F462149
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 547 | 294 | 546 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300046511|Ga0495608_0018918|Ga0495608_0018918_1682_2710 |
| Length | 342 |
| Sequence | MSELGLGQDKVENVIVVGGGPAGYTAALYTARANLEPLVFEGFQWGGQLQNTTDVENYPGYPEGIMGPEMMNQFRAQAERFGTRFVSDDVDRVELSTDGGVHRVFLGDEEHVAKTVILAMGAEPRRLGIPGEMELSGCGVSTCGVCDGAFFKGKKVIVIGGGDSAMEDAIFVSKFASELTIVNRRDEFRASKIMRERAAERPNIEFKTPFVPEEFVAAEGEPKLDHVRLRNAETGETEDFGTEGAFVAIGHIPRSEIVAGQVDTDEDGYIRTEPGSTKTNLPGVFAVGDVVDHTYRQAVTAAGTGCMGALDAEWYLRDTPPMPEAHWLPGGEPTEIAPTPGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 141 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 142 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 147 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 149 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 161 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 168 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 169 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 170 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 171 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 225 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 228 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 233 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 234 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 235 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 236 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 237 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 288 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 289 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 290 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 291 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.9 |
| Metatranscriptomes | 0.91 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.66 |
| Nodule | 0 |
| Rhizoplane | 12.25 |
| Rhizosphere | 81.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1006601 | 3300000549 | Bacteria | 1442 |
| 2 | JGI24746J21847_1002058 | 3300001977 | Bacteria | 3209 |
| 3 | JGI24748J21848_1000356 | 3300002074 | Bacteria | 5272 |
| 4 | JGI24034J26672_10000216 | 3300002239 | Bacteria | 7622 |
| 5 | Ga0070683_100023947 | 3300005329 | Bacteria | 5465 |
| 6 | Ga0070666_10009188 | 3300005335 | Bacteria | 6162 |
| 7 | Ga0070682_100000023 | 3300005337 | Bacteria | 206016 |
| 8 | Ga0070682_100000026 | 3300005337 | Bacteria | 191388 |
| 9 | Ga0068868_100000694 | 3300005338 | Bacteria | 22626 |
| 10 | Ga0068868_100072591 | 3300005338 | Bacteria | 2746 |
| 11 | Ga0070689_100081610 | 3300005340 | Bacteria | 2539 |
| 12 | Ga0070689_100210380 | 3300005340 | Bacteria | 1591 |
| 13 | Ga0070691_10000004 | 3300005341 | Bacteria | 80156 |
| 14 | Ga0070691_10000970 | 3300005341 | Bacteria | 11707 |
| 15 | Ga0070687_100012467 | 3300005343 | Bacteria | 3756 |
| 16 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 17 | Ga0070668_100010212 | 3300005347 | Bacteria | 6964 |
| 18 | Ga0070668_100019643 | 3300005347 | Bacteria | 5087 |
| 19 | Ga0070675_100000050 | 3300005354 | Bacteria | 72016 |
| 20 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 21 | Ga0070674_100000141 | 3300005356 | Bacteria | 33366 |
| 22 | Ga0070673_100100925 | 3300005364 | Bacteria | 2377 |
| 23 | Ga0070688_100000686 | 3300005365 | Bacteria | 16820 |
| 24 | Ga0070688_100076412 | 3300005365 | Bacteria | 2155 |
| 25 | Ga0070659_100000852 | 3300005366 | Bacteria | 22251 |
| 26 | Ga0070659_100003678 | 3300005366 | Bacteria | 10933 |
| 27 | Ga0070667_100003085 | 3300005367 | Bacteria | 14325 |
| 28 | Ga0070667_100068631 | 3300005367 | Bacteria | 3017 |
| 29 | Ga0070714_100004088 | 3300005435 | Bacteria | 10971 |
| 30 | Ga0070714_100356459 | 3300005435 | Bacteria | 1374 |
| 31 | Ga0070713_100000503 | 3300005436 | Bacteria | 24991 |
| 32 | Ga0070713_100119207 | 3300005436 | Bacteria | 2312 |
| 33 | Ga0070711_100016216 | 3300005439 | Bacteria | 4729 |
| 34 | Ga0070711_100036952 | 3300005439 | Bacteria | 3275 |
| 35 | Ga0070663_100021932 | 3300005455 | Bacteria | 4259 |
| 36 | Ga0070678_100226970 | 3300005456 | Bacteria | 1555 |
| 37 | Ga0070662_100000001 | 3300005457 | Bacteria | 317995 |
| 38 | Ga0070681_10080275 | 3300005458 | Bacteria | 3218 |
| 39 | Ga0068867_100000078 | 3300005459 | Bacteria | 59729 |
| 40 | Ga0068867_100007697 | 3300005459 | Bacteria | 7621 |
| 41 | Ga0070685_10000010 | 3300005466 | Bacteria | 146946 |
| 42 | Ga0070685_10001080 | 3300005466 | Bacteria | 14623 |
| 43 | Ga0070679_100000424 | 3300005530 | Bacteria | 35927 |
| 44 | Ga0070679_100000471 | 3300005530 | Bacteria | 34374 |
| 45 | Ga0070684_100012351 | 3300005535 | Bacteria | 6842 |
| 46 | Ga0070684_100048102 | 3300005535 | Bacteria | 3699 |
| 47 | Ga0070684_100048700 | 3300005535 | Bacteria | 3676 |
| 48 | Ga0070684_100143343 | 3300005535 | Bacteria | 2162 |
| 49 | Ga0070672_100000031 | 3300005543 | Bacteria | 62241 |
| 50 | Ga0070693_100001579 | 3300005547 | Bacteria | 10264 |
| 51 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 52 | Ga0070665_100002868 | 3300005548 | Bacteria | 18629 |
| 53 | Ga0070665_100652886 | 3300005548 | Bacteria | 1065 |
| 54 | Ga0070664_100193884 | 3300005564 | Bacteria | 1811 |
| 55 | Ga0070664_100212796 | 3300005564 | Bacteria | 1728 |
| 56 | Ga0068854_100000082 | 3300005578 | Bacteria | 68340 |
| 57 | Ga0068854_100021369 | 3300005578 | Bacteria | 4392 |
| 58 | Ga0068856_100000136 | 3300005614 | Bacteria | 74026 |
| 59 | Ga0068856_100005657 | 3300005614 | Bacteria | 12302 |
| 60 | Ga0068852_100064550 | 3300005616 | Bacteria | 3192 |
| 61 | Ga0068864_100000090 | 3300005618 | Bacteria | 96213 |
| 62 | Ga0068866_10000004 | 3300005718 | Bacteria | 202810 |
| 63 | Ga0068866_10004817 | 3300005718 | Bacteria | 5540 |
| 64 | Ga0068851_10002105 | 3300005834 | Bacteria | 8758 |
| 65 | Ga0068851_10083118 | 3300005834 | Bacteria | 1675 |
| 66 | Ga0068863_100000261 | 3300005841 | Bacteria | 55053 |
| 67 | Ga0068863_100008832 | 3300005841 | Bacteria | 9842 |
| 68 | Ga0068863_100268176 | 3300005841 | Bacteria | 1652 |
| 69 | Ga0068858_100000046 | 3300005842 | Bacteria | 127519 |
| 70 | Ga0068858_100001180 | 3300005842 | Bacteria | 27065 |
| 71 | Ga0068860_100003017 | 3300005843 | Bacteria | 17389 |
| 72 | Ga0068862_100001309 | 3300005844 | Bacteria | 23179 |
| 73 | Ga0068862_100202398 | 3300005844 | Bacteria | 1791 |
| 74 | Ga0081455_10009497 | 3300005937 | Bacteria | 9997 |
| 75 | Ga0081455_10010690 | 3300005937 | Bacteria | 9284 |
| 76 | Ga0081455_10016053 | 3300005937 | Bacteria | 7244 |
| 77 | Ga0081455_10047858 | 3300005937 | Bacteria | 3699 |
| 78 | Ga0081455_10113472 | 3300005937 | Bacteria | 2149 |
| 79 | Ga0081538_10000814 | 3300005981 | Bacteria | 33848 |
| 80 | Ga0081538_10053974 | 3300005981 | Bacteria | 2382 |
| 81 | Ga0081540_1000174 | 3300005983 | Bacteria | 67477 |
| 82 | Ga0081540_1000557 | 3300005983 | Bacteria | 36162 |
| 83 | Ga0081539_10000776 | 3300005985 | Bacteria | 62705 |
| 84 | Ga0075365_10001651 | 3300006038 | Bacteria | 10306 |
| 85 | Ga0075365_10006453 | 3300006038 | Bacteria | 6455 |
| 86 | Ga0075365_10008059 | 3300006038 | Bacteria | 5949 |
| 87 | Ga0075365_10012400 | 3300006038 | Bacteria | 5062 |
| 88 | Ga0075365_10043160 | 3300006038 | Bacteria | 2951 |
| 89 | Ga0075363_100009258 | 3300006048 | Bacteria | 4626 |
| 90 | Ga0075364_10004153 | 3300006051 | Bacteria | 8301 |
| 91 | Ga0075364_10068807 | 3300006051 | Bacteria | 2329 |
| 92 | Ga0070715_10000008 | 3300006163 | Bacteria | 189899 |
| 93 | Ga0075367_10125368 | 3300006178 | Bacteria | 1584 |
| 94 | Ga0068871_100086946 | 3300006358 | Bacteria | 2598 |
| 95 | Ga0075428_100024481 | 3300006844 | Bacteria | 6681 |
| 96 | Ga0075428_100243017 | 3300006844 | Bacteria | 1942 |
| 97 | Ga0075430_100019608 | 3300006846 | Bacteria | 5753 |
| 98 | Ga0075430_100026320 | 3300006846 | Bacteria | 4950 |
| 99 | Ga0075431_100003746 | 3300006847 | Bacteria | 14770 |
| 100 | Ga0075431_100022444 | 3300006847 | Bacteria | 6452 |
| 101 | Ga0075433_10000337 | 3300006852 | Bacteria | 29062 |
| 102 | Ga0075433_10185196 | 3300006852 | Bacteria | 1852 |
| 103 | Ga0075434_100001338 | 3300006871 | Bacteria | 20649 |
| 104 | Ga0075434_100012705 | 3300006871 | Bacteria | 7987 |
| 105 | Ga0068865_100054085 | 3300006881 | Bacteria | 2788 |
| 106 | Ga0068865_100078856 | 3300006881 | Bacteria | 2357 |
| 107 | Ga0075436_100151343 | 3300006914 | Bacteria | 1633 |
| 108 | Ga0111539_10352080 | 3300009094 | Bacteria | 1714 |
| 109 | Ga0105245_10000040 | 3300009098 | Bacteria | 144005 |
| 110 | Ga0105245_10000117 | 3300009098 | Bacteria | 76863 |
| 111 | Ga0105245_10000629 | 3300009098 | Bacteria | 32084 |
| 112 | Ga0105245_10006841 | 3300009098 | Bacteria | 10002 |
| 113 | Ga0105245_10009368 | 3300009098 | Bacteria | 8539 |
| 114 | Ga0105247_10000131 | 3300009101 | Bacteria | 72578 |
| 115 | Ga0114129_10030345 | 3300009147 | Bacteria | 7650 |
| 116 | Ga0114129_10125475 | 3300009147 | Bacteria | 3530 |
| 117 | Ga0114129_10284908 | 3300009147 | Bacteria | 2206 |
| 118 | Ga0105243_10010381 | 3300009148 | Bacteria | 7071 |
| 119 | Ga0105243_10010662 | 3300009148 | Bacteria | 6970 |
| 120 | Ga0105243_10180684 | 3300009148 | Bacteria | 1834 |
| 121 | Ga0105242_10000063 | 3300009176 | Bacteria | 74721 |
| 122 | Ga0105242_10000428 | 3300009176 | Bacteria | 33565 |
| 123 | Ga0105248_10192317 | 3300009177 | Bacteria | 2299 |
| 124 | Ga0105237_10030852 | 3300009545 | Bacteria | 5439 |
| 125 | Ga0105237_10237342 | 3300009545 | Bacteria | 1824 |
| 126 | Ga0105238_10000033 | 3300009551 | Bacteria | 172981 |
| 127 | Ga0105249_10000218 | 3300009553 | Bacteria | 65480 |
| 128 | Ga0105249_10004038 | 3300009553 | Bacteria | 12662 |
