10000037 3300009147 Bacteria 108744
169 Ga0114129_10000462 3300009147 Bacteria 48711
170 Ga0114129_10000721 3300009147 Bacteria 41915
171 Ga0114129_10001856 3300009147 Bacteria 28790
172 Ga0114129_10003163 3300009147 Bacteria 23097
173 Ga0114129_10003609 3300009147 Bacteria 21765
174 Ga0114129_10003767 3300009147 Bacteria 21378
175 Ga0114129_10018018 3300009147 Bacteria 10058
176 Ga0114129_10031014 3300009147 Bacteria 7561
177 Ga0114129_10059209 3300009147 Bacteria 5356
178 Ga0114129_10098332 3300009147 Bacteria 4051
179 Ga0114129_10129440 3300009147 Bacteria 3469
180 Ga0114129_10150998 3300009147 Archaea 3179
181 Ga0114129_10304364 3300009147 Bacteria 2123
182 Ga0114129_10549189 3300009147 Unclassified 1502
183 Ga0114129_10675050 3300009147 Bacteria 1331
184 Ga0114129_10769413 3300009147 Bacteria 1231
185 Ga0114129_10876111 3300009147 Bacteria 1139
186 Ga0114129_11007348 3300009147 Bacteria 1049
187 Ga0114129_12108018 3300009147 Bacteria 680
188 Ga0114129_12425624 3300009147 Unclassified 628
189 Ga0105243_11337035 3300009148 Bacteria 735
190 Ga0105243_11813417 3300009148 Bacteria 641
191 Ga0105241_10363757 3300009174 Bacteria 1259
192 Ga0105242_10119145 3300009176 Bacteria 2262
193 Ga0105249_11992021 3300009553 Bacteria 653
194 Ga0157378_10177851 3300013297 Bacteria 2000
195 Ga0157378_10230383 3300013297 Bacteria 1765
196 Ga0163162_10008310 3300013306 Bacteria 10127
197 Ga0157375_10203424 3300013308 Bacteria 2136
198 Ga0157380_10113841 3300014326 Bacteria 2278
199 Ga0157376_11563272 3300014969 Bacteria 693
200 Ga0207653_10039069 3300025885 Bacteria 1553
201 Ga0207642_10175823 3300025899 Unclassified 1162
202 Ga0207684_10000105 3300025910 Bacteria 160905
203 Ga0207684_10029967 3300025910 Bacteria 4632
204 Ga0207684_10060912 3300025910 Bacteria 3205
205 Ga0207684_10089306 3300025910 Bacteria 2626
206 Ga0207684_10911428 3300025910 Unclassified 739
207 Ga0207654_10327058 3300025911 Bacteria 1049
208 Ga0207707_10488993 3300025912 Bacteria 1050
209 Ga0207707_11542432 3300025912 Bacteria 525
210 Ga0207660_10013639 3300025917 Bacteria 5328
211 Ga0207660_10766115 3300025917 Unclassified 788
212 Ga0207660_10990006 3300025917 Bacteria 686
213 Ga0207657_10318399 3300025919 Bacteria 1230
214 Ga0207646_10000893 3300025922 Bacteria 38454
215 Ga0207646_10031099 3300025922 Bacteria 4834
216 Ga0207646_10290698 3300025922 Bacteria 1477
217 Ga0207646_10504268 3300025922 Bacteria 1090
218 Ga0207646_11199545 3300025922 Unclassified 665
219 Ga0207681_10013093 3300025923 Bacteria 5128
220 Ga0207681_10520864 3300025923 Bacteria 976
221 Ga0207644_10543067 3300025931 Bacteria 962
222 Ga0207706_10142244 3300025933 Bacteria 2110
223 Ga0207706_10767352 3300025933 Bacteria 821
224 Ga0207686_10230385 3300025934 Bacteria 1343
225 Ga0207709_10608852 3300025935 Bacteria 866
226 Ga0207709_11195525 3300025935 Bacteria 626
227 Ga0207670_10455736 3300025936 Bacteria 1032
228 Ga0207670_10852828 3300025936 Bacteria 761
229 Ga0207704_10861640 3300025938 Bacteria 760
230 Ga0207665_11099262 3300025939 Bacteria 634
231 Ga0207691_10013662 3300025940 Bacteria 7759
232 Ga0207689_10051634 3300025942 Bacteria 3389
233 Ga0207712_12010619 3300025961 Bacteria 517
234 Ga0207703_12095271 3300026035 Bacteria 542
235 Ga0207641_10365248 3300026088 Bacteria 1379
236 Ga0207648_10025762 3300026089 Bacteria 5235
237 Ga0207648_10516534 3300026089 Bacteria 1094
238 Ga0207648_12262037 3300026089 Bacteria 504
239 Ga0207675_100200698 3300026118 Bacteria 1916
240 Ga0207675_100300371 3300026118 Unclassified 1564
241 Ga0207675_101796628 3300026118 Unclassified 632
242 Ga0209999_1084959 3300027543 Bacteria 612
243 Ga0209983_1031828 3300027665 Archaea 1126
244 Ga0209588_1007150 3300027671 Bacteria 3272
245 Ga0209588_1009054 3300027671 Bacteria 2965
246 Ga0209588_1243302 3300027671 Bacteria 551
247 Ga0209971_1031698 3300027682 Archaea 1268
248 Ga0207428_10231278 3300027907 Bacteria 1383
249 Ga0207428_10262722 3300027907 Unclassified 1285
250 Ga0268265_10218193 3300028380 Bacteria 1667
251 Ga0268265_10820568 3300028380 Unclassified 908
252 Ga0268265_11160159 3300028380 Bacteria 769
253 Ga0268264_10021604 3300028381 Bacteria 5255
254 Ga0268264_11628406 3300028381 Bacteria 656
255 Ga0307408_100012526 3300031548 Bacteria 5621
256 Ga0307408_100029300 3300031548 Bacteria 3812
257 Ga0307408_100047382 3300031548 Bacteria 3078
258 Ga0307408_100297555 3300031548 Bacteria 1350
259 Ga0307405_10407475 3300031731 Bacteria 1066
260 Ga0307405_10603935 3300031731 Bacteria 896
261 Ga0307413_10501032 3300031824 Bacteria 975
262 Ga0307406_10191757 3300031901 Bacteria 1497
263 Ga0307406_10426371 3300031901 Bacteria 1058
264 Ga0307407_10948802 3300031903 Bacteria 662
265 Ga0307412_10046165 3300031911 Bacteria 2853
266 Ga0307412_10973366 3300031911 Bacteria 748
267 Ga0307412_11775944 3300031911 Bacteria 567
268 Ga0307409_100103118 3300031995 Bacteria 2372
269 Ga0307409_100336831 3300031995 Bacteria 1418
270 Ga0307409_100712546 3300031995 Bacteria 1004
271 Ga0307416_100049139 3300032002 Bacteria 3352
272 Ga0307416_100319966 3300032002 Bacteria 1553
273 Ga0307416_100528526 3300032002 Bacteria 1249
274 Ga0307416_101325318 3300032002 Bacteria 826
275 Ga0307416_102403401 3300032002 Unclassified 626
276 Ga0307414_12248465 3300032004 Unclassified 509
277 Ga0307411_10270315 3300032005 Bacteria 1347
278 Ga0307411_10354564 3300032005 Bacteria 1197
279 Ga0307415_100600716 3300032126 Bacteria 979
280 Ga0307415_100732596 3300032126 Bacteria 896
281 Ga0373950_0128862 3300034818 Unclassified 565
282 Ga0373929_0104202 3300035085 Bacteria 718
283 Ga0373940_0008284 3300035088 Bacteria 2379
284 Ga0373940_0011240 3300035088 Bacteria 2124
285 Ga0373940_0154426 3300035088 Bacteria 733
286 Ga0373949_0009489 3300035090 Bacteria 2132
287 Ga0373949_0025729 3300035090 Bacteria 1375
288 Ga0373952_0057462 3300035092 Bacteria 943
289 Ga0373932_0086585 3300035112 Bacteria 999
290 Ga0373939_0053324 3300035114 Bacteria 1263
291 Ga0373941_0013329 3300035115 Bacteria 2171
292 Ga0373960_0046131 3300035121 Bacteria 1278
293 Ga0373942_0037080 3300035207 Bacteria 1316
294 Ga0373961_0252304 3300035241 Unclassified 639
295 Ga0373962_0007886 3300035242 Bacteria 2613
296 Ga0373962_0071984 3300035242 Bacteria 1035
297 Ga0373931_0013964 3300035691 Bacteria 3919
298 Ga0373931_0045895 3300035691 Bacteria 2308
299 Ga0395899_0028364 3300037312 Bacteria 4216
300 Ga0395900_0008541 3300037418 Bacteria 10528
301 Ga0395900_0849990 3300037418 Bacteria 838
302 Ga0395898_0024916 3300037466 Bacteria 6031
303 Ga0395905_0025786 3300037471 Bacteria 5542
304 Ga0395905_0559679 3300037471 Bacteria 1045
305 Ga0395905_1546703 3300037471 Bacteria 568
306 Ga0395901_0003798 3300038443 Bacteria 15216
307 Ga0395901_0573403 3300038443 Bacteria 1141
308 Ga0242420_070326 3300038996 Bacteria 710
309 Ga0451577_0047771 3300042876 Bacteria 3826
