F462279

General Info

Members Datasets Scaffolds Average Seq Length
548 333 488 262

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0358676|Ga0496100_0358676_151_1053
Length 300
Sequence MCSETAGMGGVYEIGSPGDSARRVVELSQANLVPEAAMNGLEGRTAAVTGGSTLIGQAVVRELHRHGMAVAIADVDDPPGEALAEELGERVLYRHTDITRDDEVAAFVEEAVGRFGGLDGLVNLACTYLDEGFASPRADWLAALDVNVVSAVVVSQAAHPHLKASESGAIVNFASISANVAQTGRWLYPVSKAALVQLTRNMAMDLAADGIRVNAVSPGWTWSKVMVELTGDDRAKTDRVAAPFHLLGRVGDAEEVARVVAFLLSDDASFVTGATWAVDGGYSAMGPEGAVPAIPKLMEE

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2643221672 Variovorax sp. Root434 Isolate Unclassified
13 2643221683 Variovorax sp. Root473 Isolate Unclassified
14 2721755523 Delftia sp. HK171 Isolate Unclassified
15 2738541277 Variovorax sp. GV051 Isolate Unclassified
16 2738541307 Variovorax sp. GV008 Isolate Unclassified
17 2738543012 Acidovorax sp. CF301 Isolate Unclassified
18 2738543019 Variovorax sp. GV040 Isolate Unclassified
19 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
20 2816332133 Acidovorax radicis 2721A Isolate Unclassified
21 2818991446 Variovorax sp. 1180 Isolate Unclassified
22 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
23 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
24 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
25 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
26 2858950400 Achromobacter sp. K91 Isolate Unclassified
27 2885198086 Variovorax sp. 679 Isolate Unclassified
28 2885211737 Variovorax sp. 553 Isolate Unclassified
29 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
30 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
31 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
32 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
33 2899924645 Variovorax sp. 369 Isolate Unclassified
34 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
35 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
36 2904456579 Variovorax sp. 2002 Isolate Unclassified
37 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
38 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
39 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
40 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
41 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
42 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
43 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
44 2928037797 Variovorax sp. 1126 Isolate Unclassified
45 2928044640 Variovorax sp. 1128 Isolate Unclassified
46 2928051484 Variovorax sp. 1133 Isolate Unclassified
47 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
48 2928070936 Variovorax gossypii 1167 Isolate Unclassified
49 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
50 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
51 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
52 2929520902 Variovorax beijingensis 502 Isolate Unclassified
53 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
54 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
55 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
56 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
57 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
62 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
63 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
64 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
65 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
66 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
67 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
68 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
69 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
70 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
71 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
72 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
73 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
74 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
75 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
76 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
77 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
78 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
88 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
89 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
90 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
183 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
212 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
213 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
320 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
321 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
324 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
325 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
326 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
330 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
331 639633007 Azoarcus olearius BH72 Isolate Unclassified
332 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
333 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.5
Metatranscriptomes 0.55
Isolates 10.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 23.91
Nodule 1.46
Rhizoplane 6.2
Rhizosphere 53.1
Stem 0
Stem Tuber 0
Unclassified 15.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001152 3300002773 Bacteria 12269
2 JGI25152J39213_1004850 3300002773 Bacteria 4111
3 JGI25150J39212_1000629 3300002774 Bacteria 13373
4 JGI25159J45721_1001540 3300002987 Bacteria 9445
5 JGI25159J45721_1002520 3300002987 Bacteria 6897
6 JGI25159J45721_1019277 3300002987 Bacteria 1347
7 JGI25151J46595_10001171 3300003187 Bacteria 18873
8 JGI25151J46595_10002144 3300003187 Bacteria 12269
9 JGI25151J46595_10012957 3300003187 Bacteria 3768
10 JGI25151J46595_10017190 3300003187 Bacteria 3143
11 JGI25153J46596_10001941 3300003215 Bacteria 12269
12 JGI25153J46596_10012061 3300003215 Bacteria 3768
13 rootH2_10096586 3300003320 Bacteria 4284
14 rootH1_10006638 3300003323 Bacteria 4640
15 JGI25160J50197_1002114 3300003354 Bacteria 9445
16 JGI25160J50197_1008892 3300003354 Bacteria 3778
17 JGI25161J50226_1000849 3300003374 Bacteria 11359
18 JGI25161J50226_1004835 3300003374 Bacteria 2750
19 Ga0006562J51391_1065136 3300003578 Bacteria 5125
20 Ga0006562J51391_1065137 3300003578 Bacteria 2850
21 Ga0055535_1000750 3300003761 Bacteria 24203
22 Ga0055542_1000583 3300003762 Bacteria 31637
23 Ga0055526_1001020 3300003771 Bacteria 20496
24 Ga0055526_1003328 3300003771 Bacteria 10278
25 Ga0055526_1006457 3300003771 Bacteria 6359
26 Ga0055537_1000575 3300003773 Bacteria 20496
27 Ga0055537_1019415 3300003773 Bacteria 1056
28 Ga0055524_1000825 3300003775 Bacteria 20496
29 Ga0055524_1005418 3300003775 Bacteria 5701
30 Ga0055536_1000296 3300003781 Bacteria 37428
31 Ga0055536_1000955 3300003781 Bacteria 18500
32 Ga0055536_1001692 3300003781 Bacteria 13048
33 Ga0055536_1007355 3300003781 Bacteria 4947
34 Ga0055534_1000379 3300003784 Bacteria 27759
35 Ga0055534_1000533 3300003784 Bacteria 20496
36 Ga0055534_1002835 3300003784 Bacteria 5775
37 Ga0055534_1003380 3300003784 Bacteria 5028
38 Ga0055528_1000661 3300003790 Bacteria 25015
39 Ga0055528_1000868 3300003790 Bacteria 20496
40 Ga0055528_1017004 3300003790 Bacteria 2541
41 Ga0055528_1041043 3300003790 Bacteria 1036
42 Ga0055530_10000318 3300003791 Bacteria 43641
43 Ga0055540_1000194 3300003792 Bacteria 58565
44 Ga0055540_1000747 3300003792 Bacteria 22059
45 Ga0055540_1001928 3300003792 Bacteria 11588
46 Ga0055540_1005685 3300003792 Bacteria 5159
47 Ga0055540_1011959 3300003792 Bacteria 2756
48 Ga0055531_10001032 3300003794 Bacteria 22059
49 Ga0055531_10002357 3300003794 Bacteria 12698
50 Ga0055531_10010815 3300003794 Bacteria 4487
51 Ga0055543_1001683 3300004625 Bacteria 8370
52 Ga0065165_1004070 3300005262 Bacteria 9483
53 Ga0065165_1036228 3300005262 Bacteria 1507
54 Ga0065714_10003524 3300005288 Bacteria 8451
55 Ga0070680_100309258 3300005336 Unclassified 1341
56 Ga0070674_100566934 3300005356 Bacteria 955
57 Ga0070667_100105311 3300005367 Bacteria 2441
58 Ga0070713_100015560 3300005436 Bacteria 5695
59 Ga0070713_100160004 3300005436 Bacteria 2009
60 Ga0070713_100229074 3300005436 Bacteria 1688
61 Ga0070708_100015229 3300005445 Bacteria 6343
62 Ga0070708_100411890 3300005445 Bacteria 1275
63 Ga0070662_100232260 3300005457 Bacteria 1476
64 Ga0070706_100013100 3300005467 Bacteria 7672
65 Ga0070706_100132115 3300005467 Bacteria 2330
66 Ga0070706_100145177 3300005467 Bacteria 2216
67 Ga0070707_100019130 3300005468 Bacteria 6449
68 Ga0070707_100023098 3300005468 Bacteria 5883
69 Ga0070707_100029519 3300005468 Bacteria 5221
70 Ga0070698_100229018 3300005471 Bacteria 1792
71 Ga0070699_100244282 3300005518 Bacteria 1603
72 Ga0070699_100463358 3300005518 Bacteria 1149
73 Ga0070697_100000085 3300005536 Bacteria 77098
74 Ga0070697_100038142 3300005536 Bacteria 3882
75 Ga0070697_100038419 3300005536 Bacteria 3868
76 Ga0070697_100069008 3300005536 Bacteria 2895
77 Ga0070697_100105375 3300005536 Bacteria 2346
78 Ga0070697_100106803 3300005536 Bacteria 2329
79 Ga0070697_100173777 3300005536 Bacteria 1824
80 Ga0068853_100106182 3300005539 Bacteria 2488
81 Ga0068853_100530270 3300005539 Bacteria 1114
82 Ga0070672_100173545 3300005543 Bacteria 1794
83 Ga0068855_100001171 3300005563 Bacteria 32532
84 Ga0068855_100025390 3300005563 Bacteria 7090
85 Ga0068855_100281445 3300005563 Bacteria 1847
86 Ga0070664_100053005 3300005564 Bacteria 3437
87 Ga0068857_100051266 3300005577 Bacteria 3661
88 Ga0068854_100001144 3300005578 Bacteria 15938
89 Ga0068856_100199525 3300005614 Bacteria 2015
90 Ga0068852_100432701 3300005616 Bacteria 1299