| 129 | Ga0105249_10143982 | 3300009553 | Bacteria | 2288 |
| 130 | Ga0105249_10563279 | 3300009553 | Bacteria | 1191 |
| 131 | Ga0105239_10030284 | 3300010375 | Bacteria | 5949 |
| 132 | Ga0105239_10210502 | 3300010375 | Bacteria | 2179 |
| 133 | Ga0105239_10549574 | 3300010375 | Bacteria | 1315 |
| 134 | Ga0105246_10326253 | 3300011119 | Bacteria | 1249 |
| 135 | Ga0157370_10004940 | 3300013104 | Bacteria | 15093 |
| 136 | Ga0157374_10001719 | 3300013296 | Bacteria | 18377 |
| 137 | Ga0157374_10203473 | 3300013296 | Bacteria | 1939 |
| 138 | Ga0157378_10018349 | 3300013297 | Bacteria | 6144 |
| 139 | Ga0157378_10023605 | 3300013297 | Bacteria | 5409 |
| 140 | Ga0157378_10101111 | 3300013297 | Bacteria | 2633 |
| 141 | Ga0157372_10000146 | 3300013307 | Bacteria | 77952 |
| 142 | Ga0157375_10000492 | 3300013308 | Bacteria | 35821 |
| 143 | Ga0157375_10030090 | 3300013308 | Bacteria | 5115 |
| 144 | Ga0157375_10067540 | 3300013308 | Bacteria | 3573 |
| 145 | Ga0157380_10000007 | 3300014326 | Bacteria | 157634 |
| 146 | Ga0157380_10001343 | 3300014326 | Bacteria | 16023 |
| 147 | Ga0157379_10049463 | 3300014968 | Bacteria | 3754 |
| 148 | Ga0157379_10063407 | 3300014968 | Bacteria | 3304 |
| 149 | Ga0157379_10246886 | 3300014968 | Bacteria | 1620 |
| 150 | Ga0157376_10010885 | 3300014969 | Bacteria | 6680 |
| 151 | Ga0163161_10000027 | 3300017792 | Bacteria | 197774 |
| 152 | Ga0206350_10333991 | 3300020080 | Bacteria | 1967 |
| 153 | Ga0206354_10497300 | 3300020081 | Bacteria | 2909 |
| 154 | Ga0206354_11031077 | 3300020081 | Bacteria | 2079 |
| 155 | Ga0206353_11807736 | 3300020082 | Bacteria | 4842 |
| 156 | Ga0224712_10022571 | 3300022467 | Bacteria | 2171 |
| 157 | Ga0207656_10002076 | 3300025321 | Bacteria | 6694 |
| 158 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 159 | Ga0207642_10000737 | 3300025899 | Bacteria | 10119 |
| 160 | Ga0207642_10003444 | 3300025899 | Bacteria | 4997 |
| 161 | Ga0207710_10000268 | 3300025900 | Bacteria | 42956 |
| 162 | Ga0207680_10004865 | 3300025903 | Bacteria | 6390 |
| 163 | Ga0207685_10000012 | 3300025905 | Bacteria | 189900 |
| 164 | Ga0207707_10023616 | 3300025912 | Bacteria | 5378 |
| 165 | Ga0207695_10251788 | 3300025913 | Bacteria | 1665 |
| 166 | Ga0207671_10084315 | 3300025914 | Bacteria | 2386 |
| 167 | Ga0207693_10014431 | 3300025915 | Bacteria | 6352 |
| 168 | Ga0207693_10015147 | 3300025915 | Bacteria | 6188 |
| 169 | Ga0207663_10004985 | 3300025916 | Bacteria | 6655 |
| 170 | Ga0207662_10034095 | 3300025918 | Bacteria | 2971 |
| 171 | Ga0207657_10007235 | 3300025919 | Bacteria | 11401 |
| 172 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 173 | Ga0207652_10000232 | 3300025921 | Bacteria | 58473 |
| 174 | Ga0207652_10000412 | 3300025921 | Bacteria | 44366 |
| 175 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 176 | Ga0207659_10000055 | 3300025926 | Bacteria | 74252 |
| 177 | Ga0207687_10000046 | 3300025927 | Bacteria | 99576 |
| 178 | Ga0207687_10000070 | 3300025927 | Bacteria | 77432 |
| 179 | Ga0207687_10000095 | 3300025927 | Bacteria | 64664 |
| 180 | Ga0207687_10006279 | 3300025927 | Bacteria | 7862 |
| 181 | Ga0207687_10101546 | 3300025927 | Bacteria | 2117 |
| 182 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 183 | Ga0207664_10000006 | 3300025929 | Bacteria | 408702 |
| 184 | Ga0207644_10152774 | 3300025931 | Bacteria | 1788 |
| 185 | Ga0207690_10002537 | 3300025932 | Bacteria | 11031 |
| 186 | Ga0207690_10112859 | 3300025932 | Bacteria | 1960 |
| 187 | Ga0207706_10000003 | 3300025933 | Bacteria | 345011 |
| 188 | Ga0207686_10000124 | 3300025934 | Bacteria | 62335 |
| 189 | Ga0207686_10000395 | 3300025934 | Bacteria | 30349 |
| 190 | Ga0207670_10142256 | 3300025936 | Bacteria | 1770 |
| 191 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 192 | Ga0207669_10000021 | 3300025937 | Bacteria | 100327 |
| 193 | Ga0207704_10000104 | 3300025938 | Bacteria | 46614 |
| 194 | Ga0207704_10026478 | 3300025938 | Bacteria | 3183 |
| 195 | Ga0207691_10000178 | 3300025940 | Bacteria | 60110 |
| 196 | Ga0207691_10003769 | 3300025940 | Bacteria | 14721 |
| 197 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 198 | Ga0207711_10073917 | 3300025941 | Bacteria | 2964 |
| 199 | Ga0207661_10002170 | 3300025944 | Bacteria | 13522 |
| 200 | Ga0207661_10003560 | 3300025944 | Bacteria | 10827 |
| 201 | Ga0207661_10005006 | 3300025944 | Bacteria | 9292 |
| 202 | Ga0207661_10180341 | 3300025944 | Bacteria | 1844 |
| 203 | Ga0207679_10128408 | 3300025945 | Bacteria | 2030 |
| 204 | Ga0207667_10470726 | 3300025949 | Bacteria | 1276 |
| 205 | Ga0207651_10032078 | 3300025960 | Bacteria | 3369 |
| 206 | Ga0207712_10000027 | 3300025961 | Bacteria | 263739 |
| 207 | Ga0207712_10019638 | 3300025961 | Bacteria | 4417 |
| 208 | Ga0207712_10282739 | 3300025961 | Bacteria | 1354 |
| 209 | Ga0207668_10006557 | 3300025972 | Bacteria | 6879 |
| 210 | Ga0207640_10000054 | 3300025981 | Bacteria | 95136 |
| 211 | Ga0207658_10015937 | 3300025986 | Bacteria | 5161 |
| 212 | Ga0207677_10001111 | 3300026023 | Bacteria | 14662 |
| 213 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 214 | Ga0207703_10000042 | 3300026035 | Bacteria | 161459 |
| 215 | Ga0207678_10001975 | 3300026067 | Bacteria | 18688 |
| 216 | Ga0207678_10002172 | 3300026067 | Bacteria | 17730 |
| 217 | Ga0207708_10225037 | 3300026075 | Bacteria | 1504 |
| 218 | Ga0207702_10000105 | 3300026078 | Bacteria | 97835 |
| 219 | Ga0207702_10001788 | 3300026078 | Bacteria | 21174 |
| 220 | Ga0207641_10000062 | 3300026088 | Bacteria | 159982 |
| 221 | Ga0207641_10006453 | 3300026088 | Bacteria | 9884 |
| 222 | Ga0207648_10013215 | 3300026089 | Bacteria | 7692 |
| 223 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 224 | Ga0207674_10050746 | 3300026116 | Bacteria | 4237 |
| 225 | Ga0207674_10414054 | 3300026116 | Bacteria | 1302 |
| 226 | Ga0207675_100160315 | 3300026118 | Bacteria | 2145 |
| 227 | Ga0207683_10033719 | 3300026121 | Bacteria | 4449 |
| 228 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 229 | Ga0207428_10013276 | 3300027907 | Bacteria | 7201 |
| 230 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 231 | Ga0268266_10000526 | 3300028379 | Bacteria | 53404 |
| 232 | Ga0268266_10000990 | 3300028379 | Bacteria | 35791 |
| 233 | Ga0268266_10081443 | 3300028379 | Bacteria | 2823 |
| 234 | Ga0268265_10008679 | 3300028380 | Bacteria | 6869 |
| 235 | Ga0268264_10001191 | 3300028381 | Bacteria | 25160 |
| 236 | Ga0268264_10024255 | 3300028381 | Bacteria | 4952 |
| 237 | Ga0265337_1001256 | 3300028556 | Bacteria | 12773 |
| 238 | Ga0265326_10000127 | 3300028558 | Bacteria | 39017 |
| 239 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 240 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 241 | Ga0265336_10026744 | 3300028666 | Bacteria | 1811 |
| 242 | Ga0265338_10000287 | 3300028800 | Bacteria | 90818 |
| 243 | Ga0265328_10019084 | 3300031239 | Bacteria | 2637 |
| 244 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 245 | Ga0265325_10051053 | 3300031241 | Bacteria | 2127 |
| 246 | Ga0265329_10001050 | 3300031242 | Bacteria | 13701 |
| 247 | Ga0265339_10016752 | 3300031249 | Bacteria | 4361 |
| 248 | Ga0265331_10000217 | 3300031250 | Bacteria | 69142 |
| 249 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 250 | Ga0265316_10035110 | 3300031344 | Bacteria | 4067 |
| 251 | Ga0265314_10000491 | 3300031711 | Bacteria | 51373 |
| 252 | Ga0265342_10059103 | 3300031712 | Bacteria | 2265 |
| 253 | Ga0316576_10000603 | 3300031727 | Bacteria | 17236 |
| 254 | Ga0307406_10112797 | 3300031901 | Bacteria | 1875 |
| 255 | Ga0307409_100453414 | 3300031995 | Bacteria | 1238 |
| 256 | Ga0307415_100011748 | 3300032126 | Bacteria | 5028 |
| 257 | Ga0316583_10056789 | 3300032133 | Bacteria | 1375 |
| 258 | Ga0316574_0024095 | 3300035398 | Bacteria | 3639 |
| 259 | Ga0316574_0082417 | 3300035398 | Bacteria | 2044 |
| 260 | Ga0316574_0118784 | 3300035398 | Bacteria | 1697 |
| 261 | Ga0373937_0009257 | 3300036401 | Bacteria | 8551 |
| 262 | Ga0395900_0008759 | 3300037418 | Bacteria | 10394 |
| 263 | Ga0395900_0146668 | 3300037418 | Bacteria | 2413 |
| 264 | Ga0395898_0032878 | 3300037466 | Bacteria | 5178 |
| 265 | Ga0395898_0168643 | 3300037466 | Bacteria | 2093 |
| 266 | Ga0395905_0029155 | 3300037471 | Bacteria | 5201 |
| 267 | Ga0395901_0144181 | 3300038443 | Bacteria | 2503 |
| 268 | Ga0395901_0345576 | 3300038443 | Bacteria | 1536 |
| 269 | Ga0451853_1416621 | 3300041512 | Bacteria | 3684 |
| 270 | Ga0466963_0000233 | 3300044694 | Bacteria | 24036 |
| 271 | Ga0466970_0019251 | 3300044765 | Bacteria | 3538 |
| 272 | Ga0466967_0000002 | 3300045976 | Bacteria | 219994 |
| 273 | Ga0466967_0067231 | 3300045976 | Bacteria | 3196 |
| 274 | Ga0495592_0000024 | 3300046454 | Bacteria | 136661 |
| 275 | Ga0495603_0000102 | 3300046455 | Bacteria | 40074 |
| 276 | Ga0495603_0001201 | 3300046455 | Bacteria | 15127 |
| 277 | Ga0495603_0001271 | 3300046455 | Bacteria | 14685 |
| 278 | Ga0495629_0000828 | 3300046459 | Bacteria | 25082 |
| 279 | Ga0495629_0010841 | 3300046459 | Bacteria | 6627 |
| 280 | Ga0495629_0070431 | 3300046459 | Bacteria | 2440 |
| 281 | Ga0495641_0000004 | 3300046461 | Bacteria | 210501 |
| 282 | Ga0495641_0016090 | 3300046461 | Bacteria | 3953 |
| 283 | Ga0495651_0171738 | 3300046462 | Bacteria | 1543 |
| 284 | Ga0495653_0077145 | 3300046463 | Bacteria | 2475 |
| 285 | Ga0495653_0111487 | 3300046463 | Bacteria | 1965 |
| 286 | Ga0495653_0167298 | 3300046463 | Bacteria | 1521 |
| 287 | Ga0495582_0000003 | 3300046473 | Bacteria | 168880 |
| 288 | Ga0495662_0001473 | 3300046476 | Bacteria | 11649 |