310 Ga0451577_0342284 3300042876 Bacteria 1356
311 Ga0453683_0125685 3300044673 Bacteria 1615
312 Ga0453683_0170085 3300044673 Bacteria 1380
313 Ga0453683_0234315 3300044673 Bacteria 1168
314 Ga0453683_0296561 3300044673 Bacteria 1034
315 Ga0451576_1233416 3300045051 Bacteria 780
316 Ga0451576_1933233 3300045051 Bacteria 608
317 Ga0495603_0148869 3300046455 Bacteria 1360
318 Ga0495580_0002331 3300046472 Bacteria 16573
319 Ga0495594_0391081 3300046499 Bacteria 791
320 Ga0495642_0099976 3300046528 Bacteria 1234
321 Ga0495642_0257545 3300046528 Bacteria 763
322 Ga0495654_0314778 3300046530 Bacteria 636
323 Ga0495622_0426928 3300046557 Bacteria 569
324 Ga0495656_0628253 3300046615 Bacteria 576
325 Ga0495659_0121467 3300046664 Bacteria 1029
326 Ga0495669_0122108 3300046684 Bacteria 1221
327 Ga0495669_0149870 3300046684 Bacteria 1104
328 Ga0495670_0448850 3300046691 Bacteria 699
329 Ga0495636_0056028 3300047318 Bacteria 1659
330 Ga0495636_0089673 3300047318 Bacteria 1334
331 Ga0496102_0050522 3300048905 Bacteria 3786
332 Ga0496102_0333446 3300048905 Bacteria 1429
333 Ga0496103_0043481 3300048906 Bacteria 2766
334 Ga0496106_0258410 3300048909 Bacteria 1393
335 Ga0501298_133437 3300049521 Bacteria 595
336 Ga0501032_0926084 3300049569 Unclassified 548
337 Ga0501036_0247102 3300049572 Bacteria 1495
338 Ga0501036_0271798 3300049572 Bacteria 1419
339 Ga0501036_0915441 3300049572 Unclassified 719
340 Ga0501036_1062754 3300049572 Unclassified 662
341 Ga0501036_1206554 3300049572 Unclassified 616
342 Ga0501036_1559025 3300049572 Bacteria 534
343 Ga0501038_0246795 3300049574 Bacteria 1416
344 Ga0501038_1007605 3300049574 Unclassified 611
345 Ga0501039_0096051 3300049575 Bacteria 2311
346 Ga0501039_0523090 3300049575 Unclassified 931
347 Ga0501039_0905324 3300049575 Bacteria 687
348 Ga0501040_0011893 3300049576 Bacteria 5694
349 Ga0501040_0043489 3300049576 Bacteria 3062
350 Ga0501040_0046375 3300049576 Bacteria 2967
351 Ga0501040_0280406 3300049576 Bacteria 1190
352 Ga0501040_0718493 3300049576 Unclassified 723
353 Ga0501041_0174437 3300049577 Bacteria 1345
354 Ga0501041_0550699 3300049577 Bacteria 735
355 Ga0501042_0068209 3300049578 Bacteria 2543
356 Ga0501042_0099401 3300049578 Bacteria 2092
357 Ga0501042_0333941 3300049578 Bacteria 1096
358 Ga0501042_0381109 3300049578 Bacteria 1021
359 Ga0501042_0677101 3300049578 Bacteria 750
360 Ga0501043_0110086 3300049579 Bacteria 2163
361 Ga0501043_1258449 3300049579 Unclassified 518
362 Ga0501046_0618361 3300049580 Bacteria 768
363 Ga0501046_0869155 3300049580 Bacteria 630
364 Ga0501046_1100139 3300049580 Bacteria 549
365 Ga0501048_0030366 3300049582 Bacteria 3910
366 Ga0501048_0155057 3300049582 Bacteria 1620
367 Ga0501048_0182381 3300049582 Bacteria 1488
368 Ga0501048_0497198 3300049582 Unclassified 874
369 Ga0501048_0634425 3300049582 Bacteria 767
370 Ga0501067_0021287 3300049583 Bacteria 3588
371 Ga0501067_0261628 3300049583 Bacteria 963
372 Ga0501068_0074051 3300049584 Bacteria 2081
373 Ga0501068_0117865 3300049584 Unclassified 1654
374 Ga0501068_0299224 3300049584 Bacteria 1030
375 Ga0501068_0468155 3300049584 Bacteria 816
376 Ga0501068_0574374 3300049584 Unclassified 734
377 Ga0501068_1054824 3300049584 Bacteria 537
378 Ga0501069_0123725 3300049585 Unclassified 1478
379 Ga0501071_0583286 3300049587 Bacteria 859
380 Ga0501071_0610449 3300049587 Bacteria 839
381 Ga0501071_1147573 3300049587 Unclassified 600
382 Ga0501072_0016727 3300049588 Bacteria 5635
383 Ga0501072_0045337 3300049588 Bacteria 3457
384 Ga0501072_0082245 3300049588 Bacteria 2553
385 Ga0501072_0188986 3300049588 Bacteria 1643
386 Ga0501072_0272863 3300049588 Bacteria 1345
387 Ga0501072_0502314 3300049588 Bacteria 959
388 Ga0501072_0613842 3300049588 Bacteria 857
389 Ga0501072_0753973 3300049588 Bacteria 764
390 Ga0501073_0099441 3300049589 Bacteria 2020
391 Ga0501073_1075211 3300049589 Bacteria 553
392 Ga0501074_0167030 3300049590 Bacteria 1571
393 Ga0501074_0214429 3300049590 Bacteria 1371
394 Ga0501074_1219400 3300049590 Unclassified 528
395 Ga0501075_0005703 3300049591 Bacteria 8521
396 Ga0501075_0019688 3300049591 Bacteria 4898
397 Ga0501075_0027285 3300049591 Bacteria 4208
398 Ga0501075_0033504 3300049591 Bacteria 3822
399 Ga0501075_0100208 3300049591 Bacteria 2200
400 Ga0501075_0148505 3300049591 Bacteria 1787
401 Ga0501075_0330753 3300049591 Bacteria 1161
402 Ga0501075_0332725 3300049591 Bacteria 1157
403 Ga0501075_0372039 3300049591 Bacteria 1089
404 Ga0501075_0718754 3300049591 Unclassified 761
405 Ga0501075_1499257 3300049591 Bacteria 510
406 Ga0501076_0003954 3300049592 Bacteria 10462
407 Ga0501076_0071935 3300049592 Bacteria 2767
408 Ga0501076_0075757 3300049592 Bacteria 2697
409 Ga0501076_0201575 3300049592 Bacteria 1625
410 Ga0501076_0259201 3300049592 Bacteria 1423
411 Ga0501076_0330017 3300049592 Bacteria 1251
412 Ga0501076_1145844 3300049592 Bacteria 640
413 Ga0501076_1346582 3300049592 Bacteria 587
414 Ga0501077_0002879 3300049593 Bacteria 10317
415 Ga0501077_0058715 3300049593 Bacteria 2442
416 Ga0501079_0014479 3300049741 Bacteria 6014
417 Ga0501079_0023834 3300049741 Bacteria 4696
418 Ga0501079_0101744 3300049741 Bacteria 2228
419 Ga0501079_0431380 3300049741 Bacteria 1035
420 Ga0501079_0803867 3300049741 Bacteria 740
421 Ga0501079_0894843 3300049741 Unclassified 699
422 Ga0501080_0225287 3300049742 Bacteria 1715
423 Ga0501080_0941607 3300049742 Bacteria 751
424 Ga0501080_1733779 3300049742 Bacteria 526
425 Ga0501081_0002533 3300049743 Bacteria 11520
426 Ga0501081_0016853 3300049743 Bacteria 4829
427 Ga0501081_0034421 3300049743 Bacteria 3447
428 Ga0501081_0044069 3300049743 Bacteria 3062
429 Ga0501081_0084798 3300049743 Bacteria 2223
430 Ga0501081_0086317 3300049743 Bacteria 2203
431 Ga0501081_0090723 3300049743 Bacteria 2148
432 Ga0501081_0133400 3300049743 Bacteria 1776
433 Ga0501081_0196431 3300049743 Bacteria 1462
434 Ga0501081_0365205 3300049743 Bacteria 1065
435 Ga0501083_0081443 3300049744 Bacteria 2146
436 Ga0501083_0664241 3300049744 Bacteria 678
437 Ga0501045_0027035 3300049824 Bacteria 4131
438 Ga0501045_0069636 3300049824 Bacteria 2587
439 Ga0501045_0206262 3300049824 Bacteria 1464
440 Ga0501045_0334914 3300049824 Bacteria 1126
441 Ga0501045_0543236 3300049824 Bacteria 862
442 Ga0501045_0757735 3300049824 Bacteria 715
443 nmdc:mga05p37_1052835_c1 3300050507 Bacteria 858
444 nmdc:mga05p37_1107075_c1 3300050507 Archaea 829
445 nmdc:mga05p37_1222588_c1 3300050507 Unclassified 774
446 nmdc:mga05p37_1222_c1 3300050507 Bacteria 29364
447 nmdc:mga05p37_1241360_c1 3300050507 Bacteria 766
448 nmdc:mga05p37_13279_c1 3300050507 Bacteria 9862
449 nmdc:mga05p37_162689_c1 3300050507 Bacteria 2725
450 nmdc:mga05p37_23764_c1 3300050507 Bacteria 7443
451 nmdc:mga05p37_24618_c1 3300050507 Bacteria 7317
452 nmdc:mga05p37_323_c1 3300050507 Bacteria 50943