91 Ga0068864_100087139 3300005618 Bacteria 2748
92 Ga0068851_10300636 3300005834 Bacteria 923
93 Ga0068863_100002749 3300005841 Bacteria 17410
94 Ga0068863_100464370 3300005841 Bacteria 1243
95 Ga0068858_100855510 3300005842 Bacteria 888
96 Ga0070717_10007019 3300006028 Bacteria 8335
97 Ga0070717_10028839 3300006028 Bacteria 4447
98 Ga0075432_10039255 3300006058 Bacteria 1651
99 Ga0075362_10009608 3300006177 Bacteria 3747
100 Ga0075362_10174977 3300006177 Bacteria 1038
101 Ga0075367_10226400 3300006178 Bacteria 1171
102 Ga0075366_10171192 3300006195 Bacteria 1317
103 Ga0075370_10108541 3300006353 Bacteria 1610
104 Ga0075370_10163784 3300006353 Bacteria 1306
105 Ga0075436_100042009 3300006914 Bacteria 3153
106 Ga0075436_100043812 3300006914 Bacteria 3085
107 Ga0079104_1000072 3300006946 Bacteria 152567
108 Ga0079104_1024106 3300006946 Bacteria 1607
109 Ga0099826_10015498 3300006948 Bacteria 5757
110 Ga0075435_100032153 3300007076 Bacteria 4142
111 Ga0075435_100136678 3300007076 Bacteria 2054
112 Ga0105244_10004531 3300009036 Bacteria 9527
113 Ga0105250_10002441 3300009092 Bacteria 9341
114 Ga0105240_10018080 3300009093 Bacteria 9478
115 Ga0105240_10059967 3300009093 Bacteria 4745
116 Ga0105240_10659871 3300009093 Bacteria 1145
117 Ga0105243_10000626 3300009148 Bacteria 35234
118 Ga0105243_10001087 3300009148 Bacteria 24856
119 Ga0105243_10395966 3300009148 Bacteria 1282
120 Ga0105242_10002680 3300009176 Bacteria 13929
121 Ga0105248_10450726 3300009177 Bacteria 1450
122 Ga0105237_10013469 3300009545 Bacteria 8573
123 Ga0105237_10115969 3300009545 Bacteria 2672
124 Ga0105238_10000031 3300009551 Bacteria 179497
125 Ga0105238_10045813 3300009551 Unclassified 4417
126 Ga0105238_10167907 3300009551 Bacteria 2170
127 Ga0105239_10004190 3300010375 Bacteria 17328
128 Ga0105239_10140218 3300010375 Unclassified 2693
129 Ga0105239_10379625 3300010375 Bacteria 1598
130 Ga0105246_10116856 3300011119 Bacteria 1970
131 Ga0157373_10010507 3300013100 Bacteria 6811
132 Ga0157371_10136823 3300013102 Bacteria 1745
133 Ga0157370_10005132 3300013104 Bacteria 14768
134 Ga0157370_10038136 3300013104 Bacteria 4650
135 Ga0157370_10184823 3300013104 Bacteria 1936
136 Ga0157369_10011614 3300013105 Bacteria 10000
137 Ga0157369_10093851 3300013105 Unclassified 3203
138 Ga0157374_10022489 3300013296 Bacteria 5624
139 Ga0157372_10030940 3300013307 Bacteria 5858
140 Ga0157372_10032723 3300013307 Bacteria 5704
141 Ga0182008_10008979 3300014497 Bacteria 5416
142 Ga0182008_10014778 3300014497 Bacteria 4083
143 Ga0182008_10049945 3300014497 Bacteria 2076
144 Ga0182008_10165910 3300014497 Bacteria 1113
145 Ga0157379_10009044 3300014968 Bacteria 8679
146 Ga0182006_1001869 3300015261 Bacteria 12046
147 Ga0182006_1003998 3300015261 Bacteria 7366
148 Ga0182006_1021085 3300015261 Bacteria 2721
149 Ga0182006_1046961 3300015261 Bacteria 1676
150 Ga0182007_10032152 3300015262 Bacteria 1783
151 Ga0183362_10010 3300015683 Bacteria 106392
152 Ga0163161_10000099 3300017792 Bacteria 83318
153 Ga0163161_10024771 3300017792 Bacteria 4242
154 Ga0213872_10006511 3300021361 Bacteria 5847
155 Ga0213875_10139718 3300021388 Unclassified 1133
156 Ga0209436_108075 3300025208 Bacteria 2133
157 Ga0209672_100425 3300025228 Bacteria 24733
158 Ga0209672_100477 3300025228 Bacteria 22499
159 Ga0209147_102731 3300025229 Bacteria 4010
160 Ga0209258_100568 3300025242 Bacteria 31666
161 Ga0207425_1000273 3300025245 Bacteria 37954
162 Ga0207425_1000614 3300025245 Bacteria 20548
163 Ga0209148_1000033 3300025254 Bacteria 555508
164 Ga0209129_1000247 3300025258 Bacteria 56623
165 Ga0209129_1003218 3300025258 Bacteria 7285
166 Ga0209129_1005512 3300025258 Bacteria 4446
167 Ga0209565_1000042 3300025263 Bacteria 239712
168 Ga0209565_1000256 3300025263 Bacteria 56528
169 Ga0209565_1002503 3300025263 Bacteria 6558
170 Ga0209673_1000071 3300025273 Bacteria 239966
171 Ga0209673_1000592 3300025273 Bacteria 56577
172 Ga0209673_1000731 3300025273 Bacteria 45565
173 Ga0209673_1001396 3300025273 Bacteria 23530
174 Ga0209130_1000366 3300025284 Bacteria 51201
175 Ga0209130_1000496 3300025284 Bacteria 40068
176 Ga0209130_1020141 3300025284 Bacteria 1532
177 Ga0209675_1000041 3300025291 Bacteria 239712
178 Ga0209675_1000814 3300025291 Bacteria 20539
179 Ga0209675_1003241 3300025291 Bacteria 7851
180 Ga0209675_1003436 3300025291 Bacteria 7534
181 Ga0209675_1004718 3300025291 Bacteria 5962
182 Ga0209676_1000048 3300025292 Bacteria 403716
183 Ga0209676_1000287 3300025292 Bacteria 103263
184 Ga0209676_1000331 3300025292 Bacteria 90857
185 Ga0209676_1000573 3300025292 Bacteria 55423
186 Ga0209676_1003204 3300025292 Bacteria 10363
187 Ga0209025_1000088 3300025294 Bacteria 255087
188 Ga0209025_1000104 3300025294 Bacteria 226895
189 Ga0209025_1000113 3300025294 Bacteria 218943
190 Ga0209025_1000710 3300025294 Bacteria 56623
191 Ga0209025_1011186 3300025294 Bacteria 5958
192 Ga0209025_1013215 3300025294 Bacteria 5210
193 Ga0209564_1000596 3300025295 Bacteria 56623
194 Ga0209564_1002077 3300025295 Bacteria 17219
195 Ga0209564_1007220 3300025295 Bacteria 5781
196 Ga0209758_1000909 3300025297 Bacteria 40123
197 Ga0209758_1008662 3300025297 Bacteria 6528
198 Ga0209050_1000012 3300025298 Bacteria 813717
199 Ga0209050_1000460 3300025298 Bacteria 72933
200 Ga0209256_1000516 3300025299 Bacteria 56623
201 Ga0209256_1000679 3300025299 Bacteria 45927
202 Ga0207426_1000058 3300025302 Bacteria 363857
203 Ga0207426_1001624 3300025302 Bacteria 17738
204 Ga0209051_1000019 3300025303 Bacteria 511268
205 Ga0209051_1000307 3300025303 Bacteria 76668
206 Ga0209051_1000441 3300025303 Bacteria 56405
207 Ga0209051_1001689 3300025303 Bacteria 17720
208 Ga0209051_1012591 3300025303 Bacteria 4084
209 Ga0209257_1000024 3300025304 Bacteria 726068
210 Ga0209257_1000057 3300025304 Bacteria 396985
211 Ga0209257_1002859 3300025304 Bacteria 16123
212 Ga0209257_1023399 3300025304 Bacteria 2173
213 Ga0207696_1003669 3300025711 Bacteria 6895
214 Ga0207655_1015566 3300025728 Bacteria 4217
215 Ga0207684_10018323 3300025910 Bacteria 5993
216 Ga0207684_10125450 3300025910 Bacteria 2203
217 Ga0207695_10000480 3300025913 Bacteria 85456
218 Ga0207695_10409384 3300025913 Bacteria 1240
219 Ga0207671_10005593 3300025914 Bacteria 11543
220 Ga0207657_10003161 3300025919 Bacteria 17613
221 Ga0207652_10020943 3300025921 Bacteria 5392
222 Ga0207646_10026591 3300025922 Bacteria 5279
223 Ga0207646_10061580 3300025922 Bacteria 3349
224 Ga0207694_10000062 3300025924 Bacteria 140156
225 Ga0207694_10125034 3300025924 Bacteria 2057
226 Ga0207694_10132921 3300025924 Bacteria 1995
227 Ga0207700_10007917 3300025928 Bacteria 6540
228 Ga0207664_10067181 3300025929 Bacteria 2876
229 Ga0207706_10017645 3300025933 Bacteria 6430
230 Ga0207709_10000104 3300025935 Bacteria 130964
231 Ga0207709_10000168 3300025935 Bacteria 88059
232 Ga0207709_10009625 3300025935 Bacteria 5322
233 Ga0207709_10189995 3300025935 Bacteria 1458
234 Ga0207669_10240713 3300025937 Bacteria 1341
235 Ga0207679_10213058 3300025945 Bacteria 1621
236 Ga0207667_10000044 3300025949 Bacteria 248251
237 Ga0207667_10084588 3300025949 Bacteria 3284
238 Ga0207667_10234597 3300025949 Bacteria 1878
239 Ga0207667_10280997 3300025949 Bacteria 1701
240 Ga0207651_10356181 3300025960 Bacteria 1234
241 Ga0207640_10336683 3300025981 Bacteria 1207
242 Ga0207658_10644855 3300025986 Bacteria 954
243 Ga0207639_10162898 3300026041 Bacteria 1881
244 Ga0207702_10200848 3300026078 Unclassified 1848
245 Ga0207641_10002977 3300026088 Bacteria 15329
246 Ga0207641_10270048 3300026088 Unclassified 1596
247 Ga0207641_10538469 3300026088 Bacteria 1137
248 Ga0207648_10125118 3300026089 Bacteria 2261
249 Ga0207674_10067045 3300026116 Bacteria 3614
250 Ga0207674_10655345 3300026116 Bacteria 1014
251 Ga0209281_1000002 3300027111 Bacteria 1924012
252 Ga0209281_1017379 3300027111 Bacteria 1459
253 Ga0209282_1003079 3300027666 Bacteria 9816
254 Ga0265318_10120773 3300028577 Bacteria 963
255 Ga0307515_10000014 3300028794 Bacteria 562358
256 Ga0265338_10000705 3300028800 Bacteria 57138
257 Ga0265762_1005907 3300030760 Bacteria 2192
258 Ga0265320_10040180 3300031240 Bacteria 2334
259 Ga0265329_10092504 3300031242 Bacteria 960
260 Ga0265331_10062388 3300031250 Bacteria 1758
261 Ga0265327_10003729 3300031251 Bacteria 14174
262 Ga0307513_10233976 3300031456 Bacteria 1648
263 Ga0307408_100107725 3300031548 Bacteria 2134
264 Ga0307405_10035737 3300031731 Bacteria 2970
265 Ga0307412_10457037 3300031911 Bacteria 1053
266 Ga0307411_10376356 3300032005 Bacteria 1166
267 Ga0316583_10022715 3300032133 Bacteria 2245
268 Ga0373956_0036493 3300035119 Bacteria 2170
269 Ga0373957_0092297 3300035120 Bacteria 1205
270 Ga0373955_0137695 3300035172 Bacteria 1429
271 Ga0373933_0111601 3300035724 Bacteria 1706
272 Ga0395900_0413361 3300037418 Bacteria 1311
273 Ga0395905_0000658 3300037471 Bacteria 45924
274 Ga0395905_0036861 3300037471 Bacteria 4592
275 Ga0395905_0060925 3300037471 Bacteria 3529
276 Ga0436364_1089698 3300037853 Unclassified 3004
277 Ga0395901_0176124 3300038443 Bacteria 2244
278 Ga0395901_0376850 3300038443 Bacteria 1461
279 Ga0436361_1190221 3300039447 Bacteria 43680
280 Ga0436363_0693963 3300039450 Bacteria 10215
281 Ga0439465_0005707 3300041413 Bacteria 3962
282 Ga0439448_0010328 3300042005 Bacteria 2767
283 Ga0439449_0000724 3300042007 Bacteria 12645
284 Ga0439462_0013531 3300042015 Bacteria 2091
285 Ga0439446_0037885 3300042156 Bacteria 1413
286 Ga0450908_005034 3300042184 Bacteria 2536
287 Ga0466969_0058000 3300044656 Bacteria 1886
288 Ga0466972_0008663 3300044658 Bacteria 5102