| 289 | Ga0495662_0002109 | 3300046476 | Bacteria | 9973 |
| 290 | Ga0495664_0035968 | 3300046477 | Bacteria | 2918 |
| 291 | Ga0495594_0000009 | 3300046499 | Bacteria | 122139 |
| 292 | Ga0495606_0000017 | 3300046507 | Bacteria | 284549 |
| 293 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 294 | Ga0495608_0000661 | 3300046511 | Bacteria | 23772 |
| 295 | Ga0495608_0018918 | 3300046511 | Bacteria | 4747 |
| 296 | Ga0495608_0020565 | 3300046511 | Bacteria | 4537 |
| 297 | Ga0495608_0080915 | 3300046511 | Bacteria | 2111 |
| 298 | Ga0495618_0000267 | 3300046514 | Bacteria | 37924 |
| 299 | Ga0495618_0181771 | 3300046514 | Bacteria | 1336 |
| 300 | Ga0495620_0000041 | 3300046515 | Bacteria | 112605 |
| 301 | Ga0495628_0000794 | 3300046516 | Bacteria | 29108 |
| 302 | Ga0495628_0035805 | 3300046516 | Bacteria | 3988 |
| 303 | Ga0495628_0089356 | 3300046516 | Bacteria | 2386 |
| 304 | Ga0495628_0122167 | 3300046516 | Bacteria | 1997 |
| 305 | Ga0495628_0243944 | 3300046516 | Bacteria | 1343 |
| 306 | Ga0495630_0000026 | 3300046517 | Bacteria | 147084 |
| 307 | Ga0495630_0000032 | 3300046517 | Bacteria | 134425 |
| 308 | Ga0495630_0007095 | 3300046517 | Bacteria | 7981 |
| 309 | Ga0495644_0002837 | 3300046523 | Bacteria | 6867 |
| 310 | Ga0495652_0000018 | 3300046529 | Bacteria | 201634 |
| 311 | Ga0495652_0086425 | 3300046529 | Bacteria | 2575 |
| 312 | Ga0495586_0000254 | 3300046535 | Bacteria | 35015 |
| 313 | Ga0495587_0000272 | 3300046536 | Bacteria | 36939 |
| 314 | Ga0495598_0002543 | 3300046537 | Bacteria | 3771 |
| 315 | Ga0495645_0006138 | 3300046543 | Bacteria | 8316 |
| 316 | Ga0495645_0118566 | 3300046543 | Bacteria | 1865 |
| 317 | Ga0495622_0000097 | 3300046557 | Bacteria | 76953 |
| 318 | Ga0495667_0000038 | 3300046559 | Bacteria | 131349 |
| 319 | Ga0495667_0060775 | 3300046559 | Bacteria | 2478 |
| 320 | Ga0495634_0000002 | 3300046642 | Bacteria | 247842 |
| 321 | Ga0495634_0001691 | 3300046642 | Bacteria | 19214 |
| 322 | Ga0495634_0010144 | 3300046642 | Bacteria | 6911 |
| 323 | Ga0495625_0000243 | 3300046660 | Bacteria | 85589 |
| 324 | Ga0495635_0000005 | 3300046663 | Bacteria | 302178 |
| 325 | Ga0495588_0000073 | 3300046674 | Bacteria | 219005 |
| 326 | Ga0495588_0073193 | 3300046674 | Bacteria | 1784 |
| 327 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 328 | Ga0495657_0021495 | 3300046675 | Bacteria | 4629 |
| 329 | Ga0495599_0005867 | 3300046678 | Bacteria | 7377 |
| 330 | Ga0495599_0118123 | 3300046678 | Bacteria | 1649 |
| 331 | Ga0495647_0000005 | 3300046681 | Bacteria | 125996 |
| 332 | Ga0495647_0007800 | 3300046681 | Bacteria | 3594 |
| 333 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 334 | Ga0495658_0002091 | 3300046683 | Bacteria | 10135 |
| 335 | Ga0495669_0000483 | 3300046684 | Bacteria | 18439 |
| 336 | Ga0495669_0084535 | 3300046684 | Bacteria | 1459 |
| 337 | Ga0495613_0000027 | 3300046689 | Bacteria | 146674 |
| 338 | Ga0495613_0009561 | 3300046689 | Bacteria | 7202 |
| 339 | Ga0495613_0112287 | 3300046689 | Bacteria | 1963 |
| 340 | Ga0495624_0000123 | 3300046690 | Bacteria | 54291 |
| 341 | Ga0495624_0000691 | 3300046690 | Bacteria | 26457 |
| 342 | Ga0495624_0025621 | 3300046690 | Bacteria | 3871 |
| 343 | Ga0495649_0004688 | 3300046694 | Bacteria | 8878 |
| 344 | Ga0495600_0032852 | 3300046809 | Bacteria | 3367 |
| 345 | Ga0495604_0000100 | 3300047317 | Bacteria | 72995 |
| 346 | Ga0495604_0000723 | 3300047317 | Bacteria | 27948 |
| 347 | Ga0495604_0032236 | 3300047317 | Bacteria | 4155 |
| 348 | Ga0495674_0000039 | 3300047319 | Bacteria | 97645 |
| 349 | Ga0495676_0007903 | 3300047321 | Bacteria | 9752 |
| 350 | Ga0495676_0016441 | 3300047321 | Bacteria | 6568 |
| 351 | Ga0495676_0028720 | 3300047321 | Bacteria | 4746 |
| 352 | Ga0495680_0000007 | 3300047322 | Bacteria | 152053 |
| 353 | Ga0495680_0000929 | 3300047322 | Bacteria | 32526 |
| 354 | Ga0495680_0001001 | 3300047322 | Bacteria | 31451 |
| 355 | Ga0495675_0000002 | 3300047444 | Bacteria | 216469 |
| 356 | Ga0495675_0046104 | 3300047444 | Bacteria | 2776 |
| 357 | Ga0495679_006392 | 3300047446 | Bacteria | 5081 |
| 358 | Ga0495685_032826 | 3300047447 | Bacteria | 1784 |
| 359 | Ga0495593_0068616 | 3300047673 | Bacteria | 1845 |
| 360 | Ga0495602_0000034 | 3300048088 | Bacteria | 140722 |
| 361 | Ga0495602_0006995 | 3300048088 | Bacteria | 11843 |
| 362 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 363 | Ga0496100_0000024 | 3300048903 | Bacteria | 116138 |
| 364 | Ga0496100_0002659 | 3300048903 | Bacteria | 9113 |
| 365 | Ga0496101_0000028 | 3300048904 | Bacteria | 198664 |
| 366 | Ga0496101_0000072 | 3300048904 | Bacteria | 116138 |
| 367 | Ga0496101_0001403 | 3300048904 | Bacteria | 14427 |
| 368 | Ga0496101_0024877 | 3300048904 | Bacteria | 4150 |
| 369 | Ga0496102_0000749 | 3300048905 | Bacteria | 31723 |
| 370 | Ga0496102_0090421 | 3300048905 | Bacteria | 2833 |
| 371 | Ga0496102_0098336 | 3300048905 | Bacteria | 2715 |
| 372 | Ga0496102_0099089 | 3300048905 | Bacteria | 2705 |
| 373 | Ga0496103_0000481 | 3300048906 | Bacteria | 33518 |
| 374 | Ga0496103_0023194 | 3300048906 | Bacteria | 3741 |
| 375 | Ga0496103_0152873 | 3300048906 | Bacteria | 1479 |
| 376 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 377 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 378 | Ga0496104_0000579 | 3300048907 | Bacteria | 31244 |
| 379 | Ga0496104_0034784 | 3300048907 | Bacteria | 4699 |
| 380 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 381 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 382 | Ga0496105_0000051 | 3300048908 | Bacteria | 90365 |
| 383 | Ga0496106_0000040 | 3300048909 | Bacteria | 108754 |
| 384 | Ga0496106_0000042 | 3300048909 | Bacteria | 106662 |
| 385 | Ga0496106_0000218 | 3300048909 | Bacteria | 40075 |
| 386 | Ga0496106_0013759 | 3300048909 | Bacteria | 5977 |
| 387 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 388 | Ga0496107_0000025 | 3300048910 | Bacteria | 116138 |
| 389 | Ga0496107_0021126 | 3300048910 | Bacteria | 4601 |
| 390 | Ga0496107_0151562 | 3300048910 | Bacteria | 1715 |
| 391 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 392 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 393 | Ga0496108_0014805 | 3300048911 | Bacteria | 6364 |
| 394 | Ga0496108_0024629 | 3300048911 | Bacteria | 4956 |
| 395 | Ga0496108_0030741 | 3300048911 | Bacteria | 4450 |
| 396 | Ga0496108_0149035 | 3300048911 | Bacteria | 2018 |
| 397 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 398 | Ga0496109_0000013 | 3300048912 | Bacteria | 227469 |
| 399 | Ga0496109_0000221 | 3300048912 | Bacteria | 56054 |
| 400 | Ga0496109_0000378 | 3300048912 | Bacteria | 40469 |
| 401 | Ga0496109_0067263 | 3300048912 | Bacteria | 3282 |
| 402 | Ga0496109_0099553 | 3300048912 | Bacteria | 2696 |
| 403 | Ga0496109_0300487 | 3300048912 | Bacteria | 1513 |
| 404 | Ga0496110_0000052 | 3300048913 | Bacteria | 58549 |
| 405 | Ga0496110_0032719 | 3300048913 | Bacteria | 4494 |
| 406 | Ga0496110_0118739 | 3300048913 | Bacteria | 2381 |
| 407 | Ga0496110_0321698 | 3300048913 | Bacteria | 1409 |
| 408 | Ga0496110_0367488 | 3300048913 | Bacteria | 1311 |
| 409 | Ga0496110_0419505 | 3300048913 | Bacteria | 1220 |
| 410 | Ga0496111_0000121 | 3300048914 | Bacteria | 33902 |
| 411 | Ga0496111_0026764 | 3300048914 | Bacteria | 4074 |
| 412 | Ga0496112_0000026 | 3300048915 | Bacteria | 144758 |
| 413 | Ga0496112_0000173 | 3300048915 | Bacteria | 41090 |
| 414 | Ga0496112_0012664 | 3300048915 | Bacteria | 7755 |
| 415 | Ga0496112_0081801 | 3300048915 | Bacteria | 3194 |
| 416 | Ga0496113_0000005 | 3300048916 | Bacteria | 105956 |
| 417 | Ga0496113_0012533 | 3300048916 | Bacteria | 5703 |
| 418 | Ga0496113_0019903 | 3300048916 | Bacteria | 4706 |
| 419 | Ga0496113_0024909 | 3300048916 | Bacteria | 4260 |
| 420 | Ga0496113_0063062 | 3300048916 | Bacteria | 2801 |
| 421 | Ga0496113_0206548 | 3300048916 | Bacteria | 1562 |
| 422 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 423 | Ga0496114_0012219 | 3300048917 | Bacteria | 6871 |
| 424 | Ga0496114_0190191 | 3300048917 | Bacteria | 1796 |
| 425 | Ga0496114_0267600 | 3300048917 | Bacteria | 1506 |
| 426 | Ga0496115_0000016 | 3300048918 | Bacteria | 187067 |
| 427 | Ga0496115_0051024 | 3300048918 | Bacteria | 3317 |
| 428 | Ga0496116_0001008 | 3300048919 | Bacteria | 34374 |
| 429 | Ga0496117_0006601 | 3300048920 | Bacteria | 11660 |
| 430 | Ga0496117_0074704 | 3300048920 | Bacteria | 2255 |
| 431 | Ga0496119_0004936 | 3300048922 | Bacteria | 13043 |
| 432 | Ga0496119_0015223 | 3300048922 | Bacteria | 5946 |
| 433 | Ga0496119_0015990 | 3300048922 | Bacteria | 5736 |
| 434 | Ga0496120_0009403 | 3300048923 | Bacteria | 6944 |
| 435 | Ga0496121_0021469 | 3300048924 | Bacteria | 6321 |
| 436 | Ga0496121_0022580 | 3300048924 | Bacteria | 6097 |
| 437 | Ga0496121_0167567 | 3300048924 | Bacteria | 1599 |
| 438 | Ga0496124_0026458 | 3300048927 | Bacteria | 5230 |
| 439 | Ga0496124_0237578 | 3300048927 | Bacteria | 1357 |
| 440 | Ga0495682_0089528 | 3300049460 | Bacteria | 1106 |
| 441 | Ga0501031_0006509 | 3300049568 | Bacteria | 7613 |
| 442 | Ga0501032_0007300 | 3300049569 | Bacteria | 8084 |
| 443 | Ga0501033_0001901 | 3300049570 | Bacteria | 18171 |
| 444 | Ga0501034_0007803 | 3300049571 | Bacteria | 11386 |
| 445 | Ga0501034_0030315 | 3300049571 | Bacteria | 5498 |
| 446 | Ga0501036_0001783 | 3300049572 | Bacteria | 16706 |
| 447 | Ga0501037_0001034 | 3300049573 | Bacteria | 20571 |
| 448 | Ga0501038_0002131 | 3300049574 | Bacteria | 18372 |
| 449 | Ga0501039_0023575 | 3300049575 | Bacteria | 4723 |
| 450 | Ga0501039_0045783 | 3300049575 | Bacteria | 3380 |