453 nmdc:mga05p37_35190_c1 3300050507 Bacteria 6140
454 nmdc:mga05p37_43830_c1 3300050507 Bacteria 5505
455 nmdc:mga05p37_485885_c1 3300050507 Bacteria 1421
456 nmdc:mga05p37_618276_c1 3300050507 Bacteria 1220
457 nmdc:mga05p37_66520_c1 3300050507 Bacteria 4433
458 nmdc:mga05p37_6_c1 3300050507 Bacteria 155503
459 nmdc:mga05p37_84_c1 3300050507 Bacteria 83805
460 nmdc:mga05p37_858467_c1 3300050507 Unclassified 985
461 nmdc:mga05p37_923932_c1 3300050507 Bacteria 938
462 nmdc:mga09592_118163_c1 3300050508 Bacteria 2276
463 nmdc:mga09592_1536_c1 3300050508 Bacteria 18593
464 nmdc:mga09592_190810_c1 3300050508 Bacteria 1774
465 nmdc:mga09592_20401_c1 3300050508 Bacteria 5448
466 nmdc:mga09592_3621_c1 3300050508 Bacteria 12465
467 nmdc:mga09592_37501_c1 3300050508 Bacteria 4066
468 nmdc:mga09592_774378_c1 3300050508 Bacteria 813
469 nmdc:mga09592_80268_c1 3300050508 Bacteria 2778
470 nmdc:mga09592_9634_c1 3300050508 Bacteria 7849
471 nmdc:mga0qj67_1099_c1 3300050509 Bacteria 18741
472 nmdc:mga0qj67_112572_c1 3300050509 Bacteria 2197
473 nmdc:mga0qj67_228266_c1 3300050509 Bacteria 1511
474 nmdc:mga0qj67_35096_c1 3300050509 Bacteria 3920
475 nmdc:mga0qj67_53029_c1 3300050509 Bacteria 3210
476 nmdc:mga0qj67_57878_c1 3300050509 Bacteria 3073
477 nmdc:mga0qj67_678_c1 3300050509 Bacteria 23197
478 nmdc:mga06r32_1058497_c1 3300050510 Unclassified 762
479 nmdc:mga06r32_108639_c1 3300050510 Bacteria 2727
480 nmdc:mga06r32_268980_c1 3300050510 Bacteria 1692
481 nmdc:mga06r32_28275_c1 3300050510 Bacteria 5244
482 nmdc:mga06r32_2918_c1 3300050510 Bacteria 15336
483 nmdc:mga06r32_460336_c1 3300050510 Bacteria 1251
484 nmdc:mga06r32_479_c1 3300050510 Bacteria 34392
485 nmdc:mga06r32_498963_c1 3300050510 Bacteria 1194
486 nmdc:mga06r32_551399_c1 3300050510 Archaea 1127
487 nmdc:mga06r32_614587_c1 3300050510 Bacteria 1057
488 nmdc:mga06r32_6345_c1 3300050510 Bacteria 10624
489 nmdc:mga06r32_79678_c1 3300050510 Bacteria 3186
490 nmdc:mga08y16_126165_c1 3300050511 Bacteria 2662
491 nmdc:mga08y16_1461994_c1 3300050511 Bacteria 645
492 nmdc:mga08y16_190_c1 3300050511 Bacteria 55016
493 nmdc:mga08y16_28274_c1 3300050511 Bacteria 5910
494 nmdc:mga08y16_8086_c1 3300050511 Bacteria 11004
495 nmdc:mga0n895_100_c1 3300050512 Bacteria 50742
496 nmdc:mga0n895_15575_c1 3300050512 Bacteria 6940
497 nmdc:mga0n895_261052_c1 3300050512 Bacteria 1758
498 nmdc:mga0n895_272475_c1 3300050512 Unclassified 1717
499 nmdc:mga0n895_28975_c1 3300050512 Bacteria 5275
500 nmdc:mga0n895_324038_c1 3300050512 Bacteria 1561
501 nmdc:mga0n895_356377_c1 3300050512 Bacteria 1482
502 nmdc:mga0n895_61979_c1 3300050512 Bacteria 3694
503 nmdc:mga0n895_854236_c1 3300050512 Bacteria 898
504 nmdc:mga0n895_863110_c1 3300050512 Bacteria 892
505 nmdc:mga0rr50_127767_c1 3300050513 Bacteria 2031
506 nmdc:mga0rr50_1463981_c1 3300050513 Bacteria 578
507 nmdc:mga0rr50_171358_c1 3300050513 Bacteria 1769
508 nmdc:mga0rr50_230856_c1 3300050513 Bacteria 1531
509 nmdc:mga0rr50_2838_c1 3300050513 Bacteria 9854
510 nmdc:mga0rr50_295203_c1 3300050513 Bacteria 1355
511 nmdc:mga0rr50_43033_c1 3300050513 Bacteria 3302
512 nmdc:mga0rr50_734736_c1 3300050513 Bacteria 842
513 nmdc:mga0rr50_91000_c1 3300050513 Bacteria 2375
514 nmdc:mga08x19_1185_c1 3300050514 Bacteria 16338
515 nmdc:mga08x19_14665_c2 3300050514 Bacteria 2238
516 nmdc:mga08x19_176070_c1 3300050514 Bacteria 1459
517 nmdc:mga0a205_101538_c1 3300050515 Bacteria 2775
518 nmdc:mga0a205_13310_c1 3300050515 Bacteria 7652
519 nmdc:mga0a205_19701_c1 3300050515 Bacteria 6365
520 nmdc:mga0a205_240642_c1 3300050515 Bacteria 1691
521 nmdc:mga0a205_251334_c1 3300050515 Bacteria 1647
522 nmdc:mga0a205_36860_c1 3300050515 Bacteria 4701
523 nmdc:mga0a205_6433_c1 3300050515 Bacteria 10620
524 nmdc:mga0a205_811715_c1 3300050515 Bacteria 783
525 nmdc:mga0a205_8521_c1 3300050515 Bacteria 9324
526 nmdc:mga0a205_9259_c1 3300050515 Bacteria 8995
527 nmdc:mga0a205_95103_c1 3300050515 Bacteria 2878
528 nmdc:mga0a205_986200_c1 3300050515 Bacteria 689
529 Ga0501084_0026136 3300054114 Bacteria 4870
530 Ga0501084_0033882 3300054114 Bacteria 4271
531 Ga0501084_0038002 3300054114 Bacteria 4024
532 Ga0501084_0095740 3300054114 Bacteria 2493
533 Ga0501084_0147660 3300054114 Bacteria 1981
534 Ga0501084_0150910 3300054114 Bacteria 1959
535 Ga0501084_1289253 3300054114 Bacteria 612
536 Ga0590071_202747 3300059421 Bacteria 522
537 Ga0501082_0015365 3300060353 Bacteria 6588
538 Ga0501082_0021304 3300060353 Bacteria 5592
539 Ga0501082_0026993 3300060353 Bacteria 4947
540 Ga0501082_0055193 3300060353 Bacteria 3423
541 Ga0501082_1331112 3300060353 Bacteria 627
542 Ga0530510_0058183 3300061734 Bacteria 2795
543 Ga0530510_0164641 3300061734 Bacteria 1641
544 Ga0530510_0269758 3300061734 Bacteria 1270
545 Ga0530510_0305714 3300061734 Bacteria 1190
546 Ga0530510_0484372 3300061734 Unclassified 937
547 Ga0530510_0662222 3300061734 Unclassified 795
548 Ga0530510_1053859 3300061734 Unclassified 623
549 Ga0530510_1087585 3300061734 Bacteria 612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100097332 Ga0068869_1000973325 112
2 3300005341 Ga0070691_10000885 Ga0070691_100008853 112
3 3300005345 Ga0070692_10023010 Ga0070692_100230105 112
4 3300005353 Ga0070669_100515904 Ga0070669_1005159042 112
5 3300005406 Ga0070703_10015942 Ga0070703_100159423 112
6 3300005444 Ga0070694_100017456 Ga0070694_1000174565 112
7 3300005445 Ga0070708_100776411 Ga0070708_1007764112 112
8 3300005549 Ga0070704_100498261 Ga0070704_1004982612 112
9 3300005843 Ga0068860_100687068 Ga0068860_1006870682 112
10 3300006881 Ga0068865_100733625 Ga0068865_1007336252 112
11 3300009176 Ga0105242_10119145 Ga0105242_101191454 112
12 3300025885 Ga0207653_10039069 Ga0207653_100390691 112
13 3300025934 Ga0207686_10230385 Ga0207686_102303851 112
14 3300025935 Ga0207709_10608852 Ga0207709_106088522 112
15 3300025936 Ga0207670_10852828 Ga0207670_108528282 112
16 3300025938 Ga0207704_10861640 Ga0207704_108616402 112
17 3300025939 Ga0207665_11099262 Ga0207665_110992622 112
18 3300025942 Ga0207689_10051634 Ga0207689_100516345 112
19 3300005546 Ga0070696_101569452 Ga0070696_1015694522 116
20 3300005440 Ga0070705_100371670 Ga0070705_1003716702 117
21 3300005445 Ga0070708_100002329 Ga0070708_10000232913 117
22 3300005445 Ga0070708_100093316 Ga0070708_1000933165 117
23 3300005468 Ga0070707_100000579 Ga0070707_10000057916 117
24 3300005468 Ga0070707_100265628 Ga0070707_1002656284 117
25 3300005471 Ga0070698_100038920 Ga0070698_1000389201 117
26 3300005518 Ga0070699_100000936 Ga0070699_10000093624 117
27 3300005536 Ga0070697_100044912 Ga0070697_1000449126 117
28 3300005536 Ga0070697_100059129 Ga0070697_1000591295 117
29 3300005536 Ga0070697_100504697 Ga0070697_1005046972 117
30 3300005536 Ga0070697_101093555 Ga0070697_1010935551 117