289 Ga0466965_0057218 3300044683 Bacteria 1943
290 Ga0466965_0062419 3300044683 Bacteria 1864
291 Ga0466965_0078434 3300044683 Bacteria 1668
292 Ga0466966_0000043 3300044684 Bacteria 93998
293 Ga0466966_0009182 3300044684 Bacteria 6546
294 Ga0466966_0160190 3300044684 Bacteria 1370
295 Ga0466961_0000072 3300044693 Bacteria 62185
296 Ga0466961_0002650 3300044693 Bacteria 11103
297 Ga0466961_0006057 3300044693 Bacteria 7667
298 Ga0466961_0022796 3300044693 Bacteria 4027
299 Ga0466961_0154449 3300044693 Bacteria 1432
300 Ga0466961_0213718 3300044693 Bacteria 1190
301 Ga0466963_0005422 3300044694 Bacteria 7469
302 Ga0466963_0019923 3300044694 Bacteria 4214
303 Ga0466963_0074923 3300044694 Bacteria 2283
304 Ga0466964_0012414 3300044706 Bacteria 3223
305 Ga0466964_0013091 3300044706 Bacteria 3144
306 Ga0466971_0015174 3300044719 Bacteria 3390
307 Ga0466968_0002467 3300044735 Bacteria 6791
308 Ga0466968_0033611 3300044735 Bacteria 2137
309 Ga0466970_0121772 3300044765 Bacteria 1429
310 Ga0466957_0015288 3300044842 Bacteria 4482
311 Ga0466957_0027732 3300044842 Bacteria 3367
312 Ga0466960_0031086 3300044901 Bacteria 2461
313 Ga0466959_0003418 3300045049 Bacteria 10380
314 Ga0466959_0007476 3300045049 Bacteria 7669
315 Ga0466959_0040408 3300045049 Bacteria 3445
316 Ga0466959_0269928 3300045049 Bacteria 1169
317 Ga0451576_0449487 3300045051 Unclassified 1353
318 Ga0466958_0004757 3300045836 Bacteria 7218
319 Ga0466958_0004945 3300045836 Bacteria 7110
320 Ga0466958_0006727 3300045836 Bacteria 6276
321 Ga0466967_0000968 3300045976 Bacteria 15576
322 Ga0466967_0017169 3300045976 Bacteria 5736
323 Ga0466967_0148957 3300045976 Bacteria 2185
324 Ga0466967_0211738 3300045976 Bacteria 1838
325 Ga0495627_003666 3300046453 Bacteria 6666
326 Ga0495629_0187325 3300046459 Bacteria 1433
327 Ga0495651_0035889 3300046462 Bacteria 3859
328 Ga0495580_0017565 3300046472 Bacteria 5347
329 Ga0495580_0035282 3300046472 Bacteria 3597
330 Ga0495610_0005191 3300046512 Bacteria 9327
331 Ga0495616_0009658 3300046513 Bacteria 5624
332 Ga0495620_0000768 3300046515 Bacteria 19677
333 Ga0495628_0186826 3300046516 Bacteria 1566
334 Ga0495631_0005042 3300046518 Bacteria 6956
335 Ga0495652_0428265 3300046529 Bacteria 931
336 Ga0495654_0026723 3300046530 Bacteria 2965
337 Ga0495587_0149047 3300046536 Bacteria 1333
338 Ga0495645_0129618 3300046543 Bacteria 1769
339 Ga0495668_0119236 3300046616 Bacteria 1443
340 Ga0495634_0108762 3300046642 Bacteria 1784
341 Ga0495625_0074301 3300046660 Bacteria 2381
342 Ga0495657_0058921 3300046675 Bacteria 2548
343 Ga0495658_0050937 3300046683 Bacteria 2344
344 Ga0495613_0221705 3300046689 Bacteria 1327
345 Ga0495671_0001568 3300046692 Bacteria 15149
346 Ga0495676_0028286 3300047321 Bacteria 4789
347 Ga0495680_0031154 3300047322 Bacteria 4345
348 Ga0495675_0163746 3300047444 Bacteria 1369
349 Ga0495684_0048713 3300047471 Bacteria 3239
350 Ga0495593_0001026 3300047673 Bacteria 16386
351 Ga0495602_0379077 3300048088 Bacteria 1014
352 Ga0496100_0000473 3300048903 Bacteria 19248
353 Ga0496100_0018514 3300048903 Unclassified 4133
354 Ga0496100_0358676 3300048903 Bacteria 1103
355 Ga0496101_0040540 3300048904 Bacteria 3316
356 Ga0496101_0044245 3300048904 Bacteria 3185
357 Ga0496102_0000224 3300048905 Bacteria 74893
358 Ga0496102_0025152 3300048905 Bacteria 5296
359 Ga0496102_0046888 3300048905 Bacteria 3926
360 Ga0496102_0130095 3300048905 Bacteria 2355
361 Ga0496102_0140622 3300048905 Bacteria 2263
362 Ga0496103_0000019 3300048906 Bacteria 234311
363 Ga0496103_0224344 3300048906 Unclassified 1208
364 Ga0496104_0024985 3300048907 Bacteria 5504
365 Ga0496104_0027789 3300048907 Bacteria 5237
366 Ga0496105_0185067 3300048908 Bacteria 1704
367 Ga0496108_0029060 3300048911 Bacteria 4576
368 Ga0496108_0058834 3300048911 Bacteria 3231
369 Ga0496108_0099793 3300048911 Bacteria 2475
370 Ga0496109_0120025 3300048912 Bacteria 2449
371 Ga0496109_0151999 3300048912 Bacteria 2167
372 Ga0496109_0602930 3300048912 Bacteria 1034
373 Ga0496110_0310159 3300048913 Bacteria 1437
374 Ga0496110_0363725 3300048913 Bacteria 1318
375 Ga0496110_0368638 3300048913 Bacteria 1309
376 Ga0496111_0073909 3300048914 Bacteria 2482
377 Ga0496111_0096560 3300048914 Bacteria 2169
378 Ga0496111_0153711 3300048914 Bacteria 1707
379 Ga0496112_0082196 3300048915 Bacteria 3186
380 Ga0496112_0157045 3300048915 Bacteria 2241
381 Ga0496112_0341376 3300048915 Bacteria 1441
382 Ga0496115_0410014 3300048918 Bacteria 1099
383 Ga0496116_0000339 3300048919 Bacteria 74892
384 Ga0496116_0013262 3300048919 Bacteria 6662
385 Ga0496116_0038488 3300048919 Bacteria 3319
386 Ga0496116_0109901 3300048919 Bacteria 1623
387 Ga0496117_0000101 3300048920 Bacteria 191796
388 Ga0496117_0007447 3300048920 Bacteria 10692
389 Ga0496117_0102492 3300048920 Bacteria 1806
390 Ga0496118_0000377 3300048921 Bacteria 74911
391 Ga0496118_0005503 3300048921 Bacteria 14373
392 Ga0496118_0022859 3300048921 Bacteria 5452
393 Ga0496118_0070906 3300048921 Bacteria 2512
394 Ga0496118_0100189 3300048921 Bacteria 1961
395 Ga0496119_0001183 3300048922 Bacteria 32722
396 Ga0496119_0025340 3300048922 Bacteria 4145
397 Ga0496119_0105510 3300048922 Bacteria 1574
398 Ga0496120_0002848 3300048923 Bacteria 16664
399 Ga0496121_0000601 3300048924 Bacteria 67662
400 Ga0496121_0002686 3300048924 Bacteria 26596
401 Ga0496121_0048676 3300048924 Bacteria 3604
402 Ga0496121_0072794 3300048924 Bacteria 2757
403 Ga0496121_0082705 3300048924 Bacteria 2537
404 Ga0496122_0000033 3300048925 Bacteria 324104
405 Ga0496123_0000301 3300048926 Bacteria 96158
406 Ga0496123_0033241 3300048926 Bacteria 3714
407 Ga0496123_0101457 3300048926 Bacteria 1673
408 Ga0496124_0016849 3300048927 Bacteria 6926
409 Ga0496124_0057449 3300048927 Bacteria 3278
410 Ga0496124_0101100 3300048927 Bacteria 2336
411 Ga0496124_0120230 3300048927 Bacteria 2100
412 Ga0496124_0151594 3300048927 Bacteria 1817
413 Ga0496125_0004456 3300048928 Bacteria 16168
414 Ga0496125_0032250 3300048928 Bacteria 4656
415 Ga0496125_0068002 3300048928 Bacteria 2804
416 Ga0496125_0192489 3300048928 Bacteria 1345
417 Ga0496126_0000523 3300048929 Bacteria 74906
418 Ga0496126_0030831 3300048929 Bacteria 5076
419 Ga0501031_0023847 3300049568 Bacteria 3989
420 Ga0501032_0037789 3300049569 Bacteria 3290
421 Ga0501032_0151934 3300049569 Bacteria 1522
422 Ga0501033_0011386 3300049570 Bacteria 6807
423 Ga0501036_0092988 3300049572 Bacteria 2548
424 Ga0501036_0109885 3300049572 Bacteria 2329
425 Ga0501037_0004916 3300049573 Bacteria 9726
426 Ga0501038_0021133 3300049574 Bacteria 5846
427 Ga0501039_0198712 3300049575 Bacteria 1576
428 Ga0501040_0023245 3300049576 Bacteria 4155
429 Ga0501040_0057765 3300049576 Bacteria 2664
430 Ga0501041_0023746 3300049577 Bacteria 3676
431 Ga0501041_0236559 3300049577 Bacteria 1147
432 Ga0501042_0056382 3300049578 Bacteria 2804
433 Ga0501043_0026761 3300049579 Bacteria 4525
434 Ga0501046_0009792 3300049580 Bacteria 8265
435 Ga0501046_0392642 3300049580 Bacteria 1003
436 Ga0501047_0511714 3300049581 Bacteria 1027
437 Ga0501048_0043709 3300049582 Bacteria 3206
438 Ga0501048_0065223 3300049582 Bacteria 2575
439 Ga0501067_0146363 3300049583 Bacteria 1316
440 Ga0501068_0011867 3300049584 Bacteria 4925
441 Ga0501069_0001557 3300049585 Bacteria 11340
442 Ga0501070_0087579 3300049586 Bacteria 2577
443 Ga0501071_0002515 3300049587 Bacteria 11157
444 Ga0501072_0079655 3300049588 Bacteria 2594
445 Ga0501073_0002955 3300049589 Bacteria 12752
446 Ga0501075_0330071 3300049591 Bacteria 1162
447 Ga0501076_0062751 3300049592 Bacteria 2960
448 Ga0501076_0120429 3300049592 Bacteria 2125
449 Ga0501077_0016006 3300049593 Bacteria 4724
450 Ga0501079_0077288 3300049741 Bacteria 2575
451 Ga0501080_0103134 3300049742 Bacteria 2645
452 Ga0501080_0428880 3300049742 Bacteria 1187
453 Ga0501081_0097328 3300049743 Bacteria 2076
454 Ga0501081_0259383 3300049743 Bacteria 1270
455 Ga0501083_0026517 3300049744 Bacteria 4004
456 Ga0501035_0021769 3300049822 Bacteria 5893
457 Ga0501044_0052197 3300049823 Bacteria 4214
458 Ga0501044_0553726 3300049823 Bacteria 1047
459 Ga0501045_0120825 3300049824 Bacteria 1945
460 nmdc:mga03683_2333_c1 3300050489 Bacteria 5873
461 nmdc:mga03683_66855_c1 3300050489 Bacteria 1529
462 nmdc:mga0yw44_4066_c1 3300050492 Bacteria 6626
463 nmdc:mga0k408_4257_c1 3300050493 Bacteria 7595
464 nmdc:mga0k408_4556_c1 3300050493 Bacteria 7360
465 nmdc:mga07m45_129185_c1 3300050496 Bacteria 1462
466 nmdc:mga07m45_1725_c1 3300050496 Bacteria 10074
467 nmdc:mga0n895_412136_c1 3300050512 Bacteria 1366
468 nmdc:mga0n895_774136_c1 3300050512 Bacteria 951
469 nmdc:mga0rr50_71159_c1 3300050513 Bacteria 2653
470 nmdc:mga08x19_4775_c1 3300050514 Bacteria 8035
471 nmdc:mga08x19_4925_c1 3300050514 Bacteria 7884
472 Ga0500610_0001908 3300053079 Bacteria 7408
473 Ga0500651_0000158 3300053093 Bacteria 43443
474 Ga0500571_000077 3300053110 Bacteria 30794
475 Ga0500593_007845 3300053117 Bacteria 4364
476 Ga0500658_0000053 3300053134 Bacteria 61630
477 Ga0500658_0000058 3300053134 Bacteria 55299
478 Ga0500568_0004374 3300053139 Bacteria 7562
479 Ga0500574_000584 3300053141 Bacteria 4702
480 Ga0500616_0044355 3300053153 Bacteria 2372
481 Ga0500624_003264 3300053157 Bacteria 2131
482 Ga0500627_0004592 3300053158 Bacteria 4463
483 Ga0501084_0008854 3300054114 Bacteria 8332
484 Ga0501084_0305993 3300054114 Bacteria 1342
485 Ga0501084_0611407 3300054114 Bacteria 921
486 Ga0501082_0121639 3300060353 Bacteria 2262
487 Ga0466962_0003381 3300061719 Bacteria 7592
488 Ga0530510_0215420 3300061734 Bacteria 1427

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10096586 rootH2_100965863 230
2 3300003323 rootH1_10006638 rootH1_100066384 230
3 3300044658 Ga0466972_0008663 Ga0466972_0008663_426_1220 236
4 3300044765 Ga0466970_0121772 Ga0466970_0121772_280_1074 236
5 3300005445 Ga0070708_100015229 Ga0070708_1000152293 242
6 3300005467 Ga0070706_100145177 Ga0070706_1001451772 242
7 3300005468 Ga0070707_100023098 Ga0070707_1000230982 242
8 3300005536 Ga0070697_100038419 Ga0070697_1000384193 242
9 3300025910 Ga0207684_10125450 Ga0207684_101254502 242
10 3300025922 Ga0207646_10026591 Ga0207646_100265911 242
11 3300013296 Ga0157374_10022489 Ga0157374_100224893 251
12 3300037471 Ga0395905_0036861 Ga0395905_0036861_2140_2928 252
13 3300045051 Ga0451576_0449487 Ga0451576_0449487_24_782 252
14 3300049568 Ga0501031_0023847 Ga0501031_0023847_2285_3073 253
15 3300049569 Ga0501032_0037789 Ga0501032_0037789_2250_3038 253
16 3300049570 Ga0501033_0011386 Ga0501033_0011386_4896_5684 253
17 3300049572 Ga0501036_0109885 Ga0501036_0109885_291_1079 253
18 3300049573 Ga0501037_0004916 Ga0501037_0004916_4559_5347 253
19 3300049574 Ga0501038_0021133 Ga0501038_0021133_1232_2020 253
20 3300049575 Ga0501039_0198712 Ga0501039_0198712_778_1566 253
21 3300049576 Ga0501040_0023245 Ga0501040_0023245_1694_2482 253
22 3300049577 Ga0501041_0023746 Ga0501041_0023746_11_799 253
23 3300049579 Ga0501043_0026761 Ga0501043_0026761_1124_1912 253
24 3300049580 Ga0501046_0009792 Ga0501046_0009792_292_1080 253
25 3300049582 Ga0501048_0043709 Ga0501048_0043709_1260_2048 253
26 3300049584 Ga0501068_0011867 Ga0501068_0011867_1260_2048 253
27 3300049585 Ga0501069_0001557 Ga0501069_0001557_4133_4921 253
28 3300049586 Ga0501070_0087579 Ga0501070_0087579_63_851 253
29 3300049589 Ga0501073_0002955 Ga0501073_0002955_5777_6565 253
30 3300049591 Ga0501075_0330071 Ga0501075_0330071_316_1104 253
31 3300049593 Ga0501077_0016006 Ga0501077_0016006_457_1245 253
32 3300049742 Ga0501080_0103134 Ga0501080_0103134_1566_2354 253
33 3300049743 Ga0501081_0097328 Ga0501081_0097328_83_871 253
34 3300049744 Ga0501083_0026517 Ga0501083_0026517_2878_3666 253
35 3300049822 Ga0501035_0021769 Ga0501035_0021769_5095_5883 253
36 3300049823 Ga0501044_0052197 Ga0501044_0052197_992_1780 253
37 3300054114 Ga0501084_0305993 Ga0501084_0305993_496_1284 253
38 3300060353 Ga0501082_0121639 Ga0501082_0121639_316_1104 253
39 iso_pu_bacteria 2904770941 2904772454 256
40 3300048924 Ga0496121_0082705 Ga0496121_0082705_232_1050 257
41 iso_pu_bacteria 8003314358 8003315447 257
42 3300042007 Ga0439449_0000724 Ga0439449_0000724_8571_9347 258
43 3300042015 Ga0439462_0013531 Ga0439462_0013531_313_1089 258
44 3300042156 Ga0439446_0037885 Ga0439446_0037885_559_1335 258
45 3300044684 Ga0466966_0160190 Ga0466966_0160190_64_840 258
46 3300044735 Ga0466968_0002467 Ga0466968_0002467_2655_3431 258
47 3300048925 Ga0496122_0000033 Ga0496122_0000033_13454_14302 258
48 3300048926 Ga0496123_0000301 Ga0496123_0000301_72224_73072 258
49 3300048929 Ga0496126_0030831 Ga0496126_0030831_1727_2575 258
50 iso_pu_bacteria 2574179768 2574433054 258
51 iso_pu_bacteria 2600255067 2600815069 258
52 iso_pu_bacteria 2773857762 2774391674 258
53 iso_pu_bacteria 2858688981 2858690878 258
54 iso_pu_bacteria 2858950400 2858952525 258
55 iso_pu_bacteria 2891968417 2891971271 258
56 iso_pu_bacteria 2894023352 2894025354 258
57 iso_pu_bacteria 2895511927 2895515191 258
58 iso_pu_bacteria 2904439833 2904442683 258
59 iso_pu_bacteria 2904530477 2904535108 258
60 iso_pu_bacteria 2904541872 2904548309 258
61 iso_pu_bacteria 2904584206 2904588550 258
62 iso_pu_bacteria 2904589729 2904594376 258
63 iso_pu_bacteria 2904601388 2904604791 258
64 iso_pu_bacteria 2919079590 2919083019 258
65 iso_pu_bacteria 2928130867 2928132896 258
66 iso_pu_bacteria 2929160207 2929163299 258
67 iso_pu_bacteria 2941479691 2941480797 258
68 iso_pu_bacteria 639633007 639787085 258
69 iso_pu_bacteria 8002745576 8002747212 258
70 3300038443 Ga0395901_0176124 Ga0395901_0176124_410_1192 259
71 3300048928 Ga0496125_0032250 Ga0496125_0032250_1687_2505 259
72 iso_pu_bacteria 2513020051 2513230471 259
73 iso_pu_bacteria 2599185214 2599627553 259
74 iso_pu_bacteria 2599185226 2599677624 259
75 iso_pu_bacteria 2599185227 2599685279 259
76 iso_pu_bacteria 2599185229 2599697072 259
77 iso_pu_bacteria 2643221628 2644159793 259
78 iso_pu_bacteria 2643221658 2644325411 259
79 iso_pu_bacteria 2643221672 2644399145 259
80 iso_pu_bacteria 2643221683 2644467316 259
81 iso_pu_bacteria 2721755523 2722885472 259
82 iso_pu_bacteria 2738541277 2738718471 259
83 iso_pu_bacteria 2738541307 2738882930 259
84 iso_pu_bacteria 2738543019 2739281658 259
85 iso_pu_bacteria 2818991446 2819600663 259
86 iso_pu_bacteria 2831265667 2831268045 259
87 iso_pu_bacteria 2838054893 2838061215 259
88 iso_pu_bacteria 2839138175 2839140328 259
89 iso_pu_bacteria 2885198086 2885203186 259
90 iso_pu_bacteria 2885211737 2885216417 259
91 iso_pu_bacteria 2899924645 2899928190 259
92 iso_pu_bacteria 2904449895 2904453492 259
93 iso_pu_bacteria 2904456579 2904463068 259
94 iso_pu_bacteria 2928037797 2928041140 259
95 iso_pu_bacteria 2928044640 2928047982 259
96 iso_pu_bacteria 2928051484 2928055822 259
97 iso_pu_bacteria 2928064002 2928066704 259
98 iso_pu_bacteria 2928070936 2928075197 259
99 iso_pu_bacteria 2928084124 2928088380 259
100 iso_pu_bacteria 2929520902 2929525082 259
101 iso_pu_bacteria 2945909444 2945909996 259
102 iso_pu_bacteria 2945984333 2945987983 259
103 3300025981 Ga0207640_10336683 Ga0207640_103366832 260
104 3300054114 Ga0501084_0611407 Ga0501084_0611407_102_884 260
105 iso_pu_bacteria 2891373044 2891374050 260
106 3300025294 Ga0209025_1000088 Ga0209025_100008812 261
107 3300037471 Ga0395905_0000658 Ga0395905_0000658_13700_14485 261
108 3300037471 Ga0395905_0060925 Ga0395905_0060925_1331_2116 261
109 3300044901 Ga0466960_0031086 Ga0466960_0031086_633_1418 261
110 3300048928 Ga0496125_0192489 Ga0496125_0192489_463_1251 261
111 3300049823 Ga0501044_0553726 Ga0501044_0553726_178_963 261
112 3300050489 nmdc:mga03683_66855_c1 nmdc:mga03683_66855_c1_477_1265 261
113 3300050493 nmdc:mga0k408_4556_c1 nmdc:mga0k408_4556_c1_2127_2915 261
114 iso_pu_bacteria 2990256926 2990257009 261
115 3300003187 JGI25151J46595_10017190 JGI25151J46595_100171903 262
116 3300003771 Ga0055526_1006457 Ga0055526_10064575 262
117 3300003781 Ga0055536_1000296 Ga0055536_10002965 262
118 3300003784 Ga0055534_1002835 Ga0055534_10028354 262
119 3300005336 Ga0070680_100309258 Ga0070680_1003092581 262
120 3300005356 Ga0070674_100566934 Ga0070674_1005669341 262
121 3300005436 Ga0070713_100015560 Ga0070713_1000155602 262
122 3300005436 Ga0070713_100160004 Ga0070713_1001600042 262
123 3300005436 Ga0070713_100229074 Ga0070713_1002290742 262
124 3300005445 Ga0070708_100411890 Ga0070708_1004118902 262
125 3300005467 Ga0070706_100132115 Ga0070706_1001321151 262
126 3300005468 Ga0070707_100019130 Ga0070707_1000191305 262
127 3300005471 Ga0070698_100229018 Ga0070698_1002290182 262
128 3300005518 Ga0070699_100244282 Ga0070699_1002442822 262
129 3300005518 Ga0070699_100463358 Ga0070699_1004633581 262
130 3300005536 Ga0070697_100000085 Ga0070697_10000008537 262
131 3300005536 Ga0070697_100038142 Ga0070697_1000381423 262
132 3300005536 Ga0070697_100069008 Ga0070697_1000690081 262
133 3300005536 Ga0070697_100105375 Ga0070697_1001053752 262
134 3300005536 Ga0070697_100106803 Ga0070697_1001068032 262
135 3300005536 Ga0070697_100173777 Ga0070697_1001737772 262
136 3300005563 Ga0068855_100001171 Ga0068855_10000117117 262
137 3300005563 Ga0068855_100025390 Ga0068855_1000253904 262
138 3300005577 Ga0068857_100051266 Ga0068857_1000512664 262
139 3300005578 Ga0068854_100001144 Ga0068854_10000114411 262
140 3300005618 Ga0068864_100087139 Ga0068864_1000871393 262
141 3300005834 Ga0068851_10300636 Ga0068851_103006361 262
142 3300005841 Ga0068863_100002749 Ga0068863_10000274916 262
143 3300005841 Ga0068863_100464370 Ga0068863_1004643702 262
144 3300006028 Ga0070717_10007019 Ga0070717_100070194 262
145 3300006028 Ga0070717_10028839 Ga0070717_100288392 262
146 3300006914 Ga0075436_100042009 Ga0075436_1000420092 262
147 3300006914 Ga0075436_100043812 Ga0075436_1000438122 262
148 3300007076 Ga0075435_100032153 Ga0075435_1000321532 262
149 3300007076 Ga0075435_100136678 Ga0075435_1001366782 262
150 3300009093 Ga0105240_10018080 Ga0105240_100180803 262
151 3300009093 Ga0105240_10059967 Ga0105240_100599673 262
152 3300009093 Ga0105240_10659871 Ga0105240_106598712 262
153 3300009177 Ga0105248_10450726 Ga0105248_104507262 262
154 3300009545 Ga0105237_10013469 Ga0105237_100134697 262
155 3300009545 Ga0105237_10115969 Ga0105237_101159692 262
156 3300009551 Ga0105238_10000031 Ga0105238_1000003171 262
157 3300009551 Ga0105238_10045813 Ga0105238_100458131 262
158 3300010375 Ga0105239_10004190 Ga0105239_1000419015 262
159 3300010375 Ga0105239_10140218 Ga0105239_101402182 262
160 3300013100 Ga0157373_10010507 Ga0157373_100105075 262
161 3300013104 Ga0157370_10184823 Ga0157370_101848232 262
162 3300013105 Ga0157369_10093851 Ga0157369_100938513 262
163 3300013307 Ga0157372_10032723 Ga0157372_100327232 262
164 3300014497 Ga0182008_10049945 Ga0182008_100499452 262
165 3300014497 Ga0182008_10165910 Ga0182008_101659102 262
166 3300014968 Ga0157379_10009044 Ga0157379_100090444 262
167 3300015261 Ga0182006_1001869 Ga0182006_100186910 262
168 3300015261 Ga0182006_1021085 Ga0182006_10210852 262
169 3300021388 Ga0213875_10139718 Ga0213875_101397181 262
170 3300025228 Ga0209672_100425 Ga0209672_10042512 262
171 3300025291 Ga0209675_1004718 Ga0209675_10047184 262
172 3300025292 Ga0209676_1000331 Ga0209676_10003315 262
173 3300025294 Ga0209025_1000113 Ga0209025_100011386 262
174 3300025294 Ga0209025_1011186 Ga0209025_10111864 262
175 3300025295 Ga0209564_1007220 Ga0209564_10072204 262
176 3300025913 Ga0207695_10000480 Ga0207695_1000048045 262
177 3300025914 Ga0207671_10005593 Ga0207671_100055935 262
178 3300025919 Ga0207657_10003161 Ga0207657_1000316110 262
179 3300025921 Ga0207652_10020943 Ga0207652_100209433 262
180 3300025922 Ga0207646_10061580 Ga0207646_100615803 262
181 3300025924 Ga0207694_10000062 Ga0207694_1000006261 262
182 3300025924 Ga0207694_10132921 Ga0207694_101329211 262
183 3300025928 Ga0207700_10007917 Ga0207700_100079174 262
184 3300025929 Ga0207664_10067181 Ga0207664_100671813 262
185 3300025933 Ga0207706_10017645 Ga0207706_100176453 262
186 3300025937 Ga0207669_10240713 Ga0207669_102407132 262
187 3300025949 Ga0207667_10000044 Ga0207667_10000044145 262
188 3300025949 Ga0207667_10084588 Ga0207667_100845884 262
189 3300025949 Ga0207667_10234597 Ga0207667_102345971 262
190 3300026078 Ga0207702_10200848 Ga0207702_102008482 262
191 3300026088 Ga0207641_10002977 Ga0207641_1000297715 262
192 3300026088 Ga0207641_10270048 Ga0207641_102700482 262
193 3300026088 Ga0207641_10538469 Ga0207641_105384692 262
194 3300026116 Ga0207674_10067045 Ga0207674_100670453 262
195 3300028577 Ga0265318_10120773 Ga0265318_101207731 262
196 3300028794 Ga0307515_10000014 Ga0307515_10000014461 262
197 3300028800 Ga0265338_10000705 Ga0265338_1000070557 262
198 3300030760 Ga0265762_1005907 Ga0265762_10059072 262
199 3300031240 Ga0265320_10040180 Ga0265320_100401802 262
200 3300031242 Ga0265329_10092504 Ga0265329_100925041 262
201 3300031250 Ga0265331_10062388 Ga0265331_100623882 262
202 3300031251 Ga0265327_10003729 Ga0265327_1000372910 262
203 3300032133 Ga0316583_10022715 Ga0316583_100227153 262
204 3300035119 Ga0373956_0036493 Ga0373956_0036493_1269_2057 262
205 3300035120 Ga0373957_0092297 Ga0373957_0092297_193_981 262
206 3300035172 Ga0373955_0137695 Ga0373955_0137695_216_1004 262
207 3300035724 Ga0373933_0111601 Ga0373933_0111601_93_881 262
208 3300037418 Ga0395900_0413361 Ga0395900_0413361_427_1215 262
209 3300037853 Ga0436364_1089698 Ga0436364_1089698_566_1369 262
210 3300038443 Ga0395901_0376850 Ga0395901_0376850_579_1367 262
211 3300039450 Ga0436363_0693963 Ga0436363_0693963_6692_7492 262
212 3300042005 Ga0439448_0010328 Ga0439448_0010328_1870_2658 262
213 3300044656 Ga0466969_0058000 Ga0466969_0058000_100_888 262
214 3300044683 Ga0466965_0057218 Ga0466965_0057218_180_968 262
215 3300044683 Ga0466965_0062419 Ga0466965_0062419_469_1257 262
216 3300044683 Ga0466965_0078434 Ga0466965_0078434_205_993 262
217 3300044684 Ga0466966_0000043 Ga0466966_0000043_86197_86985 262
218 3300044684 Ga0466966_0009182 Ga0466966_0009182_1621_2409 262
219 3300044693 Ga0466961_0000072 Ga0466961_0000072_41526_42314 262
220 3300044693 Ga0466961_0002650 Ga0466961_0002650_10016_10804 262
221 3300044693 Ga0466961_0006057 Ga0466961_0006057_513_1301 262
222 3300044693 Ga0466961_0022796 Ga0466961_0022796_1140_1928 262
223 3300044693 Ga0466961_0154449 Ga0466961_0154449_19_807 262
224 3300044693 Ga0466961_0213718 Ga0466961_0213718_211_1002 262
225 3300044694 Ga0466963_0005422 Ga0466963_0005422_6504_7292 262
226 3300044694 Ga0466963_0019923 Ga0466963_0019923_2434_3222 262
227 3300044694 Ga0466963_0074923 Ga0466963_0074923_1175_1963 262
228 3300044706 Ga0466964_0012414 Ga0466964_0012414_1679_2467 262
229 3300044706 Ga0466964_0013091 Ga0466964_0013091_1952_2740 262
230 3300044719 Ga0466971_0015174 Ga0466971_0015174_1719_2507 262
231 3300044735 Ga0466968_0033611 Ga0466968_0033611_247_1035 262
232 3300044842 Ga0466957_0015288 Ga0466957_0015288_2506_3294 262
233 3300044842 Ga0466957_0027732 Ga0466957_0027732_1074_1862 262
234 3300045049 Ga0466959_0003418 Ga0466959_0003418_2268_3056 262
235 3300045049 Ga0466959_0007476 Ga0466959_0007476_1063_1851 262
236 3300045049 Ga0466959_0040408 Ga0466959_0040408_257_1045 262
237 3300045049 Ga0466959_0269928 Ga0466959_0269928_92_883 262
238 3300045836 Ga0466958_0004757 Ga0466958_0004757_3078_3866 262
239 3300045836 Ga0466958_0004945 Ga0466958_0004945_6312_7100 262
240 3300045836 Ga0466958_0006727 Ga0466958_0006727_4923_5711 262
241 3300045976 Ga0466967_0000968 Ga0466967_0000968_10779_11567 262
242 3300045976 Ga0466967_0017169 Ga0466967_0017169_3301_4089 262
243 3300045976 Ga0466967_0148957 Ga0466967_0148957_402_1190 262
244 3300045976 Ga0466967_0211738 Ga0466967_0211738_316_1104 262
245 3300046462 Ga0495651_0035889 Ga0495651_0035889_813_1601 262
246 3300046472 Ga0495580_0017565 Ga0495580_0017565_3313_4101 262
247 3300046472 Ga0495580_0035282 Ga0495580_0035282_1097_1885 262
248 3300046516 Ga0495628_0186826 Ga0495628_0186826_109_897 262
249 3300046529 Ga0495652_0428265 Ga0495652_0428265_133_921 262
250 3300046536 Ga0495587_0149047 Ga0495587_0149047_489_1277 262
251 3300046642 Ga0495634_0108762 Ga0495634_0108762_162_950 262
252 3300046675 Ga0495657_0058921 Ga0495657_0058921_43_831 262
253 3300046689 Ga0495613_0221705 Ga0495613_0221705_12_800 262
254 3300047322 Ga0495680_0031154 Ga0495680_0031154_2040_2828 262
255 3300047444 Ga0495675_0163746 Ga0495675_0163746_490_1278 262
256 3300047471 Ga0495684_0048713 Ga0495684_0048713_1956_2744 262
257 3300048088 Ga0495602_0379077 Ga0495602_0379077_101_889 262
258 3300048903 Ga0496100_0000473 Ga0496100_0000473_6785_7573 262
259 3300048903 Ga0496100_0018514 Ga0496100_0018514_3190_3978 262
260 3300048904 Ga0496101_0044245 Ga0496101_0044245_2094_2882 262
261 3300048905 Ga0496102_0000224 Ga0496102_0000224_13867_14655 262
262 3300048905 Ga0496102_0025152 Ga0496102_0025152_1124_1912 262
263 3300048905 Ga0496102_0046888 Ga0496102_0046888_1490_2311 262
264 3300048906 Ga0496103_0000019 Ga0496103_0000019_13874_14662 262
265 3300048906 Ga0496103_0224344 Ga0496103_0224344_280_1068 262
266 3300048907 Ga0496104_0024985 Ga0496104_0024985_3476_4264 262
267 3300048907 Ga0496104_0027789 Ga0496104_0027789_942_1730 262
268 3300048908 Ga0496105_0185067 Ga0496105_0185067_411_1199 262
269 3300048911 Ga0496108_0058834 Ga0496108_0058834_578_1366 262
270 3300048911 Ga0496108_0099793 Ga0496108_0099793_202_990 262
271 3300048912 Ga0496109_0120025 Ga0496109_0120025_127_918 262
272 3300048912 Ga0496109_0151999 Ga0496109_0151999_100_888 262
273 3300048912 Ga0496109_0602930 Ga0496109_0602930_53_841 262
274 3300048913 Ga0496110_0363725 Ga0496110_0363725_261_1049 262
275 3300048913 Ga0496110_0368638 Ga0496110_0368638_308_1096 262
276 3300048914 Ga0496111_0073909 Ga0496111_0073909_16_804 262
277 3300048914 Ga0496111_0096560 Ga0496111_0096560_1289_2077 262
278 3300048914 Ga0496111_0153711 Ga0496111_0153711_73_861 262
279 3300048915 Ga0496112_0082196 Ga0496112_0082196_2237_3025 262
280 3300048915 Ga0496112_0157045 Ga0496112_0157045_638_1426 262
281 3300048915 Ga0496112_0341376 Ga0496112_0341376_214_1002 262
282 3300048918 Ga0496115_0410014 Ga0496115_0410014_143_931 262
283 3300048919 Ga0496116_0000339 Ga0496116_0000339_13883_14671 262
284 3300048919 Ga0496116_0038488 Ga0496116_0038488_206_994 262
285 3300048920 Ga0496117_0000101 Ga0496117_0000101_177154_177942 262
286 3300048920 Ga0496117_0102492 Ga0496117_0102492_890_1678 262
287 3300048921 Ga0496118_0000377 Ga0496118_0000377_13885_14673 262
288 3300048921 Ga0496118_0022859 Ga0496118_0022859_1410_2198 262
289 3300048922 Ga0496119_0001183 Ga0496119_0001183_13871_14659 262
290 3300048922 Ga0496119_0025340 Ga0496119_0025340_77_865 262
291 3300048922 Ga0496119_0105510 Ga0496119_0105510_137_925 262
292 3300048923 Ga0496120_0002848 Ga0496120_0002848_9382_10170 262
293 3300048924 Ga0496121_0000601 Ga0496121_0000601_38029_38817 262
294 3300048924 Ga0496121_0002686 Ga0496121_0002686_13881_14669 262
295 3300048926 Ga0496123_0033241 Ga0496123_0033241_402_1190 262
296 3300048927 Ga0496124_0016849 Ga0496124_0016849_5101_5889 262
297 3300048927 Ga0496124_0151594 Ga0496124_0151594_59_847 262
298 3300048928 Ga0496125_0004456 Ga0496125_0004456_78_866 262
299 3300048929 Ga0496126_0000523 Ga0496126_0000523_60239_61027 262
300 3300049569 Ga0501032_0151934 Ga0501032_0151934_116_904 262
301 3300049572 Ga0501036_0092988 Ga0501036_0092988_1463_2251 262
302 3300049576 Ga0501040_0057765 Ga0501040_0057765_1406_2194 262
303 3300049577 Ga0501041_0236559 Ga0501041_0236559_223_1011 262
304 3300049578 Ga0501042_0056382 Ga0501042_0056382_1972_2760 262
305 3300049580 Ga0501046_0392642 Ga0501046_0392642_113_901 262
306 3300049581 Ga0501047_0511714 Ga0501047_0511714_96_884 262
307 3300049582 Ga0501048_0065223 Ga0501048_0065223_636_1424 262
308 3300049583 Ga0501067_0146363 Ga0501067_0146363_437_1225 262
309 3300049587 Ga0501071_0002515 Ga0501071_0002515_4555_5343 262
310 3300049588 Ga0501072_0079655 Ga0501072_0079655_1377_2165 262
311 3300049592 Ga0501076_0062751 Ga0501076_0062751_1627_2415 262
312 3300049592 Ga0501076_0120429 Ga0501076_0120429_1208_1996 262
313 3300049741 Ga0501079_0077288 Ga0501079_0077288_154_942 262
314 3300049742 Ga0501080_0428880 Ga0501080_0428880_305_1093 262
315 3300049743 Ga0501081_0259383 Ga0501081_0259383_272_1060 262
316 3300049824 Ga0501045_0120825 Ga0501045_0120825_622_1410 262
317 3300050512 nmdc:mga0n895_412136_c1 nmdc:mga0n895_412136_c1_389_1180 262
318 3300050512 nmdc:mga0n895_774136_c1 nmdc:mga0n895_774136_c1_24_812 262
319 3300050513 nmdc:mga0rr50_71159_c1 nmdc:mga0rr50_71159_c1_305_1093 262
320 3300050514 nmdc:mga08x19_4775_c1 nmdc:mga08x19_4775_c1_3447_4235 262
321 3300050514 nmdc:mga08x19_4925_c1 nmdc:mga08x19_4925_c1_2065_2853 262
322 3300053157 Ga0500624_003264 Ga0500624_003264_976_1794 262
323 3300054114 Ga0501084_0008854 Ga0501084_0008854_7356_8144 262
324 3300061719 Ga0466962_0003381 Ga0466962_0003381_2705_3493 262
325 3300061734 Ga0530510_0215420 Ga0530510_0215420_266_1054 262
326 iso_pu_bacteria 2643221609 2644061142 262
327 iso_pu_bacteria 2643221611 2644071852 262
328 iso_pu_bacteria 2738543012 2739243483 262
329 iso_pu_bacteria 2816332133 2816475725 262
330 iso_pu_bacteria 2939631187 2939632085 262
331 3300002773 JGI25152J39213_1001152 JGI25152J39213_10011523 263
332 3300002773 JGI25152J39213_1004850 JGI25152J39213_10048502 263
333 3300002774 JGI25150J39212_1000629 JGI25150J39212_10006296 263
334 3300002987 JGI25159J45721_1001540 JGI25159J45721_10015401 263
335 3300002987 JGI25159J45721_1002520 JGI25159J45721_10025206 263
336 3300002987 JGI25159J45721_1019277 JGI25159J45721_10192771 263
337 3300003187 JGI25151J46595_10001171 JGI25151J46595_1000117111 263
338 3300003187 JGI25151J46595_10002144 JGI25151J46595_100021443 263
339 3300003187 JGI25151J46595_10012957 JGI25151J46595_100129572 263
340 3300003215 JGI25153J46596_10001941 JGI25153J46596_100019413 263
341 3300003215 JGI25153J46596_10012061 JGI25153J46596_100120615 263
342 3300003354 JGI25160J50197_1002114 JGI25160J50197_10021141 263
343 3300003354 JGI25160J50197_1008892 JGI25160J50197_10088921 263
344 3300003374 JGI25161J50226_1000849 JGI25161J50226_10008496 263
345 3300003374 JGI25161J50226_1004835 JGI25161J50226_10048352 263
346 3300003578 Ga0006562J51391_1065136 Ga0006562J51391_10651362 263
347 3300003578 Ga0006562J51391_1065137 Ga0006562J51391_10651372 263
348 3300003761 Ga0055535_1000750 Ga0055535_10007502 263
349 3300003762 Ga0055542_1000583 Ga0055542_10005832 263
350 3300003771 Ga0055526_1001020 Ga0055526_100102016 263
351 3300003771 Ga0055526_1003328 Ga0055526_10033283 263
352 3300003773 Ga0055537_1000575 Ga0055537_100057516 263
353 3300003773 Ga0055537_1019415 Ga0055537_10194152 263
354 3300003775 Ga0055524_1000825 Ga0055524_100082516 263
355 3300003775 Ga0055524_1005418 Ga0055524_10054183 263
356 3300003781 Ga0055536_1000955 Ga0055536_100095518 263
357 3300003781 Ga0055536_1001692 Ga0055536_10016924 263
358 3300003781 Ga0055536_1007355 Ga0055536_10073552 263
359 3300003784 Ga0055534_1000379 Ga0055534_10003792 263
360 3300003784 Ga0055534_1000533 Ga0055534_100053316 263
361 3300003784 Ga0055534_1003380 Ga0055534_10033804 263
362 3300003790 Ga0055528_1000661 Ga0055528_100066125 263
363 3300003790 Ga0055528_1000868 Ga0055528_100086816 263
364 3300003790 Ga0055528_1017004 Ga0055528_10170042 263
365 3300003790 Ga0055528_1041043 Ga0055528_10410432 263
366 3300003791 Ga0055530_10000318 Ga0055530_1000031834 263
367 3300003792 Ga0055540_1000194 Ga0055540_100019411 263
368 3300003792 Ga0055540_1000747 Ga0055540_10007476 263
369 3300003792 Ga0055540_1001928 Ga0055540_10019283 263
370 3300003792 Ga0055540_1005685 Ga0055540_10056853 263
371 3300003792 Ga0055540_1011959 Ga0055540_10119593 263
372 3300003794 Ga0055531_10001032 Ga0055531_100010326 263
373 3300003794 Ga0055531_10002357 Ga0055531_1000235713 263
374 3300003794 Ga0055531_10010815 Ga0055531_100108153 263
375 3300004625 Ga0055543_1001683 Ga0055543_10016833 263
376 3300005262 Ga0065165_1004070 Ga0065165_10040706 263
377 3300005262 Ga0065165_1036228 Ga0065165_10362282 263
378 3300005288 Ga0065714_10003524 Ga0065714_100035248 263
379 3300005367 Ga0070667_100105311 Ga0070667_1001053112 263
380 3300005457 Ga0070662_100232260 Ga0070662_1002322602 263
381 3300005467 Ga0070706_100013100 Ga0070706_1000131007 263
382 3300005468 Ga0070707_100029519 Ga0070707_1000295194 263
383 3300005539 Ga0068853_100106182 Ga0068853_1001061822 263
384 3300005539 Ga0068853_100530270 Ga0068853_1005302702 263
385 3300005543 Ga0070672_100173545 Ga0070672_1001735452 263
386 3300005563 Ga0068855_100281445 Ga0068855_1002814452 263
387 3300005564 Ga0070664_100053005 Ga0070664_1000530053 263
388 3300005614 Ga0068856_100199525 Ga0068856_1001995252 263
389 3300005616 Ga0068852_100432701 Ga0068852_1004327012 263
390 3300005842 Ga0068858_100855510 Ga0068858_1008555101 263
391 3300006058 Ga0075432_10039255 Ga0075432_100392552 263
392 3300006177 Ga0075362_10009608 Ga0075362_100096082 263
393 3300006177 Ga0075362_10174977 Ga0075362_101749772 263
394 3300006178 Ga0075367_10226400 Ga0075367_102264001 263
395 3300006195 Ga0075366_10171192 Ga0075366_101711921 263
396 3300006353 Ga0075370_10108541 Ga0075370_101085411 263
397 3300006353 Ga0075370_10163784 Ga0075370_101637841 263
398 3300006946 Ga0079104_1000072 Ga0079104_100007284 263
399 3300006946 Ga0079104_1024106 Ga0079104_10241062 263
400 3300006948 Ga0099826_10015498 Ga0099826_100154985 263
401 3300009036 Ga0105244_10004531 Ga0105244_1000453110 263
402 3300009092 Ga0105250_10002441 Ga0105250_100024415 263
403 3300009148 Ga0105243_10000626 Ga0105243_1000062618 263
404 3300009148 Ga0105243_10001087 Ga0105243_1000108713 263
405 3300009148 Ga0105243_10395966 Ga0105243_103959662 263
406 3300009176 Ga0105242_10002680 Ga0105242_1000268010 263
407 3300009551 Ga0105238_10167907 Ga0105238_101679072 263
408 3300010375 Ga0105239_10379625 Ga0105239_103796251 263
409 3300011119 Ga0105246_10116856 Ga0105246_101168562 263
410 3300013102 Ga0157371_10136823 Ga0157371_101368231 263
411 3300013104 Ga0157370_10005132 Ga0157370_100051329 263
412 3300013104 Ga0157370_10038136 Ga0157370_100381365 263
413 3300013105 Ga0157369_10011614 Ga0157369_100116146 263
414 3300013307 Ga0157372_10030940 Ga0157372_100309406 263
415 3300014497 Ga0182008_10008979 Ga0182008_100089795 263
416 3300014497 Ga0182008_10014778 Ga0182008_100147782 263
417 3300015261 Ga0182006_1003998 Ga0182006_10039984 263
418 3300015261 Ga0182006_1046961 Ga0182006_10469612 263
419 3300015262 Ga0182007_10032152 Ga0182007_100321522 263
420 3300015683 Ga0183362_10010 Ga0183362_1001059 263
421 3300017792 Ga0163161_10000099 Ga0163161_1000009913 263
422 3300017792 Ga0163161_10024771 Ga0163161_100247712 263
423 3300021361 Ga0213872_10006511 Ga0213872_100065113 263
424 3300025208 Ga0209436_108075 Ga0209436_1080751 263
425 3300025228 Ga0209672_100477 Ga0209672_10047725 263
426 3300025229 Ga0209147_102731 Ga0209147_1027315 263
427 3300025242 Ga0209258_100568 Ga0209258_10056837 263
428 3300025245 Ga0207425_1000273 Ga0207425_10002733 263
429 3300025245 Ga0207425_1000614 Ga0207425_100061416 263
430 3300025254 Ga0209148_1000033 Ga0209148_100003393 263
431 3300025258 Ga0209129_1000247 Ga0209129_100024741 263
432 3300025258 Ga0209129_1003218 Ga0209129_10032187 263
433 3300025258 Ga0209129_1005512 Ga0209129_10055123 263
434 3300025263 Ga0209565_1000042 Ga0209565_1000042200 263
435 3300025263 Ga0209565_1000256 Ga0209565_100025616 263
436 3300025263 Ga0209565_1002503 Ga0209565_10025035 263
437 3300025273 Ga0209673_1000071 Ga0209673_100007128 263
438 3300025273 Ga0209673_1000592 Ga0209673_100059216 263
439 3300025273 Ga0209673_1000731 Ga0209673_10007316 263
440 3300025273 Ga0209673_1001396 Ga0209673_10013969 263
441 3300025284 Ga0209130_1000366 Ga0209130_100036637 263
442 3300025284 Ga0209130_1000496 Ga0209130_100049622 263
443 3300025284 Ga0209130_1020141 Ga0209130_10201412 263
444 3300025291 Ga0209675_1000041 Ga0209675_100004127 263
445 3300025291 Ga0209675_1000814 Ga0209675_10008143 263
446 3300025291 Ga0209675_1003241 Ga0209675_10032413 263
447 3300025291 Ga0209675_1003436 Ga0209675_10034366 263
448 3300025292 Ga0209676_1000048 Ga0209676_1000048236 263
449 3300025292 Ga0209676_1000287 Ga0209676_100028771 263
450 3300025292 Ga0209676_1000573 Ga0209676_100057328 263
451 3300025292 Ga0209676_1003204 Ga0209676_10032042 263
452 3300025294 Ga0209025_1000104 Ga0209025_100010475 263
453 3300025294 Ga0209025_1000710 Ga0209025_100071041 263
454 3300025294 Ga0209025_1013215 Ga0209025_10132156 263
455 3300025295 Ga0209564_1000596 Ga0209564_100059616 263
456 3300025295 Ga0209564_1002077 Ga0209564_10020777 263
457 3300025297 Ga0209758_1000909 Ga0209758_100090916 263
458 3300025297 Ga0209758_1008662 Ga0209758_10086625 263
459 3300025298 Ga0209050_1000012 Ga0209050_1000012236 263
460 3300025298 Ga0209050_1000460 Ga0209050_100046047 263
461 3300025299 Ga0209256_1000516 Ga0209256_100051616 263
462 3300025299 Ga0209256_1000679 Ga0209256_10006797 263
463 3300025302 Ga0207426_1000058 Ga0207426_100005843 263
464 3300025302 Ga0207426_1001624 Ga0207426_10016242 263
465 3300025303 Ga0209051_1000019 Ga0209051_1000019155 263
466 3300025303 Ga0209051_1000307 Ga0209051_100030713 263
467 3300025303 Ga0209051_1000441 Ga0209051_100044125 263
468 3300025303 Ga0209051_1001689 Ga0209051_10016894 263
469 3300025303 Ga0209051_1012591 Ga0209051_10125912 263
470 3300025304 Ga0209257_1000024 Ga0209257_1000024182 263
471 3300025304 Ga0209257_1000057 Ga0209257_1000057373 263
472 3300025304 Ga0209257_1002859 Ga0209257_10028596 263
473 3300025304 Ga0209257_1023399 Ga0209257_10233992 263
474 3300025711 Ga0207696_1003669 Ga0207696_10036695 263
475 3300025728 Ga0207655_1015566 Ga0207655_10155663 263
476 3300025910 Ga0207684_10018323 Ga0207684_100183234 263
477 3300025913 Ga0207695_10409384 Ga0207695_104093842 263
478 3300025924 Ga0207694_10125034 Ga0207694_101250342 263
479 3300025935 Ga0207709_10000104 Ga0207709_10000104104 263
480 3300025935 Ga0207709_10000168 Ga0207709_100001686 263
481 3300025935 Ga0207709_10009625 Ga0207709_100096254 263
482 3300025935 Ga0207709_10189995 Ga0207709_101899952 263
483 3300025945 Ga0207679_10213058 Ga0207679_102130582 263
484 3300025949 Ga0207667_10280997 Ga0207667_102809972 263
485 3300025960 Ga0207651_10356181 Ga0207651_103561811 263
486 3300025986 Ga0207658_10644855 Ga0207658_106448551 263
487 3300026041 Ga0207639_10162898 Ga0207639_101628982 263
488 3300026089 Ga0207648_10125118 Ga0207648_101251182 263
489 3300026116 Ga0207674_10655345 Ga0207674_106553451 263
490 3300027111 Ga0209281_1000002 Ga0209281_10000021041 263
491 3300027111 Ga0209281_1017379 Ga0209281_10173791 263
492 3300027666 Ga0209282_1003079 Ga0209282_10030795 263
493 3300031456 Ga0307513_10233976 Ga0307513_102339762 263
494 3300031548 Ga0307408_100107725 Ga0307408_1001077252 263
495 3300031731 Ga0307405_10035737 Ga0307405_100357373 263
496 3300031911 Ga0307412_10457037 Ga0307412_104570371 263
497 3300032005 Ga0307411_10376356 Ga0307411_103763561 263
498 3300039447 Ga0436361_1190221 Ga0436361_1190221_41188_41982 263
499 3300041413 Ga0439465_0005707 Ga0439465_0005707_3064_3855 263
500 3300042184 Ga0450908_005034 Ga0450908_005034_516_1307 263
501 3300046453 Ga0495627_003666 Ga0495627_003666_725_1516 263
502 3300046459 Ga0495629_0187325 Ga0495629_0187325_443_1234 263
503 3300046512 Ga0495610_0005191 Ga0495610_0005191_8484_9275 263
504 3300046513 Ga0495616_0009658 Ga0495616_0009658_2508_3299 263
505 3300046515 Ga0495620_0000768 Ga0495620_0000768_14939_15730 263
506 3300046518 Ga0495631_0005042 Ga0495631_0005042_2786_3577 263
507 3300046530 Ga0495654_0026723 Ga0495654_0026723_1307_2098 263
508 3300046543 Ga0495645_0129618 Ga0495645_0129618_878_1669 263
509 3300046616 Ga0495668_0119236 Ga0495668_0119236_274_1065 263
510 3300046660 Ga0495625_0074301 Ga0495625_0074301_183_974 263
511 3300046683 Ga0495658_0050937 Ga0495658_0050937_1028_1819 263
512 3300046692 Ga0495671_0001568 Ga0495671_0001568_3508_4299 263
513 3300047321 Ga0495676_0028286 Ga0495676_0028286_3537_4328 263
514 3300047673 Ga0495593_0001026 Ga0495593_0001026_3537_4328 263
515 3300048903 Ga0496100_0358676 Ga0496100_0358676_151_1053 263
516 3300048904 Ga0496101_0040540 Ga0496101_0040540_454_1245 263
517 3300048905 Ga0496102_0130095 Ga0496102_0130095_149_940 263
518 3300048905 Ga0496102_0140622 Ga0496102_0140622_975_1766 263
519 3300048911 Ga0496108_0029060 Ga0496108_0029060_258_1160 263
520 3300048913 Ga0496110_0310159 Ga0496110_0310159_325_1116 263
521 3300048919 Ga0496116_0013262 Ga0496116_0013262_740_1531 263
522 3300048919 Ga0496116_0109901 Ga0496116_0109901_578_1369 263
523 3300048920 Ga0496117_0007447 Ga0496117_0007447_7597_8388 263
524 3300048921 Ga0496118_0005503 Ga0496118_0005503_5763_6554 263
525 3300048921 Ga0496118_0070906 Ga0496118_0070906_1467_2258 263
526 3300048921 Ga0496118_0100189 Ga0496118_0100189_587_1378 263
527 3300048924 Ga0496121_0048676 Ga0496121_0048676_1128_1919 263
528 3300048924 Ga0496121_0072794 Ga0496121_0072794_200_991 263
529 3300048926 Ga0496123_0101457 Ga0496123_0101457_807_1598 263
530 3300048927 Ga0496124_0057449 Ga0496124_0057449_1609_2400 263
531 3300048927 Ga0496124_0101100 Ga0496124_0101100_270_1061 263
532 3300048927 Ga0496124_0120230 Ga0496124_0120230_378_1169 263
533 3300048928 Ga0496125_0068002 Ga0496125_0068002_1651_2442 263
534 3300050489 nmdc:mga03683_2333_c1 nmdc:mga03683_2333_c1_4470_5261 263
535 3300050492 nmdc:mga0yw44_4066_c1 nmdc:mga0yw44_4066_c1_3419_4210 263
536 3300050493 nmdc:mga0k408_4257_c1 nmdc:mga0k408_4257_c1_454_1245 263
537 3300050496 nmdc:mga07m45_129185_c1 nmdc:mga07m45_129185_c1_209_1000 263
538 3300050496 nmdc:mga07m45_1725_c1 nmdc:mga07m45_1725_c1_7850_8641 263
539 3300053079 Ga0500610_0001908 Ga0500610_0001908_4797_5588 263
540 3300053093 Ga0500651_0000158 Ga0500651_0000158_3280_4071 263
541 3300053110 Ga0500571_000077 Ga0500571_000077_29266_30057 263
542 3300053117 Ga0500593_007845 Ga0500593_007845_685_1476 263
543 3300053134 Ga0500658_0000053 Ga0500658_0000053_3897_4688 263
544 3300053134 Ga0500658_0000058 Ga0500658_0000058_3831_4622 263
545 3300053139 Ga0500568_0004374 Ga0500568_0004374_2969_3760 263
546 3300053141 Ga0500574_000584 Ga0500574_000584_2712_3503 263
547 3300053153 Ga0500616_0044355 Ga0500616_0044355_508_1299 263
548 3300053158 Ga0500627_0004592 Ga0500627_0004592_2842_3633 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

44

234

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

51

283

0.93

PF08659

KR

KR domain

45

217

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hs9-assembly3.cif.gz_C brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant:i258m/k262t 0.9617 5 244
1nff-assembly1.cif.gz_A crystal structure of rv2002 gene product from mycobacterium tuberculosis 0.9584 5 248
2d1y-assembly1.cif.gz_A crystal structure of tt0321 from thermus thermophilus hb8 0.9548 4 248
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9513 1 248
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9513 6 245
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9688 5 181 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9513 1 248 3.40.50.720
1nfrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9502 5 248 3.40.50.720
af_G5EGA6_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9501 6 246 3.40.50.720
af_Q7K3N4_96_372_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9432 8 183 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A150A8C5-F1-model_v4 Short-chain dehydrogenase 0.9947 5 263 GO:0016491
AF-A0A8B1B5B7-F1-model_v4 deleted 0.9925 3 234
AF-A0A2N2UJS6-F1-model_v4 Short-chain dehydrogenase 0.9916 4 186 GO:0016491
AF-A0A7M2Z1A7-F1-model_v4 Short-chain alcohol dehydrogenase 0.9906 4 173 GO:0016491
AF-A0A6I3CKT4-F1-model_v4 SDR family oxidoreductase 0.9805 5 227 GO:0016491

Feature Viewer

pLDDT pTM Quality
95 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map