| 451 | Ga0501040_0075248 | 3300049576 | Bacteria | 2333 |
| 452 | Ga0501042_0077366 | 3300049578 | Bacteria | 2382 |
| 453 | Ga0501042_0087641 | 3300049578 | Bacteria | 2233 |
| 454 | Ga0501043_0009548 | 3300049579 | Bacteria | 7604 |
| 455 | Ga0501046_0011259 | 3300049580 | Bacteria | 7656 |
| 456 | Ga0501047_0013797 | 3300049581 | Bacteria | 7674 |
| 457 | Ga0501047_0015422 | 3300049581 | Bacteria | 7279 |
| 458 | Ga0501047_0075389 | 3300049581 | Bacteria | 3246 |
| 459 | Ga0501047_0200521 | 3300049581 | Bacteria | 1856 |
| 460 | Ga0501048_0008391 | 3300049582 | Bacteria | 7811 |
| 461 | Ga0501067_0201205 | 3300049583 | Bacteria | 1109 |
| 462 | Ga0501069_0014098 | 3300049585 | Bacteria | 4268 |
| 463 | Ga0501069_0047144 | 3300049585 | Bacteria | 2391 |
| 464 | Ga0501070_0001885 | 3300049586 | Bacteria | 18541 |
| 465 | Ga0501071_0009677 | 3300049587 | Bacteria | 6433 |
| 466 | Ga0501071_0058417 | 3300049587 | Bacteria | 2789 |
| 467 | Ga0501071_0215211 | 3300049587 | Bacteria | 1445 |
| 468 | Ga0501072_0011549 | 3300049588 | Bacteria | 6749 |
| 469 | Ga0501072_0223007 | 3300049588 | Bacteria | 1502 |
| 470 | Ga0501073_0022180 | 3300049589 | Bacteria | 4575 |
| 471 | Ga0501075_0068758 | 3300049591 | Bacteria | 2676 |
| 472 | Ga0501076_0018024 | 3300049592 | Bacteria | 5373 |
| 473 | Ga0501076_0025434 | 3300049592 | Bacteria | 4581 |
| 474 | Ga0501077_0051369 | 3300049593 | Bacteria | 2620 |
| 475 | Ga0501079_0013207 | 3300049741 | Bacteria | 6298 |
| 476 | Ga0501079_0080196 | 3300049741 | Bacteria | 2524 |
| 477 | Ga0501079_0106903 | 3300049741 | Bacteria | 2171 |
| 478 | Ga0501080_0332763 | 3300049742 | Bacteria | 1373 |
| 479 | Ga0501081_0054753 | 3300049743 | Bacteria | 2756 |
| 480 | Ga0501083_0009544 | 3300049744 | Bacteria | 6854 |
| 481 | Ga0501083_0032875 | 3300049744 | Bacteria | 3554 |
| 482 | Ga0501083_0076030 | 3300049744 | Bacteria | 2229 |
| 483 | Ga0501035_0012533 | 3300049822 | Bacteria | 7831 |
| 484 | Ga0501035_0314754 | 3300049822 | Bacteria | 1316 |
| 485 | Ga0501044_0017031 | 3300049823 | Bacteria | 7798 |
| 486 | Ga0501044_0059974 | 3300049823 | Bacteria | 3897 |
| 487 | Ga0501044_0243704 | 3300049823 | Bacteria | 1740 |
| 488 | Ga0501045_0082876 | 3300049824 | Bacteria | 2365 |
| 489 | Ga0501045_0198254 | 3300049824 | Bacteria | 1496 |
| 490 | nmdc:mga03n38_11283_c1 | 3300050490 | Bacteria | 3322 |
| 491 | nmdc:mga00v17_23670_c1 | 3300050491 | Bacteria | 3555 |
| 492 | nmdc:mga00v17_3816_c1 | 3300050491 | Bacteria | 7772 |
| 493 | nmdc:mga0yw44_152169_c1 | 3300050492 | Bacteria | 1510 |
| 494 | nmdc:mga0yw44_76137_c1 | 3300050492 | Bacteria | 2094 |
| 495 | nmdc:mga06z11_43922_c1 | 3300050494 | Bacteria | 2251 |
| 496 | nmdc:mga05p37_105886_c1 | 3300050507 | Bacteria | 3459 |
| 497 | nmdc:mga05p37_122843_c1 | 3300050507 | Bacteria | 3189 |
| 498 | nmdc:mga05p37_19674_c1 | 3300050507 | Bacteria | 8168 |
| 499 | nmdc:mga09592_331972_c1 | 3300050508 | Bacteria | 1316 |
| 500 | nmdc:mga0qj67_36725_c1 | 3300050509 | Bacteria | 3835 |
| 501 | nmdc:mga0qj67_84895_c1 | 3300050509 | Bacteria | 2539 |
| 502 | nmdc:mga06r32_15234_c1 | 3300050510 | Bacteria | 6984 |
| 503 | nmdc:mga06r32_34834_c1 | 3300050510 | Bacteria | 4749 |
| 504 | nmdc:mga08y16_2963_c1 | 3300050511 | Bacteria | 17497 |
| 505 | nmdc:mga08y16_911352_c1 | 3300050511 | Bacteria | 864 |
| 506 | nmdc:mga0n895_150585_c1 | 3300050512 | Bacteria | 2357 |
| 507 | nmdc:mga0n895_25001_c1 | 3300050512 | Bacteria | 5637 |
| 508 | nmdc:mga08x19_234741_c1 | 3300050514 | Bacteria | 1263 |
| 509 | nmdc:mga0a205_219773_c1 | 3300050515 | Bacteria | 1786 |
| 510 | nmdc:mga0a205_4_c1 | 3300050515 | Bacteria | 168154 |
| 511 | nmdc:mga0a205_61369_c1 | 3300050515 | Bacteria | 3631 |
| 512 | Ga0495601_0000017 | 3300053077 | Bacteria | 204209 |
| 513 | Ga0495601_0000318 | 3300053077 | Bacteria | 25520 |
| 514 | Ga0495601_0024434 | 3300053077 | Bacteria | 3721 |
| 515 | Ga0495601_0028110 | 3300053077 | Bacteria | 3481 |
| 516 | Ga0495601_0038538 | 3300053077 | Bacteria | 2990 |
| 517 | Ga0495601_0048712 | 3300053077 | Bacteria | 2669 |
| 518 | Ga0495601_0084681 | 3300053077 | Bacteria | 2037 |
| 519 | Ga0495601_0201060 | 3300053077 | Bacteria | 1302 |
| 520 | Ga0495612_0000155 | 3300053078 | Bacteria | 28711 |
| 521 | Ga0495612_0003068 | 3300053078 | Bacteria | 6928 |
| 522 | Ga0495612_0020692 | 3300053078 | Bacteria | 2637 |
| 523 | Ga0495612_0084839 | 3300053078 | Bacteria | 1334 |
| 524 | Ga0495655_0000005 | 3300053083 | Bacteria | 257472 |
| 525 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 526 | Ga0495595_0000378 | 3300053084 | Bacteria | 16864 |
| 527 | Ga0495595_0036298 | 3300053084 | Bacteria | 2236 |
| 528 | Ga0495595_0058305 | 3300053084 | Bacteria | 1803 |
| 529 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 530 | Ga0495619_0000026 | 3300053085 | Bacteria | 167387 |
| 531 | Ga0495619_0000088 | 3300053085 | Bacteria | 69615 |
| 532 | Ga0495619_0000127 | 3300053085 | Bacteria | 55995 |
| 533 | Ga0495619_0000346 | 3300053085 | Bacteria | 32476 |
| 534 | Ga0495619_0006101 | 3300053085 | Bacteria | 7631 |
| 535 | Ga0495619_0039095 | 3300053085 | Bacteria | 3096 |
| 536 | Ga0495619_0127908 | 3300053085 | Bacteria | 1744 |
| 537 | Ga0500566_0001830 | 3300053094 | Bacteria | 12505 |
| 538 | Ga0500641_0000873 | 3300053096 | Bacteria | 10782 |
| 539 | Ga0500595_014028 | 3300053119 | Bacteria | 3052 |
| 540 | Ga0500614_001618 | 3300053123 | Bacteria | 5307 |
| 541 | Ga0500628_000013 | 3300053129 | Bacteria | 106419 |
| 542 | Ga0501084_0023130 | 3300054114 | Bacteria | 5188 |
| 543 | Ga0501082_0079130 | 3300060353 | Bacteria | 2836 |
| 544 | Ga0501082_0146498 | 3300060353 | Bacteria | 2050 |
| 545 | Ga0501082_0187661 | 3300060353 | Bacteria | 1799 |
| 546 | Ga0530510_0046085 | 3300061734 | Bacteria | 3149 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050511 | nmdc:mga08y16_911352_c1 | nmdc:mga08y16_911352_c1_25_852 | 271 |
| 2 | 3300006038 | Ga0075365_10012400 | Ga0075365_100124001 | 284 |
| 3 | 3300009545 | Ga0105237_10030852 | Ga0105237_100308524 | 304 |
| 4 | 3300025914 | Ga0207671_10084315 | Ga0207671_100843152 | 304 |
| 5 | 3300006038 | Ga0075365_10008059 | Ga0075365_100080595 | 313 |
| 6 | 3300006038 | Ga0075365_10043160 | Ga0075365_100431602 | 313 |
| 7 | 3300006048 | Ga0075363_100009258 | Ga0075363_1000092586 | 313 |
| 8 | 3300006051 | Ga0075364_10068807 | Ga0075364_100688073 | 313 |
| 9 | 3300046463 | Ga0495653_0111487 | Ga0495653_0111487_947_1903 | 313 |
| 10 | 3300046473 | Ga0495582_0000003 | Ga0495582_0000003_33971_34981 | 313 |
| 11 | 3300046683 | Ga0495658_0000001 | Ga0495658_0000001_137430_138440 | 313 |
| 12 | 3300049460 | Ga0495682_0089528 | Ga0495682_0089528_125_1090 | 313 |
| 13 | 3300050490 | nmdc:mga03n38_11283_c1 | nmdc:mga03n38_11283_c1_461_1402 | 313 |
| 14 | 3300050492 | nmdc:mga0yw44_152169_c1 | nmdc:mga0yw44_152169_c1_359_1300 | 313 |
| 15 | 3300031727 | Ga0316576_10000603 | Ga0316576_100006033 | 314 |
| 16 | 3300035398 | Ga0316574_0024095 | Ga0316574_0024095_1584_2528 | 314 |
| 17 | 3300049571 | Ga0501034_0007803 | Ga0501034_0007803_2215_3159 | 314 |
| 18 | 3300049571 | Ga0501034_0030315 | Ga0501034_0030315_823_1767 | 314 |
| 19 | 3300049822 | Ga0501035_0314754 | Ga0501035_0314754_234_1178 | 314 |
| 20 | 3300049823 | Ga0501044_0059974 | Ga0501044_0059974_550_1494 | 314 |
| 21 | iso_pu_bacteria | 2786546517 | 2787438033 | 315 |
| 22 | 3300006881 | Ga0068865_100054085 | Ga0068865_1000540855 | 316 |
| 23 | 3300025938 | Ga0207704_10000104 | Ga0207704_1000010428 | 316 |
| 24 | 3300009147 | Ga0114129_10284908 | Ga0114129_102849082 | 319 |
| 25 | 3300035398 | Ga0316574_0118784 | Ga0316574_0118784_239_1222 | 319 |
| 26 | 3300006178 | Ga0075367_10125368 | Ga0075367_101253682 | 320 |
| 27 | 3300049585 | Ga0501069_0014098 | Ga0501069_0014098_3048_4034 | 320 |
| 28 | 3300049588 | Ga0501072_0223007 | Ga0501072_0223007_238_1224 | 320 |
| 29 | 3300049744 | Ga0501083_0076030 | Ga0501083_0076030_1180_2166 | 320 |
| 30 | 3300050491 | nmdc:mga00v17_23670_c1 | nmdc:mga00v17_23670_c1_544_1539 | 320 |
| 31 | 3300005435 | Ga0070714_100004088 | Ga0070714_1000040886 | 321 |
| 32 | 3300005435 | Ga0070714_100356459 | Ga0070714_1003564592 | 321 |
| 33 | 3300005548 | Ga0070665_100652886 | Ga0070665_1006528861 | 321 |
| 34 | 3300025929 | Ga0207664_10000006 | Ga0207664_10000006240 | 321 |
| 35 | 3300048903 | Ga0496100_0002659 | Ga0496100_0002659_1685_2662 | 321 |
| 36 | 3300048904 | Ga0496101_0001403 | Ga0496101_0001403_6360_7337 | 321 |
| 37 | 3300048913 | Ga0496110_0032719 | Ga0496110_0032719_368_1348 | 321 |
| 38 | 3300050494 | nmdc:mga06z11_43922_c1 | nmdc:mga06z11_43922_c1_1153_2142 | 321 |
| 39 | 3300060353 | Ga0501082_0146498 | Ga0501082_0146498_14_1003 | 321 |
| 40 | 3300005338 | Ga0068868_100072591 | Ga0068868_1000725912 | 322 |
| 41 | 3300005343 | Ga0070687_100012467 | Ga0070687_1000124672 | 322 |
| 42 | 3300005364 | Ga0070673_100100925 | Ga0070673_1001009252 | 322 |
| 43 | 3300005366 | Ga0070659_100000852 | Ga0070659_10000085223 | 322 |
| 44 | 3300005455 | Ga0070663_100021932 | Ga0070663_1000219322 | 322 |
| 45 | 3300005456 | Ga0070678_100226970 | Ga0070678_1002269702 | 322 |
| 46 | 3300005459 | Ga0068867_100007697 | Ga0068867_1000076978 | 322 |
| 47 | 3300005578 | Ga0068854_100021369 | Ga0068854_1000213694 | 322 |
| 48 | 3300005834 | Ga0068851_10083118 | Ga0068851_100831182 | 322 |
| 49 | 3300005844 | Ga0068862_100202398 | Ga0068862_1002023982 | 322 |
| 50 | 3300006881 | Ga0068865_100078856 | Ga0068865_1000788562 | 322 |
| 51 | 3300009098 | Ga0105245_10009368 | Ga0105245_100093688 | 322 |
| 52 | 3300009148 | Ga0105243_10010662 | Ga0105243_100106622 | 322 |