31 3300005546 Ga0070696_100532146 Ga0070696_1005321461 117
32 3300005549 Ga0070704_101416272 Ga0070704_1014162722 117
33 3300005985 Ga0081539_10000002 Ga0081539_10000002166 117
34 3300006173 Ga0070716_100640688 Ga0070716_1006406882 117
35 3300006844 Ga0075428_100001207 Ga0075428_10000120714 117
36 3300006844 Ga0075428_100003481 Ga0075428_10000348111 117
37 3300006844 Ga0075428_100030338 Ga0075428_1000303385 117
38 3300006844 Ga0075428_100318646 Ga0075428_1003186465 117
39 3300006844 Ga0075428_100323382 Ga0075428_1003233825 117
40 3300006846 Ga0075430_100048444 Ga0075430_1000484445 117
41 3300006846 Ga0075430_100062076 Ga0075430_1000620765 117
42 3300006847 Ga0075431_100000049 Ga0075431_10000004937 117
43 3300006847 Ga0075431_100004054 Ga0075431_10000405414 117
44 3300006847 Ga0075431_100043133 Ga0075431_1000431336 117
45 3300006847 Ga0075431_100046220 Ga0075431_1000462201 117
46 3300006847 Ga0075431_100314244 Ga0075431_1003142442 117
47 3300006852 Ga0075433_10008986 Ga0075433_100089869 117
48 3300006852 Ga0075433_11066938 Ga0075433_110669381 117
49 3300006871 Ga0075434_100052936 Ga0075434_1000529367 117
50 3300006871 Ga0075434_100237837 Ga0075434_1002378372 117
51 3300006871 Ga0075434_100480371 Ga0075434_1004803712 117
52 3300006880 Ga0075429_100017245 Ga0075429_1000172459 117
53 3300006880 Ga0075429_100017803 Ga0075429_1000178037 117
54 3300006880 Ga0075429_100024639 Ga0075429_1000246397 117
55 3300006880 Ga0075429_100082940 Ga0075429_1000829405 117
56 3300006880 Ga0075429_100487455 Ga0075429_1004874553 117
57 3300006880 Ga0075429_100880069 Ga0075429_1008800693 117
58 3300006914 Ga0075436_100013559 Ga0075436_1000135599 117
59 3300007076 Ga0075435_100101652 Ga0075435_1001016525 117
60 3300007076 Ga0075435_100195029 Ga0075435_1001950292 117
61 3300007076 Ga0075435_100993552 Ga0075435_1009935521 117
62 3300007265 Ga0099794_10141320 Ga0099794_101413204 117
63 3300009094 Ga0111539_10050238 Ga0111539_100502386 117
64 3300009147 Ga0114129_10000037 Ga0114129_10000037113 117
65 3300009147 Ga0114129_10000462 Ga0114129_1000046237 117
66 3300009147 Ga0114129_10000721 Ga0114129_1000072141 117
67 3300009147 Ga0114129_10003163 Ga0114129_1000316314 117
68 3300009147 Ga0114129_10003767 Ga0114129_1000376722 117
69 3300009147 Ga0114129_10129440 Ga0114129_101294403 117
70 3300009147 Ga0114129_10549189 Ga0114129_105491893 117
71 3300009147 Ga0114129_10769413 Ga0114129_107694134 117
72 3300009147 Ga0114129_12108018 Ga0114129_121080182 117
73 3300025910 Ga0207684_10000105 Ga0207684_1000010587 117
74 3300025910 Ga0207684_10911428 Ga0207684_109114282 117
75 3300025922 Ga0207646_10000893 Ga0207646_1000089325 117
76 3300025922 Ga0207646_10290698 Ga0207646_102906983 117
77 3300025922 Ga0207646_10504268 Ga0207646_105042682 117
78 3300027543 Ga0209999_1084959 Ga0209999_10849592 117
79 3300027665 Ga0209983_1031828 Ga0209983_10318282 117
80 3300027671 Ga0209588_1007150 Ga0209588_10071505 117
81 3300027682 Ga0209971_1031698 Ga0209971_10316982 117
82 3300027907 Ga0207428_10231278 Ga0207428_102312782 117
83 3300031548 Ga0307408_100029300 Ga0307408_1000293005 117
84 3300031548 Ga0307408_100047382 Ga0307408_1000473823 117
85 3300031548 Ga0307408_100297555 Ga0307408_1002975553 117
86 3300031731 Ga0307405_10407475 Ga0307405_104074751 117
87 3300031731 Ga0307405_10603935 Ga0307405_106039352 117
88 3300031824 Ga0307413_10501032 Ga0307413_105010322 117
89 3300031901 Ga0307406_10426371 Ga0307406_104263714 117
90 3300031903 Ga0307407_10948802 Ga0307407_109488022 117
91 3300031911 Ga0307412_10973366 Ga0307412_109733662 117
92 3300031911 Ga0307412_11775944 Ga0307412_117759441 117
93 3300031995 Ga0307409_100712546 Ga0307409_1007125463 117
94 3300032002 Ga0307416_100319966 Ga0307416_1003199661 117
95 3300032002 Ga0307416_102403401 Ga0307416_1024034012 117
96 3300032004 Ga0307414_12248465 Ga0307414_122484651 117
97 3300032005 Ga0307411_10354564 Ga0307411_103545643 117
98 3300032126 Ga0307415_100732596 Ga0307415_1007325963 117
99 3300035088 Ga0373940_0154426 Ga0373940_0154426_84_443 117
100 3300035112 Ga0373932_0086585 Ga0373932_0086585_368_724 117
101 3300037471 Ga0395905_0025786 Ga0395905_0025786_532_885 117
102 3300037471 Ga0395905_0559679 Ga0395905_0559679_337_690 117
103 3300038443 Ga0395901_0573403 Ga0395901_0573403_452_805 117
104 3300038996 Ga0242420_070326 Ga0242420_070326_129_482 117
105 3300044673 Ga0453683_0125685 Ga0453683_0125685_677_1030 117
106 3300044673 Ga0453683_0296561 Ga0453683_0296561_602_955 117
107 3300049572 Ga0501036_0247102 Ga0501036_0247102_320_673 117
108 3300049572 Ga0501036_1206554 Ga0501036_1206554_58_411 117
109 3300049572 Ga0501036_1559025 Ga0501036_1559025_122_475 117
110 3300049574 Ga0501038_0246795 Ga0501038_0246795_1032_1385 117
111 3300049575 Ga0501039_0096051 Ga0501039_0096051_1360_1713 117
112 3300049575 Ga0501039_0523090 Ga0501039_0523090_29_382 117
113 3300049576 Ga0501040_0011893 Ga0501040_0011893_1476_1829 117
114 3300049576 Ga0501040_0280406 Ga0501040_0280406_595_951 117
115 3300049577 Ga0501041_0174437 Ga0501041_0174437_334_687 117
116 3300049578 Ga0501042_0068209 Ga0501042_0068209_1518_1871 117
117 3300049578 Ga0501042_0099401 Ga0501042_0099401_139_492 117
118 3300049578 Ga0501042_0381109 Ga0501042_0381109_360_713 117
119 3300049578 Ga0501042_0677101 Ga0501042_0677101_145_498 117
120 3300049579 Ga0501043_0110086 Ga0501043_0110086_1609_1962 117
121 3300049580 Ga0501046_1100139 Ga0501046_1100139_41_394 117
122 3300049582 Ga0501048_0030366 Ga0501048_0030366_1833_2186 117
123 3300049582 Ga0501048_0182381 Ga0501048_0182381_970_1323 117
124 3300049582 Ga0501048_0634425 Ga0501048_0634425_88_441 117
125 3300049583 Ga0501067_0021287 Ga0501067_0021287_625_978 117
126 3300049583 Ga0501067_0261628 Ga0501067_0261628_30_383 117
127 3300049584 Ga0501068_0074051 Ga0501068_0074051_1101_1454 117
128 3300049584 Ga0501068_0117865 Ga0501068_0117865_799_1152 117
129 3300049584 Ga0501068_0299224 Ga0501068_0299224_75_428 117
130 3300049585 Ga0501069_0123725 Ga0501069_0123725_1069_1422 117
131 3300049587 Ga0501071_0583286 Ga0501071_0583286_493_846 117
132 3300049587 Ga0501071_1147573 Ga0501071_1147573_225_578 117
133 3300049588 Ga0501072_0045337 Ga0501072_0045337_479_832 117
134 3300049588 Ga0501072_0082245 Ga0501072_0082245_958_1311 117
135 3300049588 Ga0501072_0753973 Ga0501072_0753973_60_413 117
136 3300049589 Ga0501073_0099441 Ga0501073_0099441_126_479 117
137 3300049590 Ga0501074_0167030 Ga0501074_0167030_1077_1430 117
138 3300049591 Ga0501075_0005703 Ga0501075_0005703_7872_8225 117
139 3300049591 Ga0501075_0019688 Ga0501075_0019688_4202_4555 117
140 3300049591 Ga0501075_0027285 Ga0501075_0027285_1865_2218 117
141 3300049591 Ga0501075_0100208 Ga0501075_0100208_1018_1371 117
142 3300049591 Ga0501075_0148505 Ga0501075_0148505_677_1030 117
143 3300049592 Ga0501076_0003954 Ga0501076_0003954_4492_4845 117