| 53 | 3300010375 | Ga0105239_10030284 | Ga0105239_100302843 | 322 |
| 54 | 3300025918 | Ga0207662_10034095 | Ga0207662_100340953 | 322 |
| 55 | 3300025919 | Ga0207657_10007235 | Ga0207657_100072356 | 322 |
| 56 | 3300025927 | Ga0207687_10101546 | Ga0207687_101015462 | 322 |
| 57 | 3300025932 | Ga0207690_10112859 | Ga0207690_101128592 | 322 |
| 58 | 3300025938 | Ga0207704_10026478 | Ga0207704_100264783 | 322 |
| 59 | 3300025940 | Ga0207691_10003769 | Ga0207691_100037692 | 322 |
| 60 | 3300025960 | Ga0207651_10032078 | Ga0207651_100320783 | 322 |
| 61 | 3300026067 | Ga0207678_10001975 | Ga0207678_1000197513 | 322 |
| 62 | 3300026089 | Ga0207648_10013215 | Ga0207648_100132154 | 322 |
| 63 | 3300026116 | Ga0207674_10050746 | Ga0207674_100507462 | 322 |
| 64 | 3300028379 | Ga0268266_10081443 | Ga0268266_100814431 | 322 |
| 65 | 3300031901 | Ga0307406_10112797 | Ga0307406_101127972 | 322 |
| 66 | 3300035398 | Ga0316574_0082417 | Ga0316574_0082417_89_1081 | 322 |
| 67 | 3300048911 | Ga0496108_0149035 | Ga0496108_0149035_961_1953 | 322 |
| 68 | 3300048912 | Ga0496109_0099553 | Ga0496109_0099553_132_1124 | 322 |
| 69 | 3300048915 | Ga0496112_0000173 | Ga0496112_0000173_6005_6985 | 322 |
| 70 | 3300048916 | Ga0496113_0019903 | Ga0496113_0019903_1676_2668 | 322 |
| 71 | 3300049575 | Ga0501039_0023575 | Ga0501039_0023575_3574_4572 | 322 |
| 72 | 3300049575 | Ga0501039_0045783 | Ga0501039_0045783_304_1287 | 322 |
| 73 | 3300049578 | Ga0501042_0077366 | Ga0501042_0077366_1373_2356 | 322 |
| 74 | 3300049587 | Ga0501071_0009677 | Ga0501071_0009677_2847_3830 | 322 |
| 75 | 3300049588 | Ga0501072_0011549 | Ga0501072_0011549_5428_6411 | 322 |
| 76 | 3300049591 | Ga0501075_0068758 | Ga0501075_0068758_1109_2092 | 322 |
| 77 | 3300049592 | Ga0501076_0018024 | Ga0501076_0018024_924_1907 | 322 |
| 78 | 3300049593 | Ga0501077_0051369 | Ga0501077_0051369_924_1907 | 322 |
| 79 | 3300049741 | Ga0501079_0013207 | Ga0501079_0013207_3662_4645 | 322 |
| 80 | 3300049743 | Ga0501081_0054753 | Ga0501081_0054753_581_1564 | 322 |
| 81 | 3300049824 | Ga0501045_0082876 | Ga0501045_0082876_472_1455 | 322 |
| 82 | 3300054114 | Ga0501084_0023130 | Ga0501084_0023130_940_1932 | 322 |
| 83 | 3300060353 | Ga0501082_0079130 | Ga0501082_0079130_527_1510 | 322 |
| 84 | 3300061734 | Ga0530510_0046085 | Ga0530510_0046085_1427_2410 | 322 |
| 85 | 3300044765 | Ga0466970_0019251 | Ga0466970_0019251_195_1175 | 323 |
| 86 | 3300005614 | Ga0068856_100000136 | Ga0068856_10000013672 | 324 |
| 87 | 3300026078 | Ga0207702_10000105 | Ga0207702_10000105102 | 324 |
| 88 | 3300048927 | Ga0496124_0026458 | Ga0496124_0026458_1124_2107 | 324 |
| 89 | 3300005341 | Ga0070691_10000970 | Ga0070691_100009704 | 326 |
| 90 | 3300053119 | Ga0500595_014028 | Ga0500595_014028_1288_2310 | 326 |
| 91 | 3300005718 | Ga0068866_10004817 | Ga0068866_100048174 | 327 |
| 92 | 3300005937 | Ga0081455_10010690 | Ga0081455_100106905 | 327 |
| 93 | 3300005983 | Ga0081540_1000557 | Ga0081540_100055727 | 327 |
| 94 | 3300014968 | Ga0157379_10246886 | Ga0157379_102468862 | 327 |
| 95 | 3300025899 | Ga0207642_10003444 | Ga0207642_100034445 | 327 |
| 96 | 3300046499 | Ga0495594_0000009 | Ga0495594_0000009_41902_42900 | 327 |
| 97 | 3300046557 | Ga0495622_0000097 | Ga0495622_0000097_58265_59263 | 327 |
| 98 | 3300048905 | Ga0496102_0090421 | Ga0496102_0090421_406_1422 | 327 |
| 99 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_496421_497422 | 327 |
| 100 | 3300048918 | Ga0496115_0051024 | Ga0496115_0051024_645_1643 | 327 |
| 101 | 3300048920 | Ga0496117_0006601 | Ga0496117_0006601_4631_5656 | 327 |
| 102 | 3300048922 | Ga0496119_0015990 | Ga0496119_0015990_1827_2843 | 327 |
| 103 | 3300048923 | Ga0496120_0009403 | Ga0496120_0009403_355_1371 | 327 |
| 104 | 3300048924 | Ga0496121_0022580 | Ga0496121_0022580_2888_3904 | 327 |
| 105 | 3300048924 | Ga0496121_0167567 | Ga0496121_0167567_195_1211 | 327 |
| 106 | 3300049744 | Ga0501083_0009544 | Ga0501083_0009544_3542_4552 | 327 |
| 107 | 3300053096 | Ga0500641_0000873 | Ga0500641_0000873_6401_7408 | 327 |
| 108 | 3300009147 | Ga0114129_10125475 | Ga0114129_101254753 | 328 |
| 109 | 3300013308 | Ga0157375_10000492 | Ga0157375_1000049216 | 328 |
| 110 | 3300020080 | Ga0206350_10333991 | Ga0206350_103339913 | 328 |
| 111 | 3300050507 | nmdc:mga05p37_105886_c1 | nmdc:mga05p37_105886_c1_1733_2782 | 328 |
| 112 | 3300005335 | Ga0070666_10009188 | Ga0070666_100091885 | 329 |
| 113 | 3300005341 | Ga0070691_10000004 | Ga0070691_1000000415 | 329 |
| 114 | 3300005344 | Ga0070661_100000004 | Ga0070661_100000004226 | 329 |
| 115 | 3300005347 | Ga0070668_100010212 | Ga0070668_1000102123 | 329 |
| 116 | 3300005347 | Ga0070668_100019643 | Ga0070668_1000196434 | 329 |
| 117 | 3300005367 | Ga0070667_100003085 | Ga0070667_1000030852 | 329 |
| 118 | 3300005367 | Ga0070667_100068631 | Ga0070667_1000686312 | 329 |
| 119 | 3300005436 | Ga0070713_100000503 | Ga0070713_1000005036 | 329 |
| 120 | 3300005466 | Ga0070685_10000010 | Ga0070685_10000010107 | 329 |
| 121 | 3300005530 | Ga0070679_100000471 | Ga0070679_10000047121 | 329 |
| 122 | 3300005543 | Ga0070672_100000031 | Ga0070672_10000003150 | 329 |
| 123 | 3300005548 | Ga0070665_100002868 | Ga0070665_10000286817 | 329 |
| 124 | 3300005564 | Ga0070664_100193884 | Ga0070664_1001938842 | 329 |
| 125 | 3300005616 | Ga0068852_100064550 | Ga0068852_1000645503 | 329 |
| 126 | 3300005834 | Ga0068851_10002105 | Ga0068851_100021053 | 329 |
| 127 | 3300005841 | Ga0068863_100008832 | Ga0068863_1000088324 | 329 |
| 128 | 3300005841 | Ga0068863_100268176 | Ga0068863_1002681762 | 329 |
| 129 | 3300005844 | Ga0068862_100001309 | Ga0068862_10000130924 | 329 |
| 130 | 3300005937 | Ga0081455_10016053 | Ga0081455_100160537 | 329 |
| 131 | 3300005983 | Ga0081540_1000174 | Ga0081540_100017418 | 329 |
| 132 | 3300006038 | Ga0075365_10001651 | Ga0075365_100016517 | 329 |
| 133 | 3300006844 | Ga0075428_100243017 | Ga0075428_1002430172 | 329 |
| 134 | 3300006846 | Ga0075430_100026320 | Ga0075430_1000263202 | 329 |
| 135 | 3300006847 | Ga0075431_100003746 | Ga0075431_1000037462 | 329 |
| 136 | 3300006871 | Ga0075434_100001338 | Ga0075434_10000133815 | 329 |
| 137 | 3300009101 | Ga0105247_10000131 | Ga0105247_1000013151 | 329 |
| 138 | 3300009147 | Ga0114129_10030345 | Ga0114129_100303456 | 329 |
| 139 | 3300009148 | Ga0105243_10010381 | Ga0105243_100103814 | 329 |
| 140 | 3300009176 | Ga0105242_10000063 | Ga0105242_1000006354 | 329 |
| 141 | 3300009176 | Ga0105242_10000428 | Ga0105242_1000042827 | 329 |
| 142 | 3300009177 | Ga0105248_10192317 | Ga0105248_101923173 | 329 |
| 143 | 3300009545 | Ga0105237_10237342 | Ga0105237_102373423 | 329 |
| 144 | 3300009553 | Ga0105249_10004038 | Ga0105249_100040386 | 329 |
| 145 | 3300010375 | Ga0105239_10210502 | Ga0105239_102105023 | 329 |
| 146 | 3300013297 | Ga0157378_10018349 | Ga0157378_100183493 | 329 |
| 147 | 3300013308 | Ga0157375_10030090 | Ga0157375_100300907 | 329 |
| 148 | 3300014326 | Ga0157380_10000007 | Ga0157380_1000000742 | 329 |
| 149 | 3300014968 | Ga0157379_10049463 | Ga0157379_100494632 | 329 |
| 150 | 3300025321 | Ga0207656_10002076 | Ga0207656_100020764 | 329 |
| 151 | 3300025900 | Ga0207710_10000268 | Ga0207710_1000026830 | 329 |
| 152 | 3300025903 | Ga0207680_10004865 | Ga0207680_100048655 | 329 |
| 153 | 3300025913 | Ga0207695_10251788 | Ga0207695_102517881 | 329 |
| 154 | 3300025915 | Ga0207693_10014431 | Ga0207693_100144314 | 329 |
| 155 | 3300025920 | Ga0207649_10000003 | Ga0207649_1000000334 | 329 |
| 156 | 3300025921 | Ga0207652_10000412 | Ga0207652_1000041223 | 329 |
| 157 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003185 | 329 |
| 158 | 3300025931 | Ga0207644_10152774 | Ga0207644_101527742 | 329 |
| 159 | 3300025934 | Ga0207686_10000124 | Ga0207686_100001245 | 329 |
| 160 | 3300025934 | Ga0207686_10000395 | Ga0207686_1000039514 | 329 |
| 161 | 3300025940 | Ga0207691_10000178 | Ga0207691_1000017836 | 329 |
| 162 | 3300025941 | Ga0207711_10073917 | Ga0207711_100739173 | 329 |
| 163 | 3300025944 | Ga0207661_10003560 | Ga0207661_100035605 | 329 |
| 164 | 3300025944 | Ga0207661_10005006 | Ga0207661_1000500610 | 329 |
| 165 | 3300025949 | Ga0207667_10470726 | Ga0207667_104707262 | 329 |
| 166 | 3300025961 | Ga0207712_10019638 | Ga0207712_100196385 | 329 |
| 167 | 3300025972 | Ga0207668_10006557 | Ga0207668_100065576 | 329 |
| 168 | 3300025986 | Ga0207658_10015937 | Ga0207658_100159373 | 329 |
| 169 | 3300026067 | Ga0207678_10002172 | Ga0207678_100021723 | 329 |
| 170 | 3300026075 | Ga0207708_10225037 | Ga0207708_102250373 | 329 |
| 171 | 3300026088 | Ga0207641_10006453 | Ga0207641_100064539 | 329 |
| 172 | 3300026116 | Ga0207674_10414054 | Ga0207674_104140541 | 329 |
| 173 | 3300027907 | Ga0207428_10013276 | Ga0207428_100132765 | 329 |
| 174 | 3300028379 | Ga0268266_10000526 | Ga0268266_1000052626 | 329 |
| 175 | 3300028379 | Ga0268266_10000990 | Ga0268266_1000099031 | 329 |
| 176 | 3300028380 | Ga0268265_10008679 | Ga0268265_100086796 | 329 |
| 177 | 3300028381 | Ga0268264_10024255 | Ga0268264_100242555 | 329 |
| 178 | 3300028563 | Ga0265319_1000010 | Ga0265319_100001037 | 329 |
| 179 | 3300028800 | Ga0265338_10000287 | Ga0265338_1000028772 | 329 |
| 180 | 3300031241 | Ga0265325_10051053 | Ga0265325_100510532 | 329 |
| 181 | 3300037418 | Ga0395900_0008759 | Ga0395900_0008759_67_1080 | 329 |
| 182 | 3300037466 | Ga0395898_0032878 | Ga0395898_0032878_3050_4063 | 329 |
| 183 | 3300037466 | Ga0395898_0168643 | Ga0395898_0168643_831_1850 | 329 |
| 184 | 3300038443 | Ga0395901_0144181 | Ga0395901_0144181_1138_2151 | 329 |
| 185 | 3300041512 | Ga0451853_1416621 | Ga0451853_1416621_124_1146 | 329 |
| 186 | 3300046459 | Ga0495629_0000828 | Ga0495629_0000828_15080_16084 | 329 |
| 187 | 3300046459 | Ga0495629_0010841 | Ga0495629_0010841_420_1424 | 329 |
| 188 | 3300046461 | Ga0495641_0016090 | Ga0495641_0016090_2083_3087 | 329 |
| 189 | 3300046476 | Ga0495662_0002109 | Ga0495662_0002109_765_1772 | 329 |
| 190 | 3300046507 | Ga0495606_0000017 | Ga0495606_0000017_62771_63775 | 329 |
| 191 | 3300046517 | Ga0495630_0000032 | Ga0495630_0000032_80324_81328 | 329 |
| 192 | 3300046536 | Ga0495587_0000272 | Ga0495587_0000272_12094_13098 | 329 |
| 193 | 3300046674 | Ga0495588_0000073 | Ga0495588_0000073_166295_167299 | 329 |
| 194 | 3300046690 | Ga0495624_0000691 | Ga0495624_0000691_10460_11464 | 329 |
| 195 | 3300047319 | Ga0495674_0000039 | Ga0495674_0000039_92250_93263 | 329 |
| 196 | 3300047321 | Ga0495676_0007903 | Ga0495676_0007903_8156_9160 | 329 |
| 197 | 3300047321 | Ga0495676_0028720 | Ga0495676_0028720_3069_4073 | 329 |
| 198 | 3300047444 | Ga0495675_0046104 | Ga0495675_0046104_1394_2407 | 329 |
| 199 | 3300047673 | Ga0495593_0068616 | Ga0495593_0068616_685_1689 | 329 |
| 200 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_86184_87188 | 329 |
| 201 | 3300048904 | Ga0496101_0000028 | Ga0496101_0000028_86173_87177 | 329 |
| 202 | 3300048905 | Ga0496102_0000749 | Ga0496102_0000749_14687_15691 | 329 |
| 203 | 3300048906 | Ga0496103_0000481 | Ga0496103_0000481_26658_27662 | 329 |
| 204 | 3300048906 | Ga0496103_0152873 | Ga0496103_0152873_45_1067 | 329 |
| 205 | 3300048907 | Ga0496104_0000010 | Ga0496104_0000010_212648_213652 | 329 |
| 206 | 3300048908 | Ga0496105_0000005 | Ga0496105_0000005_212648_213652 | 329 |
| 207 | 3300048909 | Ga0496106_0000218 | Ga0496106_0000218_19187_20191 | 329 |
| 208 | 3300048910 | Ga0496107_0000002 | Ga0496107_0000002_161300_162304 | 329 |
| 209 | 3300048911 | Ga0496108_0030741 | Ga0496108_0030741_1707_2714 | 329 |
| 210 | 3300048912 | Ga0496109_0000221 | Ga0496109_0000221_53220_54233 | 329 |
| 211 | 3300048913 | Ga0496110_0118739 | Ga0496110_0118739_164_1168 | 329 |
| 212 | 3300048917 | Ga0496114_0190191 | Ga0496114_0190191_504_1508 | 329 |
| 213 | 3300048918 | Ga0496115_0000016 | Ga0496115_0000016_39456_40460 | 329 |
| 214 | 3300048919 | Ga0496116_0001008 | Ga0496116_0001008_28078_29109 | 329 |
| 215 | 3300048922 | Ga0496119_0004936 | Ga0496119_0004936_8306_9337 | 329 |
| 216 | 3300048922 | Ga0496119_0015223 | Ga0496119_0015223_817_1827 | 329 |
| 217 | 3300048924 | Ga0496121_0021469 | Ga0496121_0021469_4577_5587 | 329 |
| 218 | 3300048927 | Ga0496124_0237578 | Ga0496124_0237578_329_1342 | 329 |
| 219 | 3300049568 | Ga0501031_0006509 | Ga0501031_0006509_6323_7330 | 329 |
| 220 | 3300049569 | Ga0501032_0007300 | Ga0501032_0007300_572_1579 | 329 |
| 221 | 3300049570 | Ga0501033_0001901 | Ga0501033_0001901_17008_18015 | 329 |
| 222 | 3300049572 | Ga0501036_0001783 | Ga0501036_0001783_184_1191 | 329 |
| 223 | 3300049573 | Ga0501037_0001034 | Ga0501037_0001034_19381_20388 | 329 |
| 224 | 3300049574 | Ga0501038_0002131 | Ga0501038_0002131_6551_7558 | 329 |
| 225 | 3300049576 | Ga0501040_0075248 | Ga0501040_0075248_1157_2164 | 329 |
| 226 | 3300049579 | Ga0501043_0009548 | Ga0501043_0009548_6441_7448 | 329 |
| 227 | 3300049580 | Ga0501046_0011259 | Ga0501046_0011259_236_1243 | 329 |
| 228 | 3300049581 | Ga0501047_0013797 | Ga0501047_0013797_6511_7518 | 329 |
| 229 | 3300049581 | Ga0501047_0015422 | Ga0501047_0015422_6124_7158 | 329 |
| 230 | 3300049581 | Ga0501047_0075389 | Ga0501047_0075389_532_1539 | 329 |
| 231 | 3300049581 | Ga0501047_0200521 | Ga0501047_0200521_503_1516 | 329 |
| 232 | 3300049582 | Ga0501048_0008391 | Ga0501048_0008391_6412_7419 | 329 |
| 233 | 3300049583 | Ga0501067_0201205 | Ga0501067_0201205_48_1055 | 329 |
| 234 | 3300049585 | Ga0501069_0047144 | Ga0501069_0047144_1203_2216 | 329 |
| 235 | 3300049586 | Ga0501070_0001885 | Ga0501070_0001885_17234_18241 | 329 |
| 236 | 3300049587 | Ga0501071_0058417 | Ga0501071_0058417_1140_2153 | 329 |
| 237 | 3300049587 | Ga0501071_0215211 | Ga0501071_0215211_238_1245 | 329 |
| 238 | 3300049589 | Ga0501073_0022180 | Ga0501073_0022180_3398_4405 | 329 |
| 239 | 3300049592 | Ga0501076_0025434 | Ga0501076_0025434_105_1118 | 329 |
| 240 | 3300049741 | Ga0501079_0106903 | Ga0501079_0106903_148_1155 | 329 |
| 241 | 3300049742 | Ga0501080_0332763 | Ga0501080_0332763_196_1203 | 329 |
| 242 | 3300049744 | Ga0501083_0032875 | Ga0501083_0032875_2318_3325 | 329 |
| 243 | 3300049822 | Ga0501035_0012533 | Ga0501035_0012533_157_1164 | 329 |
| 244 | 3300049823 | Ga0501044_0017031 | Ga0501044_0017031_167_1174 | 329 |
| 245 | 3300049823 | Ga0501044_0243704 | Ga0501044_0243704_571_1584 | 329 |
| 246 | 3300049824 | Ga0501045_0198254 | Ga0501045_0198254_352_1359 | 329 |
| 247 | 3300050507 | nmdc:mga05p37_19674_c1 | nmdc:mga05p37_19674_c1_6004_7059 | 329 |
| 248 | 3300050509 | nmdc:mga0qj67_36725_c1 | nmdc:mga0qj67_36725_c1_2677_3681 | 329 |
| 249 | 3300050510 | nmdc:mga06r32_15234_c1 | nmdc:mga06r32_15234_c1_1693_2748 | 329 |
| 250 | 3300050511 | nmdc:mga08y16_2963_c1 | nmdc:mga08y16_2963_c1_9795_10850 | 329 |
| 251 | 3300050512 | nmdc:mga0n895_25001_c1 | nmdc:mga0n895_25001_c1_2341_3396 | 329 |
| 252 | 3300050515 | nmdc:mga0a205_61369_c1 | nmdc:mga0a205_61369_c1_1309_2364 | 329 |
| 253 | 3300053077 | Ga0495601_0201060 | Ga0495601_0201060_150_1154 | 329 |
| 254 | 3300053078 | Ga0495612_0003068 | Ga0495612_0003068_4857_5861 | 329 |
| 255 | 3300053083 | Ga0495655_0000005 | Ga0495655_0000005_250784_251788 | 329 |
| 256 | 3300053094 | Ga0500566_0001830 | Ga0500566_0001830_5604_6608 | 329 |
| 257 | 3300053129 | Ga0500628_000013 | Ga0500628_000013_5860_6864 | 329 |
| 258 | 3300001977 | JGI24746J21847_1002058 | JGI24746J21847_10020585 | 330 |
| 259 | 3300002074 | JGI24748J21848_1000356 | JGI24748J21848_10003565 | 330 |
| 260 | 3300002239 | JGI24034J26672_10000216 | JGI24034J26672_100002164 | 330 |
| 261 | 3300005329 | Ga0070683_100023947 | Ga0070683_1000239475 | 330 |
| 262 | 3300005337 | Ga0070682_100000023 | Ga0070682_100000023154 | 330 |
| 263 | 3300005337 | Ga0070682_100000026 | Ga0070682_100000026164 | 330 |
| 264 | 3300005338 | Ga0068868_100000694 | Ga0068868_1000006946 | 330 |
| 265 | 3300005340 | Ga0070689_100210380 | Ga0070689_1002103802 | 330 |
| 266 | 3300005354 | Ga0070675_100000050 | Ga0070675_10000005028 | 330 |
| 267 | 3300005356 | Ga0070674_100000141 | Ga0070674_10000014124 | 330 |
| 268 | 3300005365 | Ga0070688_100000686 | Ga0070688_10000068615 | 330 |
| 269 | 3300005365 | Ga0070688_100076412 | Ga0070688_1000764123 | 330 |
| 270 | 3300005366 | Ga0070659_100003678 | Ga0070659_10000367812 | 330 |
| 271 | 3300005436 | Ga0070713_100119207 | Ga0070713_1001192072 | 330 |
| 272 | 3300005466 | Ga0070685_10001080 | Ga0070685_100010807 | 330 |
| 273 | 3300005535 | Ga0070684_100012351 | Ga0070684_1000123514 | 330 |
| 274 | 3300005535 | Ga0070684_100048700 | Ga0070684_1000487005 | 330 |
| 275 | 3300005578 | Ga0068854_100000082 | Ga0068854_10000008265 | 330 |
| 276 | 3300005718 | Ga0068866_10000004 | Ga0068866_1000000415 | 330 |
| 277 | 3300005841 | Ga0068863_100000261 | Ga0068863_1000002619 | 330 |
| 278 | 3300005937 | Ga0081455_10047858 | Ga0081455_100478582 | 330 |
| 279 | 3300009098 | Ga0105245_10000040 | Ga0105245_1000004045 | 330 |
| 280 | 3300009098 | Ga0105245_10000117 | Ga0105245_1000011716 | 330 |
| 281 | 3300009098 | Ga0105245_10006841 | Ga0105245_100068415 | 330 |
| 282 | 3300009553 | Ga0105249_10000218 | Ga0105249_1000021831 | 330 |
| 283 | 3300013104 | Ga0157370_10004940 | Ga0157370_100049406 | 330 |
| 284 | 3300013296 | Ga0157374_10001719 | Ga0157374_1000171910 | 330 |
| 285 | 3300013297 | Ga0157378_10023605 | Ga0157378_100236052 | 330 |
| 286 | 3300013307 | Ga0157372_10000146 | Ga0157372_1000014618 | 330 |
| 287 | 3300014326 | Ga0157380_10001343 | Ga0157380_100013436 | 330 |
| 288 | 3300014969 | Ga0157376_10010885 | Ga0157376_100108853 | 330 |
| 289 | 3300020081 | Ga0206354_10497300 | Ga0206354_104973002 | 330 |
| 290 | 3300020081 | Ga0206354_11031077 | Ga0206354_110310772 | 330 |
| 291 | 3300020082 | Ga0206353_11807736 | Ga0206353_118077364 | 330 |
| 292 | 3300022467 | Ga0224712_10022571 | Ga0224712_100225711 | 330 |
| 293 | 3300025899 | Ga0207642_10000005 | Ga0207642_10000005192 | 330 |
| 294 | 3300025926 | Ga0207659_10000055 | Ga0207659_1000005529 | 330 |
| 295 | 3300025927 | Ga0207687_10000046 | Ga0207687_1000004616 | 330 |
| 296 | 3300025927 | Ga0207687_10000070 | Ga0207687_1000007078 | 330 |
| 297 | 3300025927 | Ga0207687_10006279 | Ga0207687_100062794 | 330 |
| 298 | 3300025932 | Ga0207690_10002537 | Ga0207690_100025373 | 330 |
| 299 | 3300025936 | Ga0207670_10142256 | Ga0207670_101422562 | 330 |
| 300 | 3300025937 | Ga0207669_10000021 | Ga0207669_1000002135 | 330 |
| 301 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011394 | 330 |
| 302 | 3300025944 | Ga0207661_10002170 | Ga0207661_100021705 | 330 |
| 303 | 3300025961 | Ga0207712_10000027 | Ga0207712_10000027224 | 330 |
| 304 | 3300025981 | Ga0207640_10000054 | Ga0207640_1000005440 | 330 |
| 305 | 3300026023 | Ga0207677_10001111 | Ga0207677_1000111110 | 330 |
| 306 | 3300026088 | Ga0207641_10000062 | Ga0207641_10000062127 | 330 |
| 307 | 3300026118 | Ga0207675_100160315 | Ga0207675_1001603152 | 330 |
| 308 | 3300026142 | Ga0207698_10000015 | Ga0207698_1000001593 | 330 |
| 309 | 3300028556 | Ga0265337_1001256 | Ga0265337_100125613 | 330 |
| 310 | 3300028558 | Ga0265326_10000127 | Ga0265326_100001277 | 330 |
| 311 | 3300028654 | Ga0265322_10000005 | Ga0265322_10000005172 | 330 |
| 312 | 3300028666 | Ga0265336_10026744 | Ga0265336_100267443 | 330 |
| 313 | 3300031239 | Ga0265328_10019084 | Ga0265328_100190844 | 330 |
| 314 | 3300031240 | Ga0265320_10000010 | Ga0265320_10000010218 | 330 |