144 3300049592 Ga0501076_0071935 Ga0501076_0071935_1219_1572 117
145 3300049592 Ga0501076_0259201 Ga0501076_0259201_827_1180 117
146 3300049592 Ga0501076_1145844 Ga0501076_1145844_149_502 117
147 3300049592 Ga0501076_1346582 Ga0501076_1346582_94_447 117
148 3300049593 Ga0501077_0002879 Ga0501077_0002879_9593_9946 117
149 3300049593 Ga0501077_0058715 Ga0501077_0058715_1101_1454 117
150 3300049741 Ga0501079_0014479 Ga0501079_0014479_2592_2945 117
151 3300049741 Ga0501079_0023834 Ga0501079_0023834_3409_3762 117
152 3300049741 Ga0501079_0101744 Ga0501079_0101744_1566_1919 117
153 3300049742 Ga0501080_0941607 Ga0501080_0941607_45_398 117
154 3300049743 Ga0501081_0002533 Ga0501081_0002533_10283_10636 117
155 3300049743 Ga0501081_0016853 Ga0501081_0016853_1582_1935 117
156 3300049743 Ga0501081_0034421 Ga0501081_0034421_1640_1993 117
157 3300049743 Ga0501081_0086317 Ga0501081_0086317_1286_1639 117
158 3300049743 Ga0501081_0090723 Ga0501081_0090723_344_697 117
159 3300049743 Ga0501081_0196431 Ga0501081_0196431_930_1283 117
160 3300049744 Ga0501083_0081443 Ga0501083_0081443_1750_2103 117
161 3300049744 Ga0501083_0664241 Ga0501083_0664241_278_643 117
162 3300049824 Ga0501045_0027035 Ga0501045_0027035_2078_2431 117
163 3300049824 Ga0501045_0069636 Ga0501045_0069636_1972_2325 117
164 3300049824 Ga0501045_0334914 Ga0501045_0334914_762_1115 117
165 3300049824 Ga0501045_0543236 Ga0501045_0543236_16_372 117
166 3300050507 nmdc:mga05p37_1052835_c1 nmdc:mga05p37_1052835_c1_388_741 117
167 3300050507 nmdc:mga05p37_1107075_c1 nmdc:mga05p37_1107075_c1_315_668 117
168 3300050507 nmdc:mga05p37_13279_c1 nmdc:mga05p37_13279_c1_2074_2427 117
169 3300050507 nmdc:mga05p37_162689_c1 nmdc:mga05p37_162689_c1_2021_2374 117
170 3300050507 nmdc:mga05p37_323_c1 nmdc:mga05p37_323_c1_29928_30281 117
171 3300050507 nmdc:mga05p37_485885_c1 nmdc:mga05p37_485885_c1_560_913 117
172 3300050507 nmdc:mga05p37_6_c1 nmdc:mga05p37_6_c1_18550_18903 117
173 3300050507 nmdc:mga05p37_84_c1 nmdc:mga05p37_84_c1_56775_57128 117
174 3300050508 nmdc:mga09592_1536_c1 nmdc:mga09592_1536_c1_1068_1421 117
175 3300050508 nmdc:mga09592_20401_c1 nmdc:mga09592_20401_c1_3104_3457 117
176 3300050508 nmdc:mga09592_774378_c1 nmdc:mga09592_774378_c1_346_699 117
177 3300050508 nmdc:mga09592_9634_c1 nmdc:mga09592_9634_c1_7311_7664 117
178 3300050509 nmdc:mga0qj67_112572_c1 nmdc:mga0qj67_112572_c1_1643_1996 117
179 3300050509 nmdc:mga0qj67_228266_c1 nmdc:mga0qj67_228266_c1_848_1201 117
180 3300050509 nmdc:mga0qj67_53029_c1 nmdc:mga0qj67_53029_c1_232_585 117
181 3300050509 nmdc:mga0qj67_57878_c1 nmdc:mga0qj67_57878_c1_1896_2249 117
182 3300050510 nmdc:mga06r32_268980_c1 nmdc:mga06r32_268980_c1_960_1313 117
183 3300050510 nmdc:mga06r32_479_c1 nmdc:mga06r32_479_c1_16426_16779 117
184 3300050510 nmdc:mga06r32_551399_c1 nmdc:mga06r32_551399_c1_50_403 117
185 3300050510 nmdc:mga06r32_614587_c1 nmdc:mga06r32_614587_c1_192_545 117
186 3300050510 nmdc:mga06r32_79678_c1 nmdc:mga06r32_79678_c1_1100_1453 117
187 3300050511 nmdc:mga08y16_8086_c1 nmdc:mga08y16_8086_c1_6423_6782 117
188 3300050512 nmdc:mga0n895_100_c1 nmdc:mga0n895_100_c1_18974_19327 117
189 3300050512 nmdc:mga0n895_61979_c1 nmdc:mga0n895_61979_c1_274_627 117
190 3300050513 nmdc:mga0rr50_127767_c1 nmdc:mga0rr50_127767_c1_302_655 117
191 3300050513 nmdc:mga0rr50_2838_c1 nmdc:mga0rr50_2838_c1_3323_3676 117
192 3300050514 nmdc:mga08x19_1185_c1 nmdc:mga08x19_1185_c1_15034_15387 117
193 3300050515 nmdc:mga0a205_6433_c1 nmdc:mga0a205_6433_c1_2540_2893 117
194 3300050515 nmdc:mga0a205_986200_c1 nmdc:mga0a205_986200_c1_32_385 117
195 3300054114 Ga0501084_0026136 Ga0501084_0026136_303_656 117
196 3300054114 Ga0501084_0033882 Ga0501084_0033882_3657_4010 117
197 3300054114 Ga0501084_0038002 Ga0501084_0038002_3607_3960 117
198 3300054114 Ga0501084_0095740 Ga0501084_0095740_1850_2203 117
199 3300054114 Ga0501084_1289253 Ga0501084_1289253_215_568 117
200 3300060353 Ga0501082_0015365 Ga0501082_0015365_204_557 117
201 3300060353 Ga0501082_0026993 Ga0501082_0026993_266_619 117
202 3300061734 Ga0530510_0164641 Ga0530510_0164641_148_501 117
203 3300061734 Ga0530510_0305714 Ga0530510_0305714_10_363 117
204 3300061734 Ga0530510_0662222 Ga0530510_0662222_33_386 117
205 3300005295 Ga0065707_10116046 Ga0065707_101160463 118
206 3300005295 Ga0065707_10239192 Ga0065707_102391922 118
207 3300005334 Ga0068869_100217534 Ga0068869_1002175344 118
208 3300005336 Ga0070680_100040075 Ga0070680_1000400753 118
209 3300005336 Ga0070680_100438654 Ga0070680_1004386542 118
210 3300005336 Ga0070680_101061863 Ga0070680_1010618632 118
211 3300005336 Ga0070680_101370516 Ga0070680_1013705162 118
212 3300005336 Ga0070680_101410020 Ga0070680_1014100201 118
213 3300005339 Ga0070660_100304901 Ga0070660_1003049011 118
214 3300005343 Ga0070687_100807182 Ga0070687_1008071821 118
215 3300005353 Ga0070669_100028862 Ga0070669_1000288626 118
216 3300005353 Ga0070669_100691486 Ga0070669_1006914861 118
217 3300005355 Ga0070671_100860630 Ga0070671_1008606302 118
218 3300005438 Ga0070701_11275704 Ga0070701_112757041 118
219 3300005440 Ga0070705_100003128 Ga0070705_1000031289 118
220 3300005440 Ga0070705_100408744 Ga0070705_1004087442 118
221 3300005440 Ga0070705_100799922 Ga0070705_1007999222 118
222 3300005444 Ga0070694_100474994 Ga0070694_1004749942 118
223 3300005444 Ga0070694_100507138 Ga0070694_1005071381 118
224 3300005444 Ga0070694_100787154 Ga0070694_1007871542 118
225 3300005445 Ga0070708_100017838 Ga0070708_1000178385 118
226 3300005457 Ga0070662_100267323 Ga0070662_1002673232 118
227 3300005458 Ga0070681_10245487 Ga0070681_102454873 118
228 3300005459 Ga0068867_100079905 Ga0068867_1000799052 118
229 3300005459 Ga0068867_100535841 Ga0068867_1005358412 118
230 3300005459 Ga0068867_100691991 Ga0068867_1006919913 118
231 3300005467 Ga0070706_100050342 Ga0070706_1000503425 118
232 3300005467 Ga0070706_100170999 Ga0070706_1001709993 118
233 3300005468 Ga0070707_100012309 Ga0070707_10001230910 118
234 3300005468 Ga0070707_101621198 Ga0070707_1016211982 118
235 3300005536 Ga0070697_100106514 Ga0070697_1001065145 118
236 3300005536 Ga0070697_100379093 Ga0070697_1003790934 118
237 3300005536 Ga0070697_100724471 Ga0070697_1007244712 118
238 3300005536 Ga0070697_101464490 Ga0070697_1014644901 118
239 3300005543 Ga0070672_100007790 Ga0070672_1000077909 118
240 3300005543 Ga0070672_100302379 Ga0070672_1003023794 118
241 3300005545 Ga0070695_100035672 Ga0070695_1000356722 118
242 3300005545 Ga0070695_100064210 Ga0070695_1000642103 118
243 3300005546 Ga0070696_100067021 Ga0070696_1000670215 118
244 3300005546 Ga0070696_101204744 Ga0070696_1012047441 118
245 3300005547 Ga0070693_100318759 Ga0070693_1003187592 118
246 3300005549 Ga0070704_100038552 Ga0070704_1000385525 118
247 3300005549 Ga0070704_100089318 Ga0070704_1000893181 118