| 315 | 3300031242 | Ga0265329_10001050 | Ga0265329_1000105011 | 330 |
| 316 | 3300031249 | Ga0265339_10016752 | Ga0265339_100167525 | 330 |
| 317 | 3300031250 | Ga0265331_10000217 | Ga0265331_1000021726 | 330 |
| 318 | 3300031251 | Ga0265327_10000040 | Ga0265327_1000004088 | 330 |
| 319 | 3300031344 | Ga0265316_10035110 | Ga0265316_100351103 | 330 |
| 320 | 3300031711 | Ga0265314_10000491 | Ga0265314_1000049151 | 330 |
| 321 | 3300031712 | Ga0265342_10059103 | Ga0265342_100591032 | 330 |
| 322 | 3300031995 | Ga0307409_100453414 | Ga0307409_1004534141 | 330 |
| 323 | 3300032126 | Ga0307415_100011748 | Ga0307415_1000117483 | 330 |
| 324 | 3300032133 | Ga0316583_10056789 | Ga0316583_100567892 | 330 |
| 325 | 3300037471 | Ga0395905_0029155 | Ga0395905_0029155_1916_2932 | 330 |
| 326 | 3300045976 | Ga0466967_0000002 | Ga0466967_0000002_37858_38865 | 330 |
| 327 | 3300046455 | Ga0495603_0000102 | Ga0495603_0000102_17310_18317 | 330 |
| 328 | 3300046462 | Ga0495651_0171738 | Ga0495651_0171738_148_1158 | 330 |
| 329 | 3300046476 | Ga0495662_0001473 | Ga0495662_0001473_4411_5421 | 330 |
| 330 | 3300046511 | Ga0495608_0000013 | Ga0495608_0000013_85744_86751 | 330 |
| 331 | 3300046514 | Ga0495618_0181771 | Ga0495618_0181771_188_1234 | 330 |
| 332 | 3300046516 | Ga0495628_0000794 | Ga0495628_0000794_15139_16146 | 330 |
| 333 | 3300046517 | Ga0495630_0007095 | Ga0495630_0007095_5978_6985 | 330 |
| 334 | 3300046523 | Ga0495644_0002837 | Ga0495644_0002837_1097_2104 | 330 |
| 335 | 3300046529 | Ga0495652_0000018 | Ga0495652_0000018_80002_81009 | 330 |
| 336 | 3300046537 | Ga0495598_0002543 | Ga0495598_0002543_61_1068 | 330 |
| 337 | 3300046543 | Ga0495645_0006138 | Ga0495645_0006138_6880_7887 | 330 |
| 338 | 3300046559 | Ga0495667_0000038 | Ga0495667_0000038_49402_50409 | 330 |
| 339 | 3300046559 | Ga0495667_0060775 | Ga0495667_0060775_1073_2083 | 330 |
| 340 | 3300046642 | Ga0495634_0001691 | Ga0495634_0001691_6207_7214 | 330 |
| 341 | 3300046675 | Ga0495657_0000003 | Ga0495657_0000003_136943_137950 | 330 |
| 342 | 3300046683 | Ga0495658_0002091 | Ga0495658_0002091_5951_6958 | 330 |
| 343 | 3300046684 | Ga0495669_0000483 | Ga0495669_0000483_11841_12848 | 330 |
| 344 | 3300046689 | Ga0495613_0000027 | Ga0495613_0000027_129001_130008 | 330 |
| 345 | 3300046689 | Ga0495613_0112287 | Ga0495613_0112287_348_1358 | 330 |
| 346 | 3300046809 | Ga0495600_0032852 | Ga0495600_0032852_1327_2334 | 330 |
| 347 | 3300047317 | Ga0495604_0000100 | Ga0495604_0000100_60365_61372 | 330 |
| 348 | 3300047317 | Ga0495604_0000723 | Ga0495604_0000723_14598_15605 | 330 |
| 349 | 3300047317 | Ga0495604_0032236 | Ga0495604_0032236_2074_3081 | 330 |
| 350 | 3300047321 | Ga0495676_0016441 | Ga0495676_0016441_5241_6248 | 330 |
| 351 | 3300047322 | Ga0495680_0001001 | Ga0495680_0001001_23975_24982 | 330 |
| 352 | 3300047444 | Ga0495675_0000002 | Ga0495675_0000002_136943_137950 | 330 |
| 353 | 3300048088 | Ga0495602_0000034 | Ga0495602_0000034_87353_88360 | 330 |
| 354 | 3300048088 | Ga0495602_0006995 | Ga0495602_0006995_5514_6521 | 330 |
| 355 | 3300048910 | Ga0496107_0151562 | Ga0496107_0151562_182_1201 | 330 |
| 356 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_425730_426737 | 330 |
| 357 | 3300048911 | Ga0496108_0014805 | Ga0496108_0014805_2207_3217 | 330 |
| 358 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_108355_109362 | 330 |
| 359 | 3300048912 | Ga0496109_0000378 | Ga0496109_0000378_26957_27967 | 330 |
| 360 | 3300048913 | Ga0496110_0000052 | Ga0496110_0000052_10789_11796 | 330 |
| 361 | 3300048914 | Ga0496111_0000121 | Ga0496111_0000121_5402_6409 | 330 |
| 362 | 3300048915 | Ga0496112_0012664 | Ga0496112_0012664_2823_3830 | 330 |
| 363 | 3300048916 | Ga0496113_0000005 | Ga0496113_0000005_82101_83108 | 330 |
| 364 | 3300048916 | Ga0496113_0063062 | Ga0496113_0063062_442_1461 | 330 |
| 365 | 3300048920 | Ga0496117_0074704 | Ga0496117_0074704_435_1469 | 330 |
| 366 | 3300050508 | nmdc:mga09592_331972_c1 | nmdc:mga09592_331972_c1_146_1165 | 330 |
| 367 | 3300053077 | Ga0495601_0000017 | Ga0495601_0000017_16996_18003 | 330 |
| 368 | 3300053077 | Ga0495601_0038538 | Ga0495601_0038538_1281_2288 | 330 |
| 369 | 3300053077 | Ga0495601_0084681 | Ga0495601_0084681_511_1518 | 330 |
| 370 | 3300053078 | Ga0495612_0084839 | Ga0495612_0084839_63_1070 | 330 |
| 371 | 3300053084 | Ga0495595_0000007 | Ga0495595_0000007_85767_86774 | 330 |
| 372 | 3300053084 | Ga0495595_0036298 | Ga0495595_0036298_1162_2169 | 330 |
| 373 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_447352_448362 | 330 |
| 374 | 3300053085 | Ga0495619_0000026 | Ga0495619_0000026_85790_86797 | 330 |
| 375 | 3300053085 | Ga0495619_0000088 | Ga0495619_0000088_41249_42256 | 330 |
| 376 | 3300053085 | Ga0495619_0000127 | Ga0495619_0000127_9114_10121 | 330 |
| 377 | 3300005340 | Ga0070689_100081610 | Ga0070689_1000816101 | 331 |
| 378 | 3300005356 | Ga0070674_100000002 | Ga0070674_10000000257 | 331 |
| 379 | 3300005439 | Ga0070711_100016216 | Ga0070711_1000162163 | 331 |
| 380 | 3300005439 | Ga0070711_100036952 | Ga0070711_1000369522 | 331 |
| 381 | 3300005457 | Ga0070662_100000001 | Ga0070662_10000000176 | 331 |
| 382 | 3300005458 | Ga0070681_10080275 | Ga0070681_100802753 | 331 |
| 383 | 3300005459 | Ga0068867_100000078 | Ga0068867_10000007845 | 331 |
| 384 | 3300005530 | Ga0070679_100000424 | Ga0070679_10000042421 | 331 |
| 385 | 3300005535 | Ga0070684_100048102 | Ga0070684_1000481022 | 331 |
| 386 | 3300005535 | Ga0070684_100143343 | Ga0070684_1001433432 | 331 |
| 387 | 3300005547 | Ga0070693_100001579 | Ga0070693_1000015795 | 331 |
| 388 | 3300005548 | Ga0070665_100000022 | Ga0070665_1000000229 | 331 |
| 389 | 3300005564 | Ga0070664_100212796 | Ga0070664_1002127963 | 331 |
| 390 | 3300005614 | Ga0068856_100005657 | Ga0068856_1000056576 | 331 |
| 391 | 3300005618 | Ga0068864_100000090 | Ga0068864_10000009069 | 331 |
| 392 | 3300005842 | Ga0068858_100001180 | Ga0068858_1000011809 | 331 |
| 393 | 3300005843 | Ga0068860_100003017 | Ga0068860_10000301716 | 331 |
| 394 | 3300005981 | Ga0081538_10000814 | Ga0081538_1000081419 | 331 |
| 395 | 3300005981 | Ga0081538_10053974 | Ga0081538_100539742 | 331 |
| 396 | 3300006038 | Ga0075365_10006453 | Ga0075365_100064534 | 331 |
| 397 | 3300006051 | Ga0075364_10004153 | Ga0075364_100041536 | 331 |
| 398 | 3300006163 | Ga0070715_10000008 | Ga0070715_1000000831 | 331 |
| 399 | 3300006358 | Ga0068871_100086946 | Ga0068871_1000869464 | 331 |
| 400 | 3300006847 | Ga0075431_100022444 | Ga0075431_1000224443 | 331 |
| 401 | 3300006852 | Ga0075433_10000337 | Ga0075433_1000033710 | 331 |
| 402 | 3300006852 | Ga0075433_10185196 | Ga0075433_101851962 | 331 |
| 403 | 3300006871 | Ga0075434_100012705 | Ga0075434_1000127056 | 331 |
| 404 | 3300006914 | Ga0075436_100151343 | Ga0075436_1001513433 | 331 |
| 405 | 3300009094 | Ga0111539_10352080 | Ga0111539_103520802 | 331 |
| 406 | 3300009098 | Ga0105245_10000629 | Ga0105245_1000062925 | 331 |
| 407 | 3300009148 | Ga0105243_10180684 | Ga0105243_101806842 | 331 |
| 408 | 3300009551 | Ga0105238_10000033 | Ga0105238_10000033120 | 331 |
| 409 | 3300009553 | Ga0105249_10143982 | Ga0105249_101439822 | 331 |
| 410 | 3300009553 | Ga0105249_10563279 | Ga0105249_105632791 | 331 |
| 411 | 3300010375 | Ga0105239_10549574 | Ga0105239_105495742 | 331 |
| 412 | 3300011119 | Ga0105246_10326253 | Ga0105246_103262531 | 331 |
| 413 | 3300013296 | Ga0157374_10203473 | Ga0157374_102034732 | 331 |
| 414 | 3300013297 | Ga0157378_10101111 | Ga0157378_101011112 | 331 |
| 415 | 3300013308 | Ga0157375_10067540 | Ga0157375_100675401 | 331 |
| 416 | 3300014968 | Ga0157379_10063407 | Ga0157379_100634073 | 331 |
| 417 | 3300017792 | Ga0163161_10000027 | Ga0163161_100000271 | 331 |
| 418 | 3300025899 | Ga0207642_10000737 | Ga0207642_100007375 | 331 |
| 419 | 3300025905 | Ga0207685_10000012 | Ga0207685_1000001231 | 331 |
| 420 | 3300025912 | Ga0207707_10023616 | Ga0207707_100236163 | 331 |
| 421 | 3300025915 | Ga0207693_10015147 | Ga0207693_100151474 | 331 |
| 422 | 3300025916 | Ga0207663_10004985 | Ga0207663_100049856 | 331 |
| 423 | 3300025921 | Ga0207652_10000232 | Ga0207652_100002322 | 331 |
| 424 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012121 | 331 |
| 425 | 3300025927 | Ga0207687_10000095 | Ga0207687_1000009554 | 331 |
| 426 | 3300025933 | Ga0207706_10000003 | Ga0207706_10000003253 | 331 |
| 427 | 3300025937 | Ga0207669_10000003 | Ga0207669_10000003237 | 331 |
| 428 | 3300025944 | Ga0207661_10180341 | Ga0207661_101803412 | 331 |
| 429 | 3300025945 | Ga0207679_10128408 | Ga0207679_101284082 | 331 |
| 430 | 3300025961 | Ga0207712_10282739 | Ga0207712_102827392 | 331 |
| 431 | 3300026035 | Ga0207703_10000020 | Ga0207703_1000002063 | 331 |
| 432 | 3300026078 | Ga0207702_10001788 | Ga0207702_1000178821 | 331 |
| 433 | 3300026095 | Ga0207676_10000016 | Ga0207676_10000016283 | 331 |
| 434 | 3300026121 | Ga0207683_10033719 | Ga0207683_100337192 | 331 |
| 435 | 3300028379 | Ga0268266_10000029 | Ga0268266_10000029440 | 331 |
| 436 | 3300028381 | Ga0268264_10001191 | Ga0268264_1000119118 | 331 |
| 437 | 3300036401 | Ga0373937_0009257 | Ga0373937_0009257_1859_2869 | 331 |
| 438 | 3300038443 | Ga0395901_0345576 | Ga0395901_0345576_224_1255 | 331 |
| 439 | 3300044694 | Ga0466963_0000233 | Ga0466963_0000233_16010_17020 | 331 |
| 440 | 3300045976 | Ga0466967_0067231 | Ga0466967_0067231_1581_2588 | 331 |
| 441 | 3300046454 | Ga0495592_0000024 | Ga0495592_0000024_121165_122175 | 331 |
| 442 | 3300046455 | Ga0495603_0001201 | Ga0495603_0001201_12476_13489 | 331 |
| 443 | 3300046455 | Ga0495603_0001271 | Ga0495603_0001271_3809_4819 | 331 |