248 3300005549 Ga0070704_100113753 Ga0070704_1001137533 118
249 3300005549 Ga0070704_100223925 Ga0070704_1002239254 118
250 3300005578 Ga0068854_101487781 Ga0068854_1014877812 118
251 3300005617 Ga0068859_101949462 Ga0068859_1019494622 118
252 3300005718 Ga0068866_10556680 Ga0068866_105566802 118
253 3300005719 Ga0068861_100912606 Ga0068861_1009126062 118
254 3300005719 Ga0068861_101835464 Ga0068861_1018354642 118
255 3300005841 Ga0068863_100087045 Ga0068863_1000870454 118
256 3300005843 Ga0068860_100881197 Ga0068860_1008811972 118
257 3300005844 Ga0068862_100625520 Ga0068862_1006255204 118
258 3300005844 Ga0068862_101354887 Ga0068862_1013548872 118
259 3300005937 Ga0081455_10670157 Ga0081455_106701571 118
260 3300005937 Ga0081455_10772685 Ga0081455_107726852 118
261 3300005983 Ga0081540_1201101 Ga0081540_12011012 118
262 3300006844 Ga0075428_100000032 Ga0075428_10000003211 118
263 3300006844 Ga0075428_100049588 Ga0075428_1000495885 118
264 3300006844 Ga0075428_100084930 Ga0075428_1000849301 118
265 3300006844 Ga0075428_100693812 Ga0075428_1006938123 118
266 3300006846 Ga0075430_100000097 Ga0075430_10000009722 118
267 3300006846 Ga0075430_100004723 Ga0075430_1000047235 118
268 3300006846 Ga0075430_100033122 Ga0075430_1000331227 118
269 3300006847 Ga0075431_100000199 Ga0075431_10000019915 118
270 3300006847 Ga0075431_100000537 Ga0075431_10000053730 118
271 3300006847 Ga0075431_100088257 Ga0075431_1000882575 118
272 3300006847 Ga0075431_100112266 Ga0075431_1001122665 118
273 3300006847 Ga0075431_100287089 Ga0075431_1002870893 118
274 3300006847 Ga0075431_100413305 Ga0075431_1004133054 118
275 3300006852 Ga0075433_10000995 Ga0075433_100009958 118
276 3300006852 Ga0075433_10011320 Ga0075433_100113209 118
277 3300006852 Ga0075433_10035944 Ga0075433_100359446 118
278 3300006852 Ga0075433_10044878 Ga0075433_100448785 118
279 3300006852 Ga0075433_10094874 Ga0075433_100948743 118
280 3300006852 Ga0075433_10101488 Ga0075433_101014883 118
281 3300006852 Ga0075433_10342586 Ga0075433_103425863 118
282 3300006871 Ga0075434_100002030 Ga0075434_10000203015 118
283 3300006871 Ga0075434_100006385 Ga0075434_1000063853 118
284 3300006871 Ga0075434_100022423 Ga0075434_1000224236 118
285 3300006871 Ga0075434_100032218 Ga0075434_1000322186 118
286 3300006871 Ga0075434_100122180 Ga0075434_1001221803 118
287 3300006871 Ga0075434_100154124 Ga0075434_1001541243 118
288 3300006871 Ga0075434_100211205 Ga0075434_1002112055 118
289 3300006871 Ga0075434_100256782 Ga0075434_1002567823 118
290 3300006871 Ga0075434_100432986 Ga0075434_1004329862 118
291 3300006871 Ga0075434_101264962 Ga0075434_1012649622 118
292 3300006871 Ga0075434_102397948 Ga0075434_1023979481 118
293 3300006880 Ga0075429_100000032 Ga0075429_10000003246 118
294 3300006880 Ga0075429_100003383 Ga0075429_10000338314 118
295 3300006880 Ga0075429_100007768 Ga0075429_10000776810 118
296 3300006880 Ga0075429_101343521 Ga0075429_1013435211 118
297 3300006914 Ga0075436_100024487 Ga0075436_1000244875 118
298 3300006914 Ga0075436_100620467 Ga0075436_1006204672 118
299 3300006914 Ga0075436_100701818 Ga0075436_1007018182 118
300 3300006931 Ga0097620_101949475 Ga0097620_1019494752 118
301 3300007076 Ga0075435_100013384 Ga0075435_1000133846 118
302 3300007076 Ga0075435_100017458 Ga0075435_1000174583 118
303 3300007076 Ga0075435_100098971 Ga0075435_1000989715 118
304 3300007076 Ga0075435_100101673 Ga0075435_1001016733 118
305 3300007076 Ga0075435_100122298 Ga0075435_1001222984 118
306 3300007076 Ga0075435_100172976 Ga0075435_1001729765 118
307 3300007076 Ga0075435_100178381 Ga0075435_1001783812 118
308 3300007076 Ga0075435_102048792 Ga0075435_1020487922 118
309 3300007265 Ga0099794_10004439 Ga0099794_100044395 118
310 3300007265 Ga0099794_10308333 Ga0099794_103083333 118
311 3300009094 Ga0111539_10004676 Ga0111539_1000467619 118
312 3300009094 Ga0111539_10005166 Ga0111539_1000516616 118
313 3300009094 Ga0111539_10220806 Ga0111539_102208064 118
314 3300009094 Ga0111539_10964241 Ga0111539_109642411 118
315 3300009094 Ga0111539_11413892 Ga0111539_114138922 118
316 3300009098 Ga0105245_11949603 Ga0105245_119496031 118
317 3300009147 Ga0114129_10001856 Ga0114129_1000185633 118
318 3300009147 Ga0114129_10003609 Ga0114129_1000360915 118
319 3300009147 Ga0114129_10018018 Ga0114129_1001801813 118
320 3300009147 Ga0114129_10031014 Ga0114129_100310145 118
321 3300009147 Ga0114129_10059209 Ga0114129_100592098 118
322 3300009147 Ga0114129_10098332 Ga0114129_100983325 118
323 3300009147 Ga0114129_10150998 Ga0114129_101509983 118
324 3300009147 Ga0114129_10304364 Ga0114129_103043642 118
325 3300009147 Ga0114129_10675050 Ga0114129_106750504 118
326 3300009147 Ga0114129_10876111 Ga0114129_108761112 118
327 3300009147 Ga0114129_11007348 Ga0114129_110073482 118
328 3300009147 Ga0114129_12425624 Ga0114129_124256242 118
329 3300009148 Ga0105243_11337035 Ga0105243_113370352 118
330 3300009148 Ga0105243_11813417 Ga0105243_118134172 118
331 3300009174 Ga0105241_10363757 Ga0105241_103637572 118
332 3300009553 Ga0105249_11992021 Ga0105249_119920212 118
333 3300013297 Ga0157378_10177851 Ga0157378_101778514 118
334 3300013297 Ga0157378_10230383 Ga0157378_102303833 118
335 3300013306 Ga0163162_10008310 Ga0163162_100083106 118
336 3300013308 Ga0157375_10203424 Ga0157375_102034244 118
337 3300014326 Ga0157380_10113841 Ga0157380_101138413 118
338 3300014969 Ga0157376_11563272 Ga0157376_115632721 118
339 3300025899 Ga0207642_10175823 Ga0207642_101758233 118
340 3300025910 Ga0207684_10029967 Ga0207684_100299673 118
341 3300025910 Ga0207684_10060912 Ga0207684_100609123 118
342 3300025910 Ga0207684_10089306 Ga0207684_100893065 118
343 3300025911 Ga0207654_10327058 Ga0207654_103270582 118
344 3300025912 Ga0207707_10488993 Ga0207707_104889933 118
345 3300025912 Ga0207707_11542432 Ga0207707_115424322 118
346 3300025917 Ga0207660_10013639 Ga0207660_100136395 118
347 3300025917 Ga0207660_10766115 Ga0207660_107661152 118
348 3300025917 Ga0207660_10990006 Ga0207660_109900062 118
349 3300025919 Ga0207657_10318399 Ga0207657_103183993 118
350 3300025922 Ga0207646_10031099 Ga0207646_100310995 118
351 3300025922 Ga0207646_11199545 Ga0207646_111995451 118
352 3300025923 Ga0207681_10013093 Ga0207681_100130931 118
353 3300025923 Ga0207681_10520864 Ga0207681_105208642 118
354 3300025931 Ga0207644_10543067 Ga0207644_105430673 118
355 3300025933 Ga0207706_10142244 Ga0207706_101422442 118
356 3300025933 Ga0207706_10767352 Ga0207706_107673522 118
357 3300025935 Ga0207709_11195525 Ga0207709_111955251 118
358 3300025936 Ga0207670_10455736 Ga0207670_104557362 118
359 3300025940 Ga0207691_10013662 Ga0207691_100136629 118
360 3300025961 Ga0207712_12010619 Ga0207712_120106192 118
361 3300026035 Ga0207703_12095271 Ga0207703_120952711 118
362 3300026088 Ga0207641_10365248 Ga0207641_103652482 118
363 3300026089 Ga0207648_10025762 Ga0207648_100257629 118
364 3300026089 Ga0207648_10516534 Ga0207648_105165343 118
365 3300026089 Ga0207648_12262037 Ga0207648_122620372 118
366 3300026118 Ga0207675_100200698 Ga0207675_1002006982 118
367 3300026118 Ga0207675_100300371 Ga0207675_1003003712 118
368 3300026118 Ga0207675_101796628 Ga0207675_1017966282 118
369 3300027671 Ga0209588_1009054 Ga0209588_10090545 118
370 3300027671 Ga0209588_1243302 Ga0209588_12433021 118
371 3300027907 Ga0207428_10262722 Ga0207428_102627223 118
372 3300028380 Ga0268265_10218193 Ga0268265_102181932 118
373 3300028380 Ga0268265_10820568 Ga0268265_108205682 118
374 3300028380 Ga0268265_11160159 Ga0268265_111601591 118
375 3300028381 Ga0268264_10021604 Ga0268264_100216046 118
376 3300028381 Ga0268264_11628406 Ga0268264_116284062 118
377 3300031548 Ga0307408_100012526 Ga0307408_1000125262 118
378 3300031901 Ga0307406_10191757 Ga0307406_101917573 118
379 3300031911 Ga0307412_10046165 Ga0307412_100461654 118
380 3300031995 Ga0307409_100103118 Ga0307409_1001031184 118
381 3300031995 Ga0307409_100336831 Ga0307409_1003368313 118
382 3300032002 Ga0307416_100049139 Ga0307416_1000491394 118
383 3300032002 Ga0307416_100528526 Ga0307416_1005285262 118
384 3300032002 Ga0307416_101325318 Ga0307416_1013253183 118
385 3300032005 Ga0307411_10270315 Ga0307411_102703153 118
386 3300032126 Ga0307415_100600716 Ga0307415_1006007163 118
387 3300034818 Ga0373950_0128862 Ga0373950_0128862_179_535 118
388 3300035085 Ga0373929_0104202 Ga0373929_0104202_210_566 118
389 3300035088 Ga0373940_0008284 Ga0373940_0008284_129_485 118
390 3300035088 Ga0373940_0011240 Ga0373940_0011240_1520_1876 118
391 3300035090 Ga0373949_0009489 Ga0373949_0009489_1129_1485 118
392 3300035090 Ga0373949_0025729 Ga0373949_0025729_743_1099 118
393 3300035092 Ga0373952_0057462 Ga0373952_0057462_341_697 118
394 3300035114 Ga0373939_0053324 Ga0373939_0053324_12_368 118
395 3300035115 Ga0373941_0013329 Ga0373941_0013329_918_1274 118
396 3300035121 Ga0373960_0046131 Ga0373960_0046131_243_599 118
397 3300035207 Ga0373942_0037080 Ga0373942_0037080_52_408 118
398 3300035241 Ga0373961_0252304 Ga0373961_0252304_52_408 118
399 3300035242 Ga0373962_0007886 Ga0373962_0007886_638_994 118
400 3300035242 Ga0373962_0071984 Ga0373962_0071984_25_381 118
401 3300035691 Ga0373931_0013964 Ga0373931_0013964_3291_3647 118
402 3300035691 Ga0373931_0045895 Ga0373931_0045895_389_745 118
403 3300037312 Ga0395899_0028364 Ga0395899_0028364_3622_3978 118
404 3300037418 Ga0395900_0008541 Ga0395900_0008541_3529_3885 118
405 3300037418 Ga0395900_0849990 Ga0395900_0849990_267_623 118
406 3300037466 Ga0395898_0024916 Ga0395898_0024916_262_618 118
407 3300037471 Ga0395905_1546703 Ga0395905_1546703_171_527 118
408 3300038443 Ga0395901_0003798 Ga0395901_0003798_14578_14934 118
409 3300042876 Ga0451577_0047771 Ga0451577_0047771_2877_3233 118
410 3300042876 Ga0451577_0342284 Ga0451577_0342284_815_1171 118
411 3300044673 Ga0453683_0170085 Ga0453683_0170085_922_1278 118
412 3300044673 Ga0453683_0234315 Ga0453683_0234315_785_1141 118
413 3300045051 Ga0451576_1233416 Ga0451576_1233416_324_680 118
414 3300045051 Ga0451576_1933233 Ga0451576_1933233_234_590 118
415 3300046455 Ga0495603_0148869 Ga0495603_0148869_159_521 118
416 3300046472 Ga0495580_0002331 Ga0495580_0002331_16078_16434 118
417 3300046499 Ga0495594_0391081 Ga0495594_0391081_200_562 118
418 3300046528 Ga0495642_0099976 Ga0495642_0099976_271_627 118
419 3300046528 Ga0495642_0257545 Ga0495642_0257545_156_518 118
420 3300046530 Ga0495654_0314778 Ga0495654_0314778_25_387 118
421 3300046557 Ga0495622_0426928 Ga0495622_0426928_167_529 118
422 3300046615 Ga0495656_0628253 Ga0495656_0628253_46_402 118
423 3300046664 Ga0495659_0121467 Ga0495659_0121467_167_529 118
424 3300046684 Ga0495669_0122108 Ga0495669_0122108_321_683 118
425 3300046684 Ga0495669_0149870 Ga0495669_0149870_101_457 118
426 3300046691 Ga0495670_0448850 Ga0495670_0448850_89_445 118
427 3300047318 Ga0495636_0056028 Ga0495636_0056028_1184_1540 118
428 3300047318 Ga0495636_0089673 Ga0495636_0089673_784_1140 118
429 3300048905 Ga0496102_0050522 Ga0496102_0050522_317_673 118
430 3300048905 Ga0496102_0333446 Ga0496102_0333446_802_1164 118
431 3300048906 Ga0496103_0043481 Ga0496103_0043481_1812_2168 118
432 3300048909 Ga0496106_0258410 Ga0496106_0258410_207_563 118
433 3300049521 Ga0501298_133437 Ga0501298_133437_130_486 118
434 3300049569 Ga0501032_0926084 Ga0501032_0926084_97_453 118
435 3300049572 Ga0501036_0271798 Ga0501036_0271798_381_758 118
436 3300049572 Ga0501036_0915441 Ga0501036_0915441_251_607 118
437 3300049572 Ga0501036_1062754 Ga0501036_1062754_114_488 118
438 3300049574 Ga0501038_1007605 Ga0501038_1007605_243_599 118
439 3300049575 Ga0501039_0905324 Ga0501039_0905324_64_420 118
440 3300049576 Ga0501040_0043489 Ga0501040_0043489_2562_2918 118
441 3300049576 Ga0501040_0046375 Ga0501040_0046375_1115_1489 118
442 3300049576 Ga0501040_0718493 Ga0501040_0718493_83_439 118
443 3300049577 Ga0501041_0550699 Ga0501041_0550699_92_448 118
444 3300049578 Ga0501042_0333941 Ga0501042_0333941_588_944 118
445 3300049579 Ga0501043_1258449 Ga0501043_1258449_97_453 118
446 3300049580 Ga0501046_0618361 Ga0501046_0618361_231_587 118
447 3300049580 Ga0501046_0869155 Ga0501046_0869155_139_495 118
448 3300049582 Ga0501048_0155057 Ga0501048_0155057_344_721 118
449 3300049582 Ga0501048_0497198 Ga0501048_0497198_316_672 118
450 3300049584 Ga0501068_0468155 Ga0501068_0468155_416_772 118
451 3300049584 Ga0501068_0574374 Ga0501068_0574374_342_698 118
452 3300049584 Ga0501068_1054824 Ga0501068_1054824_148_504 118
453 3300049587 Ga0501071_0610449 Ga0501071_0610449_102_458 118
454 3300049588 Ga0501072_0016727 Ga0501072_0016727_2494_2850 118
455 3300049588 Ga0501072_0188986 Ga0501072_0188986_123_479 118
456 3300049588 Ga0501072_0272863 Ga0501072_0272863_603_959 118
457 3300049588 Ga0501072_0502314 Ga0501072_0502314_512_868 118
458 3300049588 Ga0501072_0613842 Ga0501072_0613842_344_721 118
459 3300049589 Ga0501073_1075211 Ga0501073_1075211_103_459 118
460 3300049590 Ga0501074_0214429 Ga0501074_0214429_957_1313 118
461 3300049590 Ga0501074_1219400 Ga0501074_1219400_144_500 118
462 3300049591 Ga0501075_0033504 Ga0501075_0033504_728_1084 118
463 3300049591 Ga0501075_0330753 Ga0501075_0330753_194_550 118
464 3300049591 Ga0501075_0332725 Ga0501075_0332725_753_1109 118
465 3300049591 Ga0501075_0372039 Ga0501075_0372039_264_620 118
466 3300049591 Ga0501075_0718754 Ga0501075_0718754_280_636 118
467 3300049591 Ga0501075_1499257 Ga0501075_1499257_28_384 118
468 3300049592 Ga0501076_0075757 Ga0501076_0075757_189_545 118
469 3300049592 Ga0501076_0201575 Ga0501076_0201575_413_769 118
470 3300049592 Ga0501076_0330017 Ga0501076_0330017_582_938 118
471 3300049741 Ga0501079_0431380 Ga0501079_0431380_525_881 118
472 3300049741 Ga0501079_0803867 Ga0501079_0803867_200_556 118
473 3300049741 Ga0501079_0894843 Ga0501079_0894843_216_572 118
474 3300049742 Ga0501080_0225287 Ga0501080_0225287_534_890 118
475 3300049742 Ga0501080_1733779 Ga0501080_1733779_90_446 118
476 3300049743 Ga0501081_0044069 Ga0501081_0044069_649_1005 118
477 3300049743 Ga0501081_0084798 Ga0501081_0084798_1275_1631 118
478 3300049743 Ga0501081_0133400 Ga0501081_0133400_754_1110 118
479 3300049743 Ga0501081_0365205 Ga0501081_0365205_669_1025 118
480 3300049824 Ga0501045_0206262 Ga0501045_0206262_174_530 118
481 3300049824 Ga0501045_0757735 Ga0501045_0757735_19_393 118
482 3300050507 nmdc:mga05p37_1222588_c1 nmdc:mga05p37_1222588_c1_374_730 118
483 3300050507 nmdc:mga05p37_1222_c1 nmdc:mga05p37_1222_c1_6634_6990 118
484 3300050507 nmdc:mga05p37_1241360_c1 nmdc:mga05p37_1241360_c1_113_469 118
485 3300050507 nmdc:mga05p37_23764_c1 nmdc:mga05p37_23764_c1_3308_3664 118
486 3300050507 nmdc:mga05p37_24618_c1 nmdc:mga05p37_24618_c1_4898_5254 118
487 3300050507 nmdc:mga05p37_35190_c1 nmdc:mga05p37_35190_c1_3013_3375 118
488 3300050507 nmdc:mga05p37_43830_c1 nmdc:mga05p37_43830_c1_3730_4086 118
489 3300050507 nmdc:mga05p37_618276_c1 nmdc:mga05p37_618276_c1_784_1140 118
490 3300050507 nmdc:mga05p37_66520_c1 nmdc:mga05p37_66520_c1_979_1335 118
491 3300050507 nmdc:mga05p37_858467_c1 nmdc:mga05p37_858467_c1_31_387 118
492 3300050507 nmdc:mga05p37_923932_c1 nmdc:mga05p37_923932_c1_229_585 118
493 3300050508 nmdc:mga09592_118163_c1 nmdc:mga09592_118163_c1_1632_1988 118
494 3300050508 nmdc:mga09592_190810_c1 nmdc:mga09592_190810_c1_668_1024 118
495 3300050508 nmdc:mga09592_3621_c1 nmdc:mga09592_3621_c1_1726_2082 118
496 3300050508 nmdc:mga09592_37501_c1 nmdc:mga09592_37501_c1_2938_3294 118
497 3300050508 nmdc:mga09592_80268_c1 nmdc:mga09592_80268_c1_999_1355 118
498 3300050509 nmdc:mga0qj67_1099_c1 nmdc:mga0qj67_1099_c1_1769_2125 118
499 3300050509 nmdc:mga0qj67_35096_c1 nmdc:mga0qj67_35096_c1_3203_3559 118
500 3300050509 nmdc:mga0qj67_678_c1 nmdc:mga0qj67_678_c1_16215_16571 118
501 3300050510 nmdc:mga06r32_1058497_c1 nmdc:mga06r32_1058497_c1_43_405 118
502 3300050510 nmdc:mga06r32_108639_c1 nmdc:mga06r32_108639_c1_1374_1730 118
503 3300050510 nmdc:mga06r32_28275_c1 nmdc:mga06r32_28275_c1_4530_4886 118
504 3300050510 nmdc:mga06r32_2918_c1 nmdc:mga06r32_2918_c1_3365_3721 118
505 3300050510 nmdc:mga06r32_460336_c1 nmdc:mga06r32_460336_c1_301_657 118
506 3300050510 nmdc:mga06r32_498963_c1 nmdc:mga06r32_498963_c1_568_924 118
507 3300050510 nmdc:mga06r32_6345_c1 nmdc:mga06r32_6345_c1_8346_8702 118
508 3300050511 nmdc:mga08y16_126165_c1 nmdc:mga08y16_126165_c1_1716_2072 118
509 3300050511 nmdc:mga08y16_1461994_c1 nmdc:mga08y16_1461994_c1_108_464 118
510 3300050511 nmdc:mga08y16_190_c1 nmdc:mga08y16_190_c1_14226_14582 118
511 3300050511 nmdc:mga08y16_28274_c1 nmdc:mga08y16_28274_c1_36_395 118
512 3300050512 nmdc:mga0n895_15575_c1 nmdc:mga0n895_15575_c1_4220_4576 118
513 3300050512 nmdc:mga0n895_261052_c1 nmdc:mga0n895_261052_c1_1234_1590 118
514 3300050512 nmdc:mga0n895_272475_c1 nmdc:mga0n895_272475_c1_771_1127 118
515 3300050512 nmdc:mga0n895_28975_c1 nmdc:mga0n895_28975_c1_2982_3338 118
516 3300050512 nmdc:mga0n895_324038_c1 nmdc:mga0n895_324038_c1_357_719 118
517 3300050512 nmdc:mga0n895_356377_c1 nmdc:mga0n895_356377_c1_1025_1381 118
518 3300050512 nmdc:mga0n895_854236_c1 nmdc:mga0n895_854236_c1_217_573 118
519 3300050512 nmdc:mga0n895_863110_c1 nmdc:mga0n895_863110_c1_476_832 118
520 3300050513 nmdc:mga0rr50_1463981_c1 nmdc:mga0rr50_1463981_c1_116_472 118
521 3300050513 nmdc:mga0rr50_171358_c1 nmdc:mga0rr50_171358_c1_1279_1635 118
522 3300050513 nmdc:mga0rr50_230856_c1 nmdc:mga0rr50_230856_c1_514_870 118
523 3300050513 nmdc:mga0rr50_295203_c1 nmdc:mga0rr50_295203_c1_542_898 118
524 3300050513 nmdc:mga0rr50_43033_c1 nmdc:mga0rr50_43033_c1_1079_1435 118
525 3300050513 nmdc:mga0rr50_734736_c1 nmdc:mga0rr50_734736_c1_454_810 118
526 3300050513 nmdc:mga0rr50_91000_c1 nmdc:mga0rr50_91000_c1_1429_1785 118
527 3300050514 nmdc:mga08x19_14665_c2 nmdc:mga08x19_14665_c2_195_551 118
528 3300050514 nmdc:mga08x19_176070_c1 nmdc:mga08x19_176070_c1_553_909 118
529 3300050515 nmdc:mga0a205_101538_c1 nmdc:mga0a205_101538_c1_512_868 118
530 3300050515 nmdc:mga0a205_13310_c1 nmdc:mga0a205_13310_c1_5317_5673 118
531 3300050515 nmdc:mga0a205_19701_c1 nmdc:mga0a205_19701_c1_3419_3775 118
532 3300050515 nmdc:mga0a205_240642_c1 nmdc:mga0a205_240642_c1_533_889 118
533 3300050515 nmdc:mga0a205_251334_c1 nmdc:mga0a205_251334_c1_922_1284 118
534 3300050515 nmdc:mga0a205_36860_c1 nmdc:mga0a205_36860_c1_4148_4504 118
535 3300050515 nmdc:mga0a205_811715_c1 nmdc:mga0a205_811715_c1_164_520 118
536 3300050515 nmdc:mga0a205_8521_c1 nmdc:mga0a205_8521_c1_1720_2076 118
537 3300050515 nmdc:mga0a205_9259_c1 nmdc:mga0a205_9259_c1_4292_4648 118
538 3300050515 nmdc:mga0a205_95103_c1 nmdc:mga0a205_95103_c1_1954_2310 118
539 3300054114 Ga0501084_0147660 Ga0501084_0147660_929_1285 118
540 3300054114 Ga0501084_0150910 Ga0501084_0150910_838_1194 118
541 3300059421 Ga0590071_202747 Ga0590071_202747_49_405 118
542 3300060353 Ga0501082_0021304 Ga0501082_0021304_4637_4993 118
543 3300060353 Ga0501082_0055193 Ga0501082_0055193_2273_2629 118
544 3300060353 Ga0501082_1331112 Ga0501082_1331112_228_584 118
545 3300061734 Ga0530510_0058183 Ga0530510_0058183_275_631 118
546 3300061734 Ga0530510_0269758 Ga0530510_0269758_790_1146 118
547 3300061734 Ga0530510_0484372 Ga0530510_0484372_22_378 118
548 3300061734 Ga0530510_1053859 Ga0530510_1053859_16_372 118
549 3300061734 Ga0530510_1087585 Ga0530510_1087585_75_431 118

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.797 3 118
2hy5-assembly1.cif.gz_B crystal structure of dsrefh 0.7928 5 118
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.7787 3 118
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.7681 5 118
2hy5-assembly1.cif.gz_B crystal structure of dsrefh 0.763 5 118
ID Description Score Start End Superfamily
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8014 6 118 3.40.1260.10
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.7894 6 118 3.40.1260.10
af_P0AB52_1_117_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.7784 5 118 3.40.1260.10
2d1pH00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.7783 5 118 3.40.1260.10
af_O16922_1_279_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7754 1 43 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2V7AKK0-F1-model_v4 Peroxiredoxin 0.962 9 118
AF-A0A2V7BHA5-F1-model_v4 Uncharacterized protein 0.9605 1 118
AF-A0A2V6Q5K2-F1-model_v4 Uncharacterized protein 0.9579 1 118
AF-A0A2V6RHG8-F1-model_v4 Peroxiredoxin 0.9551 1 118
AF-A0A2V6SIF8-F1-model_v4 Uncharacterized protein 0.9546 2 118

Feature Viewer

pLDDT pTM Quality
94.16 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map