| 444 | 3300046459 | Ga0495629_0070431 | Ga0495629_0070431_1167_2177 | 331 |
| 445 | 3300046461 | Ga0495641_0000004 | Ga0495641_0000004_72883_73893 | 331 |
| 446 | 3300046463 | Ga0495653_0167298 | Ga0495653_0167298_194_1204 | 331 |
| 447 | 3300046477 | Ga0495664_0035968 | Ga0495664_0035968_805_1821 | 331 |
| 448 | 3300046511 | Ga0495608_0000661 | Ga0495608_0000661_2845_3855 | 331 |
| 449 | 3300046511 | Ga0495608_0020565 | Ga0495608_0020565_1478_2488 | 331 |
| 450 | 3300046511 | Ga0495608_0080915 | Ga0495608_0080915_734_1744 | 331 |
| 451 | 3300046514 | Ga0495618_0000267 | Ga0495618_0000267_15733_16743 | 331 |
| 452 | 3300046515 | Ga0495620_0000041 | Ga0495620_0000041_46762_47772 | 331 |
| 453 | 3300046516 | Ga0495628_0035805 | Ga0495628_0035805_2189_3199 | 331 |
| 454 | 3300046516 | Ga0495628_0089356 | Ga0495628_0089356_464_1480 | 331 |
| 455 | 3300046516 | Ga0495628_0122167 | Ga0495628_0122167_822_1838 | 331 |
| 456 | 3300046517 | Ga0495630_0000026 | Ga0495630_0000026_88202_89212 | 331 |
| 457 | 3300046529 | Ga0495652_0086425 | Ga0495652_0086425_446_1456 | 331 |
| 458 | 3300046535 | Ga0495586_0000254 | Ga0495586_0000254_15267_16277 | 331 |
| 459 | 3300046543 | Ga0495645_0118566 | Ga0495645_0118566_763_1773 | 331 |
| 460 | 3300046642 | Ga0495634_0000002 | Ga0495634_0000002_128808_129821 | 331 |
| 461 | 3300046642 | Ga0495634_0010144 | Ga0495634_0010144_4143_5159 | 331 |
| 462 | 3300046663 | Ga0495635_0000005 | Ga0495635_0000005_31621_32631 | 331 |
| 463 | 3300046674 | Ga0495588_0073193 | Ga0495588_0073193_591_1631 | 331 |
| 464 | 3300046675 | Ga0495657_0021495 | Ga0495657_0021495_1892_2902 | 331 |
| 465 | 3300046678 | Ga0495599_0005867 | Ga0495599_0005867_2962_3972 | 331 |
| 466 | 3300046678 | Ga0495599_0118123 | Ga0495599_0118123_480_1496 | 331 |
| 467 | 3300046681 | Ga0495647_0000005 | Ga0495647_0000005_99783_100796 | 331 |
| 468 | 3300046681 | Ga0495647_0007800 | Ga0495647_0007800_2445_3455 | 331 |
| 469 | 3300046684 | Ga0495669_0084535 | Ga0495669_0084535_125_1141 | 331 |
| 470 | 3300046689 | Ga0495613_0009561 | Ga0495613_0009561_47_1057 | 331 |
| 471 | 3300046690 | Ga0495624_0000123 | Ga0495624_0000123_16110_17120 | 331 |
| 472 | 3300046690 | Ga0495624_0025621 | Ga0495624_0025621_2474_3484 | 331 |
| 473 | 3300046694 | Ga0495649_0004688 | Ga0495649_0004688_2578_3588 | 331 |
| 474 | 3300047322 | Ga0495680_0000007 | Ga0495680_0000007_124074_125084 | 331 |
| 475 | 3300047322 | Ga0495680_0000929 | Ga0495680_0000929_16055_17065 | 331 |
| 476 | 3300047446 | Ga0495679_006392 | Ga0495679_006392_3616_4626 | 331 |
| 477 | 3300047447 | Ga0495685_032826 | Ga0495685_032826_66_1076 | 331 |
| 478 | 3300048903 | Ga0496100_0000024 | Ga0496100_0000024_68767_69777 | 331 |
| 479 | 3300048904 | Ga0496101_0000072 | Ga0496101_0000072_46362_47372 | 331 |
| 480 | 3300048904 | Ga0496101_0024877 | Ga0496101_0024877_2983_4023 | 331 |
| 481 | 3300048905 | Ga0496102_0098336 | Ga0496102_0098336_1537_2571 | 331 |
| 482 | 3300048905 | Ga0496102_0099089 | Ga0496102_0099089_986_2005 | 331 |
| 483 | 3300048906 | Ga0496103_0023194 | Ga0496103_0023194_1888_2928 | 331 |
| 484 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_119404_120414 | 331 |
| 485 | 3300048907 | Ga0496104_0000579 | Ga0496104_0000579_4272_5282 | 331 |
| 486 | 3300048907 | Ga0496104_0034784 | Ga0496104_0034784_1096_2130 | 331 |
| 487 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_119404_120414 | 331 |
| 488 | 3300048908 | Ga0496105_0000051 | Ga0496105_0000051_80428_81438 | 331 |
| 489 | 3300048909 | Ga0496106_0000040 | Ga0496106_0000040_61383_62393 | 331 |
| 490 | 3300048909 | Ga0496106_0000042 | Ga0496106_0000042_51505_52515 | 331 |
| 491 | 3300048909 | Ga0496106_0013759 | Ga0496106_0013759_4468_5502 | 331 |
| 492 | 3300048910 | Ga0496107_0000025 | Ga0496107_0000025_68767_69777 | 331 |
| 493 | 3300048910 | Ga0496107_0021126 | Ga0496107_0021126_1583_2602 | 331 |
| 494 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_475221_476231 | 331 |
| 495 | 3300048911 | Ga0496108_0024629 | Ga0496108_0024629_1552_2586 | 331 |
| 496 | 3300048912 | Ga0496109_0000013 | Ga0496109_0000013_157662_158672 | 331 |
| 497 | 3300048912 | Ga0496109_0067263 | Ga0496109_0067263_1450_2460 | 331 |
| 498 | 3300048912 | Ga0496109_0300487 | Ga0496109_0300487_230_1270 | 331 |
| 499 | 3300048913 | Ga0496110_0321698 | Ga0496110_0321698_208_1215 | 331 |
| 500 | 3300048913 | Ga0496110_0367488 | Ga0496110_0367488_242_1255 | 331 |
| 501 | 3300048913 | Ga0496110_0419505 | Ga0496110_0419505_123_1133 | 331 |
| 502 | 3300048914 | Ga0496111_0026764 | Ga0496111_0026764_274_1284 | 331 |
| 503 | 3300048915 | Ga0496112_0000026 | Ga0496112_0000026_21867_22877 | 331 |
| 504 | 3300048915 | Ga0496112_0081801 | Ga0496112_0081801_104_1144 | 331 |
| 505 | 3300048916 | Ga0496113_0012533 | Ga0496113_0012533_2363_3397 | 331 |
| 506 | 3300048916 | Ga0496113_0024909 | Ga0496113_0024909_186_1196 | 331 |
| 507 | 3300048916 | Ga0496113_0206548 | Ga0496113_0206548_66_1076 | 331 |
| 508 | 3300048917 | Ga0496114_0012219 | Ga0496114_0012219_3306_4316 | 331 |
| 509 | 3300048917 | Ga0496114_0267600 | Ga0496114_0267600_454_1464 | 331 |
| 510 | 3300049578 | Ga0501042_0087641 | Ga0501042_0087641_382_1392 | 331 |
| 511 | 3300050491 | nmdc:mga00v17_3816_c1 | nmdc:mga00v17_3816_c1_4354_5385 | 331 |
| 512 | 3300050492 | nmdc:mga0yw44_76137_c1 | nmdc:mga0yw44_76137_c1_767_1798 | 331 |
| 513 | 3300050507 | nmdc:mga05p37_122843_c1 | nmdc:mga05p37_122843_c1_1829_2866 | 331 |
| 514 | 3300050510 | nmdc:mga06r32_34834_c1 | nmdc:mga06r32_34834_c1_1288_2295 | 331 |
| 515 | 3300050512 | nmdc:mga0n895_150585_c1 | nmdc:mga0n895_150585_c1_1241_2260 | 331 |
| 516 | 3300050514 | nmdc:mga08x19_234741_c1 | nmdc:mga08x19_234741_c1_56_1075 | 331 |
| 517 | 3300050515 | nmdc:mga0a205_219773_c1 | nmdc:mga0a205_219773_c1_424_1446 | 331 |
| 518 | 3300050515 | nmdc:mga0a205_4_c1 | nmdc:mga0a205_4_c1_132397_133404 | 331 |
| 519 | 3300053077 | Ga0495601_0000318 | Ga0495601_0000318_18470_19480 | 331 |
| 520 | 3300053077 | Ga0495601_0024434 | Ga0495601_0024434_2526_3536 | 331 |
| 521 | 3300053077 | Ga0495601_0028110 | Ga0495601_0028110_502_1512 | 331 |
| 522 | 3300053077 | Ga0495601_0048712 | Ga0495601_0048712_1368_2378 | 331 |
| 523 | 3300053078 | Ga0495612_0000155 | Ga0495612_0000155_6179_7195 | 331 |
| 524 | 3300053078 | Ga0495612_0020692 | Ga0495612_0020692_575_1585 | 331 |
| 525 | 3300053084 | Ga0495595_0000378 | Ga0495595_0000378_303_1313 | 331 |
| 526 | 3300053084 | Ga0495595_0058305 | Ga0495595_0058305_383_1393 | 331 |
| 527 | 3300053085 | Ga0495619_0000346 | Ga0495619_0000346_4362_5372 | 331 |
| 528 | 3300053085 | Ga0495619_0006101 | Ga0495619_0006101_3236_4246 | 331 |
| 529 | 3300053085 | Ga0495619_0039095 | Ga0495619_0039095_1835_2845 | 331 |
| 530 | 3300053085 | Ga0495619_0127908 | Ga0495619_0127908_553_1563 | 331 |
| 531 | 3300053123 | Ga0500614_001618 | Ga0500614_001618_1819_2829 | 331 |
| 532 | 3300005842 | Ga0068858_100000046 | Ga0068858_10000004680 | 332 |
| 533 | 3300005985 | Ga0081539_10000776 | Ga0081539_1000077634 | 332 |
| 534 | 3300026035 | Ga0207703_10000042 | Ga0207703_1000004245 | 332 |
| 535 | 3300037418 | Ga0395900_0146668 | Ga0395900_0146668_885_1895 | 332 |
| 536 | 3300046660 | Ga0495625_0000243 | Ga0495625_0000243_82069_83082 | 332 |
| 537 | 3300049741 | Ga0501079_0080196 | Ga0501079_0080196_300_1322 | 332 |
| 538 | 3300060353 | Ga0501082_0187661 | Ga0501082_0187661_458_1483 | 332 |
| 539 | 3300005937 | Ga0081455_10009497 | Ga0081455_100094975 | 333 |
| 540 | 3300005937 | Ga0081455_10113472 | Ga0081455_101134722 | 333 |
| 541 | 3300006844 | Ga0075428_100024481 | Ga0075428_1000244816 | 333 |
| 542 | 3300006846 | Ga0075430_100019608 | Ga0075430_1000196083 | 333 |
| 543 | 3300046463 | Ga0495653_0077145 | Ga0495653_0077145_389_1414 | 333 |
| 544 | 3300046516 | Ga0495628_0243944 | Ga0495628_0243944_116_1138 | 333 |
| 545 | 3300050509 | nmdc:mga0qj67_84895_c1 | nmdc:mga0qj67_84895_c1_341_1357 | 333 |
| 546 | 3300046511 | Ga0495608_0018918 | Ga0495608_0018918_1682_2710 | 335 |
| 547 | 3300000549 | LJQas_1006601 | LJQas_10066012 | 341 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ccr-assembly2.cif.gz_D | crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor | 0.907 | 9 | 316 |
| 3zdn-assembly2.cif.gz_D | d11-c mutant of monoamine oxidase from aspergillus niger | 0.899 | 9 | 40 |
| 4ccr-assembly2.cif.gz_D | crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor | 0.8978 | 9 | 316 |
| 5mh4-assembly1.cif.gz_A | crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) | 0.8907 | 11 | 316 |
| 4up3-assembly1.cif.gz_B | crystal structure of the mutant c140s,c286q thioredoxin reductase from entamoeba histolytica | 0.886 | 9 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5uthA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9879 | 123 | 247 | 3.50.50.60 |
| 3f8rD02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9808 | 123 | 247 | 3.50.50.60 |
| 5uthA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.98 | 123 | 247 | 3.50.50.60 |
| 4zn0C02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9748 | 123 | 247 | 3.50.50.60 |
| 3f8rD02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9725 | 123 | 247 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0YJU2-F1-model_v4 | deleted | 0.9932 | 141 | 207 |
|
| AF-A0A6B3EPH4-F1-model_v4 | FAD-dependent oxidoreductase | 0.9846 | 119 | 233 |
GO:0016668
|
| AF-A0A6N6X486-F1-model_v4 | deleted | 0.9573 | 119 | 243 |
|
| AF-A0A3D5UWY6-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9565 | 148 | 238 |
GO:0016491
|
| AF-A0A2H9SVM5-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9492 | 8 | 314 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar