F462149

General Info

Members Datasets Scaffolds Average Seq Length
547 294 546 335

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0018918|Ga0495608_0018918_1682_2710
Length 342
Sequence MSELGLGQDKVENVIVVGGGPAGYTAALYTARANLEPLVFEGFQWGGQLQNTTDVENYPGYPEGIMGPEMMNQFRAQAERFGTRFVSDDVDRVELSTDGGVHRVFLGDEEHVAKTVILAMGAEPRRLGIPGEMELSGCGVSTCGVCDGAFFKGKKVIVIGGGDSAMEDAIFVSKFASELTIVNRRDEFRASKIMRERAAERPNIEFKTPFVPEEFVAAEGEPKLDHVRLRNAETGETEDFGTEGAFVAIGHIPRSEIVAGQVDTDEDGYIRTEPGSTKTNLPGVFAVGDVVDHTYRQAVTAAGTGCMGALDAEWYLRDTPPMPEAHWLPGGEPTEIAPTPGS

Samples

Sample ID Description Type Environment
1 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
290 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
291 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.91
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.66
Nodule 0
Rhizoplane 12.25
Rhizosphere 81.72
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006601 3300000549 Bacteria 1442
2 JGI24746J21847_1002058 3300001977 Bacteria 3209
3 JGI24748J21848_1000356 3300002074 Bacteria 5272
4 JGI24034J26672_10000216 3300002239 Bacteria 7622
5 Ga0070683_100023947 3300005329 Bacteria 5465
6 Ga0070666_10009188 3300005335 Bacteria 6162
7 Ga0070682_100000023 3300005337 Bacteria 206016
8 Ga0070682_100000026 3300005337 Bacteria 191388
9 Ga0068868_100000694 3300005338 Bacteria 22626
10 Ga0068868_100072591 3300005338 Bacteria 2746
11 Ga0070689_100081610 3300005340 Bacteria 2539
12 Ga0070689_100210380 3300005340 Bacteria 1591
13 Ga0070691_10000004 3300005341 Bacteria 80156
14 Ga0070691_10000970 3300005341 Bacteria 11707
15 Ga0070687_100012467 3300005343 Bacteria 3756
16 Ga0070661_100000004 3300005344 Bacteria 243876
17 Ga0070668_100010212 3300005347 Bacteria 6964
18 Ga0070668_100019643 3300005347 Bacteria 5087
19 Ga0070675_100000050 3300005354 Bacteria 72016
20 Ga0070674_100000002 3300005356 Bacteria 271088
21 Ga0070674_100000141 3300005356 Bacteria 33366
22 Ga0070673_100100925 3300005364 Bacteria 2377
23 Ga0070688_100000686 3300005365 Bacteria 16820
24 Ga0070688_100076412 3300005365 Bacteria 2155
25 Ga0070659_100000852 3300005366 Bacteria 22251
26 Ga0070659_100003678 3300005366 Bacteria 10933
27 Ga0070667_100003085 3300005367 Bacteria 14325
28 Ga0070667_100068631 3300005367 Bacteria 3017
29 Ga0070714_100004088 3300005435 Bacteria 10971
30 Ga0070714_100356459 3300005435 Bacteria 1374
31 Ga0070713_100000503 3300005436 Bacteria 24991
32 Ga0070713_100119207 3300005436 Bacteria 2312
33 Ga0070711_100016216 3300005439 Bacteria 4729
34 Ga0070711_100036952 3300005439 Bacteria 3275
35 Ga0070663_100021932 3300005455 Bacteria 4259
36 Ga0070678_100226970 3300005456 Bacteria 1555
37 Ga0070662_100000001 3300005457 Bacteria 317995
38 Ga0070681_10080275 3300005458 Bacteria 3218
39 Ga0068867_100000078 3300005459 Bacteria 59729
40 Ga0068867_100007697 3300005459 Bacteria 7621
41 Ga0070685_10000010 3300005466 Bacteria 146946
42 Ga0070685_10001080 3300005466 Bacteria 14623
43 Ga0070679_100000424 3300005530 Bacteria 35927
44 Ga0070679_100000471 3300005530 Bacteria 34374
45 Ga0070684_100012351 3300005535 Bacteria 6842
46 Ga0070684_100048102 3300005535 Bacteria 3699
47 Ga0070684_100048700 3300005535 Bacteria 3676
48 Ga0070684_100143343 3300005535 Bacteria 2162
49 Ga0070672_100000031 3300005543 Bacteria 62241
50 Ga0070693_100001579 3300005547 Bacteria 10264
51 Ga0070665_100000022 3300005548 Bacteria 379286
52 Ga0070665_100002868 3300005548 Bacteria 18629
53 Ga0070665_100652886 3300005548 Bacteria 1065
54 Ga0070664_100193884 3300005564 Bacteria 1811
55 Ga0070664_100212796 3300005564 Bacteria 1728
56 Ga0068854_100000082 3300005578 Bacteria 68340
57 Ga0068854_100021369 3300005578 Bacteria 4392
58 Ga0068856_100000136 3300005614 Bacteria 74026
59 Ga0068856_100005657 3300005614 Bacteria 12302
60 Ga0068852_100064550 3300005616 Bacteria 3192
61 Ga0068864_100000090 3300005618 Bacteria 96213
62 Ga0068866_10000004 3300005718 Bacteria 202810
63 Ga0068866_10004817 3300005718 Bacteria 5540
64 Ga0068851_10002105 3300005834 Bacteria 8758
65 Ga0068851_10083118 3300005834 Bacteria 1675
66 Ga0068863_100000261 3300005841 Bacteria 55053
67 Ga0068863_100008832 3300005841 Bacteria 9842
68 Ga0068863_100268176 3300005841 Bacteria 1652
69 Ga0068858_100000046 3300005842 Bacteria 127519
70 Ga0068858_100001180 3300005842 Bacteria 27065
71 Ga0068860_100003017 3300005843 Bacteria 17389
72 Ga0068862_100001309 3300005844 Bacteria 23179
73 Ga0068862_100202398 3300005844 Bacteria 1791
74 Ga0081455_10009497 3300005937 Bacteria 9997
75 Ga0081455_10010690 3300005937 Bacteria 9284
76 Ga0081455_10016053 3300005937 Bacteria 7244
77 Ga0081455_10047858 3300005937 Bacteria 3699
78 Ga0081455_10113472 3300005937 Bacteria 2149
79 Ga0081538_10000814 3300005981 Bacteria 33848
80 Ga0081538_10053974 3300005981 Bacteria 2382
81 Ga0081540_1000174 3300005983 Bacteria 67477
82 Ga0081540_1000557 3300005983 Bacteria 36162
83 Ga0081539_10000776 3300005985 Bacteria 62705
84 Ga0075365_10001651 3300006038 Bacteria 10306
85 Ga0075365_10006453 3300006038 Bacteria 6455
86 Ga0075365_10008059 3300006038 Bacteria 5949
87 Ga0075365_10012400 3300006038 Bacteria 5062
88 Ga0075365_10043160 3300006038 Bacteria 2951
89 Ga0075363_100009258 3300006048 Bacteria 4626
90 Ga0075364_10004153 3300006051 Bacteria 8301
91 Ga0075364_10068807 3300006051 Bacteria 2329
92 Ga0070715_10000008 3300006163 Bacteria 189899
93 Ga0075367_10125368 3300006178 Bacteria 1584
94 Ga0068871_100086946 3300006358 Bacteria 2598
95 Ga0075428_100024481 3300006844 Bacteria 6681
96 Ga0075428_100243017 3300006844 Bacteria 1942
97 Ga0075430_100019608 3300006846 Bacteria 5753
98 Ga0075430_100026320 3300006846 Bacteria 4950
99 Ga0075431_100003746 3300006847 Bacteria 14770
100 Ga0075431_100022444 3300006847 Bacteria 6452
101 Ga0075433_10000337 3300006852 Bacteria 29062
102 Ga0075433_10185196 3300006852 Bacteria 1852
103 Ga0075434_100001338 3300006871 Bacteria 20649
104 Ga0075434_100012705 3300006871 Bacteria 7987
105 Ga0068865_100054085 3300006881 Bacteria 2788
106 Ga0068865_100078856 3300006881 Bacteria 2357
107 Ga0075436_100151343 3300006914 Bacteria 1633
108 Ga0111539_10352080 3300009094 Bacteria 1714
109 Ga0105245_10000040 3300009098 Bacteria 144005
110 Ga0105245_10000117 3300009098 Bacteria 76863
111 Ga0105245_10000629 3300009098 Bacteria 32084
112 Ga0105245_10006841 3300009098 Bacteria 10002
113 Ga0105245_10009368 3300009098 Bacteria 8539
114 Ga0105247_10000131 3300009101 Bacteria 72578
115 Ga0114129_10030345 3300009147 Bacteria 7650
116 Ga0114129_10125475 3300009147 Bacteria 3530
117 Ga0114129_10284908 3300009147 Bacteria 2206
118 Ga0105243_10010381 3300009148 Bacteria 7071
119 Ga0105243_10010662 3300009148 Bacteria 6970
120 Ga0105243_10180684 3300009148 Bacteria 1834
121 Ga0105242_10000063 3300009176 Bacteria 74721
122 Ga0105242_10000428 3300009176 Bacteria 33565
123 Ga0105248_10192317 3300009177 Bacteria 2299
124 Ga0105237_10030852 3300009545 Bacteria 5439
125 Ga0105237_10237342 3300009545 Bacteria 1824
126 Ga0105238_10000033 3300009551 Bacteria 172981
127 Ga0105249_10000218 3300009553 Bacteria 65480
128 Ga0105249_10004038 3300009553 Bacteria 12662
129 Ga0105249_10143982 3300009553 Bacteria 2288
130 Ga0105249_10563279 3300009553 Bacteria 1191
131 Ga0105239_10030284 3300010375 Bacteria 5949
132 Ga0105239_10210502 3300010375 Bacteria 2179
133 Ga0105239_10549574 3300010375 Bacteria 1315
134 Ga0105246_10326253 3300011119 Bacteria 1249
135 Ga0157370_10004940 3300013104 Bacteria 15093
136 Ga0157374_10001719 3300013296 Bacteria 18377
137 Ga0157374_10203473 3300013296 Bacteria 1939
138 Ga0157378_10018349 3300013297 Bacteria 6144
139 Ga0157378_10023605 3300013297 Bacteria 5409
140 Ga0157378_10101111 3300013297 Bacteria 2633
141 Ga0157372_10000146 3300013307 Bacteria 77952
142 Ga0157375_10000492 3300013308 Bacteria 35821
143 Ga0157375_10030090 3300013308 Bacteria 5115
144 Ga0157375_10067540 3300013308 Bacteria 3573
145 Ga0157380_10000007 3300014326 Bacteria 157634
146 Ga0157380_10001343 3300014326 Bacteria 16023
147 Ga0157379_10049463 3300014968 Bacteria 3754
148 Ga0157379_10063407 3300014968 Bacteria 3304
149 Ga0157379_10246886 3300014968 Bacteria 1620
150 Ga0157376_10010885 3300014969 Bacteria 6680
151 Ga0163161_10000027 3300017792 Bacteria 197774
152 Ga0206350_10333991 3300020080 Bacteria 1967
153 Ga0206354_10497300 3300020081 Bacteria 2909
154 Ga0206354_11031077 3300020081 Bacteria 2079
155 Ga0206353_11807736 3300020082 Bacteria 4842
156 Ga0224712_10022571 3300022467 Bacteria 2171
157 Ga0207656_10002076 3300025321 Bacteria 6694
158 Ga0207642_10000005 3300025899 Bacteria 401934
159 Ga0207642_10000737 3300025899 Bacteria 10119
160 Ga0207642_10003444 3300025899 Bacteria 4997
161 Ga0207710_10000268 3300025900 Bacteria 42956
162 Ga0207680_10004865 3300025903 Bacteria 6390
163 Ga0207685_10000012 3300025905 Bacteria 189900
164 Ga0207707_10023616 3300025912 Bacteria 5378
165 Ga0207695_10251788 3300025913 Bacteria 1665
166 Ga0207671_10084315 3300025914 Bacteria 2386
167 Ga0207693_10014431 3300025915 Bacteria 6352
168 Ga0207693_10015147 3300025915 Bacteria 6188
169 Ga0207663_10004985 3300025916 Bacteria 6655
170 Ga0207662_10034095 3300025918 Bacteria 2971
171 Ga0207657_10007235 3300025919 Bacteria 11401
172 Ga0207649_10000003 3300025920 Bacteria 388908
173 Ga0207652_10000232 3300025921 Bacteria 58473
174 Ga0207652_10000412 3300025921 Bacteria 44366
175 Ga0207694_10000012 3300025924 Bacteria 411218
176 Ga0207659_10000055 3300025926 Bacteria 74252
177 Ga0207687_10000046 3300025927 Bacteria 99576
178 Ga0207687_10000070 3300025927 Bacteria 77432
179 Ga0207687_10000095 3300025927 Bacteria 64664
180 Ga0207687_10006279 3300025927 Bacteria 7862
181 Ga0207687_10101546 3300025927 Bacteria 2117
182 Ga0207700_10000003 3300025928 Bacteria 500797
183 Ga0207664_10000006 3300025929 Bacteria 408702
184 Ga0207644_10152774 3300025931 Bacteria 1788
185 Ga0207690_10002537 3300025932 Bacteria 11031
186 Ga0207690_10112859 3300025932 Bacteria 1960
187 Ga0207706_10000003 3300025933 Bacteria 345011
188 Ga0207686_10000124 3300025934 Bacteria 62335
189 Ga0207686_10000395 3300025934 Bacteria 30349
190 Ga0207670_10142256 3300025936 Bacteria 1770
191 Ga0207669_10000003 3300025937 Bacteria 252239
192 Ga0207669_10000021 3300025937 Bacteria 100327
193 Ga0207704_10000104 3300025938 Bacteria 46614
194 Ga0207704_10026478 3300025938 Bacteria 3183
195 Ga0207691_10000178 3300025940 Bacteria 60110
196 Ga0207691_10003769 3300025940 Bacteria 14721
197 Ga0207711_10000011 3300025941 Bacteria 518817
198 Ga0207711_10073917 3300025941 Bacteria 2964
199 Ga0207661_10002170 3300025944 Bacteria 13522
200 Ga0207661_10003560 3300025944 Bacteria 10827
201 Ga0207661_10005006 3300025944 Bacteria 9292
202 Ga0207661_10180341 3300025944 Bacteria 1844
203 Ga0207679_10128408 3300025945 Bacteria 2030
204 Ga0207667_10470726 3300025949 Bacteria 1276
205 Ga0207651_10032078 3300025960 Bacteria 3369
206 Ga0207712_10000027 3300025961 Bacteria 263739
207 Ga0207712_10019638 3300025961 Bacteria 4417
208 Ga0207712_10282739 3300025961 Bacteria 1354
209 Ga0207668_10006557 3300025972 Bacteria 6879
210 Ga0207640_10000054 3300025981 Bacteria 95136
211 Ga0207658_10015937 3300025986 Bacteria 5161
212 Ga0207677_10001111 3300026023 Bacteria 14662
213 Ga0207703_10000020 3300026035 Bacteria 251603
214 Ga0207703_10000042 3300026035 Bacteria 161459
215 Ga0207678_10001975 3300026067 Bacteria 18688
216 Ga0207678_10002172 3300026067 Bacteria 17730
217 Ga0207708_10225037 3300026075 Bacteria 1504
218 Ga0207702_10000105 3300026078 Bacteria 97835
219 Ga0207702_10001788 3300026078 Bacteria 21174
220 Ga0207641_10000062 3300026088 Bacteria 159982
221 Ga0207641_10006453 3300026088 Bacteria 9884
222 Ga0207648_10013215 3300026089 Bacteria 7692
223 Ga0207676_10000016 3300026095 Bacteria 311561
224 Ga0207674_10050746 3300026116 Bacteria 4237
225 Ga0207674_10414054 3300026116 Bacteria 1302
226 Ga0207675_100160315 3300026118 Bacteria 2145
227 Ga0207683_10033719 3300026121 Bacteria 4449
228 Ga0207698_10000015 3300026142 Bacteria 207368
229 Ga0207428_10013276 3300027907 Bacteria 7201
230 Ga0268266_10000029 3300028379 Bacteria 424015
231 Ga0268266_10000526 3300028379 Bacteria 53404
232 Ga0268266_10000990 3300028379 Bacteria 35791
233 Ga0268266_10081443 3300028379 Bacteria 2823
234 Ga0268265_10008679 3300028380 Bacteria 6869
235 Ga0268264_10001191 3300028381 Bacteria 25160
236 Ga0268264_10024255 3300028381 Bacteria 4952
237 Ga0265337_1001256 3300028556 Bacteria 12773
238 Ga0265326_10000127 3300028558 Bacteria 39017
239 Ga0265319_1000010 3300028563 Bacteria 188773
240 Ga0265322_10000005 3300028654 Bacteria 246112
241 Ga0265336_10026744 3300028666 Bacteria 1811
242 Ga0265338_10000287 3300028800 Bacteria 90818
243 Ga0265328_10019084 3300031239 Bacteria 2637
244 Ga0265320_10000010 3300031240 Bacteria 250501
245 Ga0265325_10051053 3300031241 Bacteria 2127
246 Ga0265329_10001050 3300031242 Bacteria 13701
247 Ga0265339_10016752 3300031249 Bacteria 4361
248 Ga0265331_10000217 3300031250 Bacteria 69142
249 Ga0265327_10000040 3300031251 Bacteria 291052
250 Ga0265316_10035110 3300031344 Bacteria 4067
251 Ga0265314_10000491 3300031711 Bacteria 51373
252 Ga0265342_10059103 3300031712 Bacteria 2265
253 Ga0316576_10000603 3300031727 Bacteria 17236
254 Ga0307406_10112797 3300031901 Bacteria 1875
255 Ga0307409_100453414 3300031995 Bacteria 1238
256 Ga0307415_100011748 3300032126 Bacteria 5028
257 Ga0316583_10056789 3300032133 Bacteria 1375
258 Ga0316574_0024095 3300035398 Bacteria 3639
259 Ga0316574_0082417 3300035398 Bacteria 2044
260 Ga0316574_0118784 3300035398 Bacteria 1697
261 Ga0373937_0009257 3300036401 Bacteria 8551
262 Ga0395900_0008759 3300037418 Bacteria 10394
263 Ga0395900_0146668 3300037418 Bacteria 2413
264 Ga0395898_0032878 3300037466 Bacteria 5178
265 Ga0395898_0168643 3300037466 Bacteria 2093
266 Ga0395905_0029155 3300037471 Bacteria 5201
267 Ga0395901_0144181 3300038443 Bacteria 2503
268 Ga0395901_0345576 3300038443 Bacteria 1536
269 Ga0451853_1416621 3300041512 Bacteria 3684
270 Ga0466963_0000233 3300044694 Bacteria 24036
271 Ga0466970_0019251 3300044765 Bacteria 3538
272 Ga0466967_0000002 3300045976 Bacteria 219994
273 Ga0466967_0067231 3300045976 Bacteria 3196
274 Ga0495592_0000024 3300046454 Bacteria 136661
275 Ga0495603_0000102 3300046455 Bacteria 40074
276 Ga0495603_0001201 3300046455 Bacteria 15127
277 Ga0495603_0001271 3300046455 Bacteria 14685
278 Ga0495629_0000828 3300046459 Bacteria 25082
279 Ga0495629_0010841 3300046459 Bacteria 6627
280 Ga0495629_0070431 3300046459 Bacteria 2440
281 Ga0495641_0000004 3300046461 Bacteria 210501
282 Ga0495641_0016090 3300046461 Bacteria 3953
283 Ga0495651_0171738 3300046462 Bacteria 1543
284 Ga0495653_0077145 3300046463 Bacteria 2475
285 Ga0495653_0111487 3300046463 Bacteria 1965
286 Ga0495653_0167298 3300046463 Bacteria 1521
287 Ga0495582_0000003 3300046473 Bacteria 168880
288 Ga0495662_0001473 3300046476 Bacteria 11649
289 Ga0495662_0002109 3300046476 Bacteria 9973
290 Ga0495664_0035968 3300046477 Bacteria 2918
291 Ga0495594_0000009 3300046499 Bacteria 122139
292 Ga0495606_0000017 3300046507 Bacteria 284549
293 Ga0495608_0000013 3300046511 Bacteria 228481
294 Ga0495608_0000661 3300046511 Bacteria 23772
295 Ga0495608_0018918 3300046511 Bacteria 4747
296 Ga0495608_0020565 3300046511 Bacteria 4537
297 Ga0495608_0080915 3300046511 Bacteria 2111
298 Ga0495618_0000267 3300046514 Bacteria 37924
299 Ga0495618_0181771 3300046514 Bacteria 1336
300 Ga0495620_0000041 3300046515 Bacteria 112605
301 Ga0495628_0000794 3300046516 Bacteria 29108
302 Ga0495628_0035805 3300046516 Bacteria 3988
303 Ga0495628_0089356 3300046516 Bacteria 2386
304 Ga0495628_0122167 3300046516 Bacteria 1997
305 Ga0495628_0243944 3300046516 Bacteria 1343
306 Ga0495630_0000026 3300046517 Bacteria 147084
307 Ga0495630_0000032 3300046517 Bacteria 134425
308 Ga0495630_0007095 3300046517 Bacteria 7981
309 Ga0495644_0002837 3300046523 Bacteria 6867
310 Ga0495652_0000018 3300046529 Bacteria 201634
311 Ga0495652_0086425 3300046529 Bacteria 2575
312 Ga0495586_0000254 3300046535 Bacteria 35015
313 Ga0495587_0000272 3300046536 Bacteria 36939
314 Ga0495598_0002543 3300046537 Bacteria 3771
315 Ga0495645_0006138 3300046543 Bacteria 8316
316 Ga0495645_0118566 3300046543 Bacteria 1865
317 Ga0495622_0000097 3300046557 Bacteria 76953
318 Ga0495667_0000038 3300046559 Bacteria 131349
319 Ga0495667_0060775 3300046559 Bacteria 2478
320 Ga0495634_0000002 3300046642 Bacteria 247842
321 Ga0495634_0001691 3300046642 Bacteria 19214
322 Ga0495634_0010144 3300046642 Bacteria 6911
323 Ga0495625_0000243 3300046660 Bacteria 85589
324 Ga0495635_0000005 3300046663 Bacteria 302178
325 Ga0495588_0000073 3300046674 Bacteria 219005
326 Ga0495588_0073193 3300046674 Bacteria 1784
327 Ga0495657_0000003 3300046675 Bacteria 279680
328 Ga0495657_0021495 3300046675 Bacteria 4629
329 Ga0495599_0005867 3300046678 Bacteria 7377
330 Ga0495599_0118123 3300046678 Bacteria 1649
331 Ga0495647_0000005 3300046681 Bacteria 125996
332 Ga0495647_0007800 3300046681 Bacteria 3594
333 Ga0495658_0000001 3300046683 Bacteria 385362
334 Ga0495658_0002091 3300046683 Bacteria 10135
335 Ga0495669_0000483 3300046684 Bacteria 18439
336 Ga0495669_0084535 3300046684 Bacteria 1459
337 Ga0495613_0000027 3300046689 Bacteria 146674
338 Ga0495613_0009561 3300046689 Bacteria 7202
339 Ga0495613_0112287 3300046689 Bacteria 1963
340 Ga0495624_0000123 3300046690 Bacteria 54291
341 Ga0495624_0000691 3300046690 Bacteria 26457
342 Ga0495624_0025621 3300046690 Bacteria 3871
343 Ga0495649_0004688 3300046694 Bacteria 8878
344 Ga0495600_0032852 3300046809 Bacteria 3367
345 Ga0495604_0000100 3300047317 Bacteria 72995
346 Ga0495604_0000723 3300047317 Bacteria 27948
347 Ga0495604_0032236 3300047317 Bacteria 4155
348 Ga0495674_0000039 3300047319 Bacteria 97645
349 Ga0495676_0007903 3300047321 Bacteria 9752
350 Ga0495676_0016441 3300047321 Bacteria 6568
351 Ga0495676_0028720 3300047321 Bacteria 4746
352 Ga0495680_0000007 3300047322 Bacteria 152053
353 Ga0495680_0000929 3300047322 Bacteria 32526
354 Ga0495680_0001001 3300047322 Bacteria 31451
355 Ga0495675_0000002 3300047444 Bacteria 216469
356 Ga0495675_0046104 3300047444 Bacteria 2776
357 Ga0495679_006392 3300047446 Bacteria 5081
358 Ga0495685_032826 3300047447 Bacteria 1784
359 Ga0495593_0068616 3300047673 Bacteria 1845
360 Ga0495602_0000034 3300048088 Bacteria 140722
361 Ga0495602_0006995 3300048088 Bacteria 11843
362 Ga0496100_0000001 3300048903 Bacteria 530179
363 Ga0496100_0000024 3300048903 Bacteria 116138
364 Ga0496100_0002659 3300048903 Bacteria 9113
365 Ga0496101_0000028 3300048904 Bacteria 198664
366 Ga0496101_0000072 3300048904 Bacteria 116138
367 Ga0496101_0001403 3300048904 Bacteria 14427
368 Ga0496101_0024877 3300048904 Bacteria 4150
369 Ga0496102_0000749 3300048905 Bacteria 31723
370 Ga0496102_0090421 3300048905 Bacteria 2833
371 Ga0496102_0098336 3300048905 Bacteria 2715
372 Ga0496102_0099089 3300048905 Bacteria 2705
373 Ga0496103_0000481 3300048906 Bacteria 33518
374 Ga0496103_0023194 3300048906 Bacteria 3741
375 Ga0496103_0152873 3300048906 Bacteria 1479
376 Ga0496104_0000008 3300048907 Bacteria 516976
377 Ga0496104_0000010 3300048907 Bacteria 475255
378 Ga0496104_0000579 3300048907 Bacteria 31244
379 Ga0496104_0034784 3300048907 Bacteria 4699
380 Ga0496105_0000003 3300048908 Bacteria 713251
381 Ga0496105_0000005 3300048908 Bacteria 475797
382 Ga0496105_0000051 3300048908 Bacteria 90365
383 Ga0496106_0000040 3300048909 Bacteria 108754
384 Ga0496106_0000042 3300048909 Bacteria 106662
385 Ga0496106_0000218 3300048909 Bacteria 40075
386 Ga0496106_0013759 3300048909 Bacteria 5977
387 Ga0496107_0000002 3300048910 Bacteria 320871
388 Ga0496107_0000025 3300048910 Bacteria 116138
389 Ga0496107_0021126 3300048910 Bacteria 4601
390 Ga0496107_0151562 3300048910 Bacteria 1715
391 Ga0496108_0000004 3300048911 Bacteria 545055
392 Ga0496108_0000005 3300048911 Bacteria 535059
393 Ga0496108_0014805 3300048911 Bacteria 6364
394 Ga0496108_0024629 3300048911 Bacteria 4956
395 Ga0496108_0030741 3300048911 Bacteria 4450
396 Ga0496108_0149035 3300048911 Bacteria 2018
397 Ga0496109_0000002 3300048912 Bacteria 443393
398 Ga0496109_0000013 3300048912 Bacteria 227469
399 Ga0496109_0000221 3300048912 Bacteria 56054
400 Ga0496109_0000378 3300048912 Bacteria 40469
401 Ga0496109_0067263 3300048912 Bacteria 3282
402 Ga0496109_0099553 3300048912 Bacteria 2696
403 Ga0496109_0300487 3300048912 Bacteria 1513
404 Ga0496110_0000052 3300048913 Bacteria 58549
405 Ga0496110_0032719 3300048913 Bacteria 4494
406 Ga0496110_0118739 3300048913 Bacteria 2381
407 Ga0496110_0321698 3300048913 Bacteria 1409
408 Ga0496110_0367488 3300048913 Bacteria 1311
409 Ga0496110_0419505 3300048913 Bacteria 1220
410 Ga0496111_0000121 3300048914 Bacteria 33902
411 Ga0496111_0026764 3300048914 Bacteria 4074
412 Ga0496112_0000026 3300048915 Bacteria 144758
413 Ga0496112_0000173 3300048915 Bacteria 41090
414 Ga0496112_0012664 3300048915 Bacteria 7755
415 Ga0496112_0081801 3300048915 Bacteria 3194
416 Ga0496113_0000005 3300048916 Bacteria 105956
417 Ga0496113_0012533 3300048916 Bacteria 5703
418 Ga0496113_0019903 3300048916 Bacteria 4706
419 Ga0496113_0024909 3300048916 Bacteria 4260
420 Ga0496113_0063062 3300048916 Bacteria 2801
421 Ga0496113_0206548 3300048916 Bacteria 1562
422 Ga0496114_0000003 3300048917 Bacteria 630981
423 Ga0496114_0012219 3300048917 Bacteria 6871
424 Ga0496114_0190191 3300048917 Bacteria 1796
425 Ga0496114_0267600 3300048917 Bacteria 1506
426 Ga0496115_0000016 3300048918 Bacteria 187067
427 Ga0496115_0051024 3300048918 Bacteria 3317
428 Ga0496116_0001008 3300048919 Bacteria 34374
429 Ga0496117_0006601 3300048920 Bacteria 11660
430 Ga0496117_0074704 3300048920 Bacteria 2255
431 Ga0496119_0004936 3300048922 Bacteria 13043
432 Ga0496119_0015223 3300048922 Bacteria 5946
433 Ga0496119_0015990 3300048922 Bacteria 5736
434 Ga0496120_0009403 3300048923 Bacteria 6944
435 Ga0496121_0021469 3300048924 Bacteria 6321
436 Ga0496121_0022580 3300048924 Bacteria 6097
437 Ga0496121_0167567 3300048924 Bacteria 1599
438 Ga0496124_0026458 3300048927 Bacteria 5230
439 Ga0496124_0237578 3300048927 Bacteria 1357
440 Ga0495682_0089528 3300049460 Bacteria 1106
441 Ga0501031_0006509 3300049568 Bacteria 7613
442 Ga0501032_0007300 3300049569 Bacteria 8084
443 Ga0501033_0001901 3300049570 Bacteria 18171
444 Ga0501034_0007803 3300049571 Bacteria 11386
445 Ga0501034_0030315 3300049571 Bacteria 5498
446 Ga0501036_0001783 3300049572 Bacteria 16706
447 Ga0501037_0001034 3300049573 Bacteria 20571
448 Ga0501038_0002131 3300049574 Bacteria 18372
449 Ga0501039_0023575 3300049575 Bacteria 4723
450 Ga0501039_0045783 3300049575 Bacteria 3380
451 Ga0501040_0075248 3300049576 Bacteria 2333
452 Ga0501042_0077366 3300049578 Bacteria 2382
453 Ga0501042_0087641 3300049578 Bacteria 2233
454 Ga0501043_0009548 3300049579 Bacteria 7604
455 Ga0501046_0011259 3300049580 Bacteria 7656
456 Ga0501047_0013797 3300049581 Bacteria 7674
457 Ga0501047_0015422 3300049581 Bacteria 7279
458 Ga0501047_0075389 3300049581 Bacteria 3246
459 Ga0501047_0200521 3300049581 Bacteria 1856
460 Ga0501048_0008391 3300049582 Bacteria 7811
461 Ga0501067_0201205 3300049583 Bacteria 1109
462 Ga0501069_0014098 3300049585 Bacteria 4268
463 Ga0501069_0047144 3300049585 Bacteria 2391
464 Ga0501070_0001885 3300049586 Bacteria 18541
465 Ga0501071_0009677 3300049587 Bacteria 6433
466 Ga0501071_0058417 3300049587 Bacteria 2789
467 Ga0501071_0215211 3300049587 Bacteria 1445
468 Ga0501072_0011549 3300049588 Bacteria 6749
469 Ga0501072_0223007 3300049588 Bacteria 1502
470 Ga0501073_0022180 3300049589 Bacteria 4575
471 Ga0501075_0068758 3300049591 Bacteria 2676
472 Ga0501076_0018024 3300049592 Bacteria 5373
473 Ga0501076_0025434 3300049592 Bacteria 4581
474 Ga0501077_0051369 3300049593 Bacteria 2620
475 Ga0501079_0013207 3300049741 Bacteria 6298
476 Ga0501079_0080196 3300049741 Bacteria 2524
477 Ga0501079_0106903 3300049741 Bacteria 2171
478 Ga0501080_0332763 3300049742 Bacteria 1373
479 Ga0501081_0054753 3300049743 Bacteria 2756
480 Ga0501083_0009544 3300049744 Bacteria 6854
481 Ga0501083_0032875 3300049744 Bacteria 3554
482 Ga0501083_0076030 3300049744 Bacteria 2229
483 Ga0501035_0012533 3300049822 Bacteria 7831
484 Ga0501035_0314754 3300049822 Bacteria 1316
485 Ga0501044_0017031 3300049823 Bacteria 7798
486 Ga0501044_0059974 3300049823 Bacteria 3897
487 Ga0501044_0243704 3300049823 Bacteria 1740
488 Ga0501045_0082876 3300049824 Bacteria 2365
489 Ga0501045_0198254 3300049824 Bacteria 1496
490 nmdc:mga03n38_11283_c1 3300050490 Bacteria 3322
491 nmdc:mga00v17_23670_c1 3300050491 Bacteria 3555
492 nmdc:mga00v17_3816_c1 3300050491 Bacteria 7772
493 nmdc:mga0yw44_152169_c1 3300050492 Bacteria 1510
494 nmdc:mga0yw44_76137_c1 3300050492 Bacteria 2094
495 nmdc:mga06z11_43922_c1 3300050494 Bacteria 2251
496 nmdc:mga05p37_105886_c1 3300050507 Bacteria 3459
497 nmdc:mga05p37_122843_c1 3300050507 Bacteria 3189
498 nmdc:mga05p37_19674_c1 3300050507 Bacteria 8168
499 nmdc:mga09592_331972_c1 3300050508 Bacteria 1316
500 nmdc:mga0qj67_36725_c1 3300050509 Bacteria 3835
501 nmdc:mga0qj67_84895_c1 3300050509 Bacteria 2539
502 nmdc:mga06r32_15234_c1 3300050510 Bacteria 6984
503 nmdc:mga06r32_34834_c1 3300050510 Bacteria 4749
504 nmdc:mga08y16_2963_c1 3300050511 Bacteria 17497
505 nmdc:mga08y16_911352_c1 3300050511 Bacteria 864
506 nmdc:mga0n895_150585_c1 3300050512 Bacteria 2357
507 nmdc:mga0n895_25001_c1 3300050512 Bacteria 5637
508 nmdc:mga08x19_234741_c1 3300050514 Bacteria 1263
509 nmdc:mga0a205_219773_c1 3300050515 Bacteria 1786
510 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
511 nmdc:mga0a205_61369_c1 3300050515 Bacteria 3631
512 Ga0495601_0000017 3300053077 Bacteria 204209
513 Ga0495601_0000318 3300053077 Bacteria 25520
514 Ga0495601_0024434 3300053077 Bacteria 3721
515 Ga0495601_0028110 3300053077 Bacteria 3481
516 Ga0495601_0038538 3300053077 Bacteria 2990
517 Ga0495601_0048712 3300053077 Bacteria 2669
518 Ga0495601_0084681 3300053077 Bacteria 2037
519 Ga0495601_0201060 3300053077 Bacteria 1302
520 Ga0495612_0000155 3300053078 Bacteria 28711
521 Ga0495612_0003068 3300053078 Bacteria 6928
522 Ga0495612_0020692 3300053078 Bacteria 2637
523 Ga0495612_0084839 3300053078 Bacteria 1334
524 Ga0495655_0000005 3300053083 Bacteria 257472
525 Ga0495595_0000007 3300053084 Bacteria 228504
526 Ga0495595_0000378 3300053084 Bacteria 16864
527 Ga0495595_0036298 3300053084 Bacteria 2236
528 Ga0495595_0058305 3300053084 Bacteria 1803
529 Ga0495619_0000001 3300053085 Bacteria 586054
530 Ga0495619_0000026 3300053085 Bacteria 167387
531 Ga0495619_0000088 3300053085 Bacteria 69615
532 Ga0495619_0000127 3300053085 Bacteria 55995
533 Ga0495619_0000346 3300053085 Bacteria 32476
534 Ga0495619_0006101 3300053085 Bacteria 7631
535 Ga0495619_0039095 3300053085 Bacteria 3096
536 Ga0495619_0127908 3300053085 Bacteria 1744
537 Ga0500566_0001830 3300053094 Bacteria 12505
538 Ga0500641_0000873 3300053096 Bacteria 10782
539 Ga0500595_014028 3300053119 Bacteria 3052
540 Ga0500614_001618 3300053123 Bacteria 5307
541 Ga0500628_000013 3300053129 Bacteria 106419
542 Ga0501084_0023130 3300054114 Bacteria 5188
543 Ga0501082_0079130 3300060353 Bacteria 2836
544 Ga0501082_0146498 3300060353 Bacteria 2050
545 Ga0501082_0187661 3300060353 Bacteria 1799
546 Ga0530510_0046085 3300061734 Bacteria 3149

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_911352_c1 nmdc:mga08y16_911352_c1_25_852 271
2 3300006038 Ga0075365_10012400 Ga0075365_100124001 284
3 3300009545 Ga0105237_10030852 Ga0105237_100308524 304
4 3300025914 Ga0207671_10084315 Ga0207671_100843152 304
5 3300006038 Ga0075365_10008059 Ga0075365_100080595 313
6 3300006038 Ga0075365_10043160 Ga0075365_100431602 313
7 3300006048 Ga0075363_100009258 Ga0075363_1000092586 313
8 3300006051 Ga0075364_10068807 Ga0075364_100688073 313
9 3300046463 Ga0495653_0111487 Ga0495653_0111487_947_1903 313
10 3300046473 Ga0495582_0000003 Ga0495582_0000003_33971_34981 313
11 3300046683 Ga0495658_0000001 Ga0495658_0000001_137430_138440 313
12 3300049460 Ga0495682_0089528 Ga0495682_0089528_125_1090 313
13 3300050490 nmdc:mga03n38_11283_c1 nmdc:mga03n38_11283_c1_461_1402 313
14 3300050492 nmdc:mga0yw44_152169_c1 nmdc:mga0yw44_152169_c1_359_1300 313
15 3300031727 Ga0316576_10000603 Ga0316576_100006033 314
16 3300035398 Ga0316574_0024095 Ga0316574_0024095_1584_2528 314
17 3300049571 Ga0501034_0007803 Ga0501034_0007803_2215_3159 314
18 3300049571 Ga0501034_0030315 Ga0501034_0030315_823_1767 314
19 3300049822 Ga0501035_0314754 Ga0501035_0314754_234_1178 314
20 3300049823 Ga0501044_0059974 Ga0501044_0059974_550_1494 314
21 iso_pu_bacteria 2786546517 2787438033 315
22 3300006881 Ga0068865_100054085 Ga0068865_1000540855 316
23 3300025938 Ga0207704_10000104 Ga0207704_1000010428 316
24 3300009147 Ga0114129_10284908 Ga0114129_102849082 319
25 3300035398 Ga0316574_0118784 Ga0316574_0118784_239_1222 319
26 3300006178 Ga0075367_10125368 Ga0075367_101253682 320
27 3300049585 Ga0501069_0014098 Ga0501069_0014098_3048_4034 320
28 3300049588 Ga0501072_0223007 Ga0501072_0223007_238_1224 320
29 3300049744 Ga0501083_0076030 Ga0501083_0076030_1180_2166 320
30 3300050491 nmdc:mga00v17_23670_c1 nmdc:mga00v17_23670_c1_544_1539 320
31 3300005435 Ga0070714_100004088 Ga0070714_1000040886 321
32 3300005435 Ga0070714_100356459 Ga0070714_1003564592 321
33 3300005548 Ga0070665_100652886 Ga0070665_1006528861 321
34 3300025929 Ga0207664_10000006 Ga0207664_10000006240 321
35 3300048903 Ga0496100_0002659 Ga0496100_0002659_1685_2662 321
36 3300048904 Ga0496101_0001403 Ga0496101_0001403_6360_7337 321
37 3300048913 Ga0496110_0032719 Ga0496110_0032719_368_1348 321
38 3300050494 nmdc:mga06z11_43922_c1 nmdc:mga06z11_43922_c1_1153_2142 321
39 3300060353 Ga0501082_0146498 Ga0501082_0146498_14_1003 321
40 3300005338 Ga0068868_100072591 Ga0068868_1000725912 322
41 3300005343 Ga0070687_100012467 Ga0070687_1000124672 322
42 3300005364 Ga0070673_100100925 Ga0070673_1001009252 322
43 3300005366 Ga0070659_100000852 Ga0070659_10000085223 322
44 3300005455 Ga0070663_100021932 Ga0070663_1000219322 322
45 3300005456 Ga0070678_100226970 Ga0070678_1002269702 322
46 3300005459 Ga0068867_100007697 Ga0068867_1000076978 322
47 3300005578 Ga0068854_100021369 Ga0068854_1000213694 322
48 3300005834 Ga0068851_10083118 Ga0068851_100831182 322
49 3300005844 Ga0068862_100202398 Ga0068862_1002023982 322
50 3300006881 Ga0068865_100078856 Ga0068865_1000788562 322
51 3300009098 Ga0105245_10009368 Ga0105245_100093688 322
52 3300009148 Ga0105243_10010662 Ga0105243_100106622 322
53 3300010375 Ga0105239_10030284 Ga0105239_100302843 322
54 3300025918 Ga0207662_10034095 Ga0207662_100340953 322
55 3300025919 Ga0207657_10007235 Ga0207657_100072356 322
56 3300025927 Ga0207687_10101546 Ga0207687_101015462 322
57 3300025932 Ga0207690_10112859 Ga0207690_101128592 322
58 3300025938 Ga0207704_10026478 Ga0207704_100264783 322
59 3300025940 Ga0207691_10003769 Ga0207691_100037692 322
60 3300025960 Ga0207651_10032078 Ga0207651_100320783 322
61 3300026067 Ga0207678_10001975 Ga0207678_1000197513 322
62 3300026089 Ga0207648_10013215 Ga0207648_100132154 322
63 3300026116 Ga0207674_10050746 Ga0207674_100507462 322
64 3300028379 Ga0268266_10081443 Ga0268266_100814431 322
65 3300031901 Ga0307406_10112797 Ga0307406_101127972 322
66 3300035398 Ga0316574_0082417 Ga0316574_0082417_89_1081 322
67 3300048911 Ga0496108_0149035 Ga0496108_0149035_961_1953 322
68 3300048912 Ga0496109_0099553 Ga0496109_0099553_132_1124 322
69 3300048915 Ga0496112_0000173 Ga0496112_0000173_6005_6985 322
70 3300048916 Ga0496113_0019903 Ga0496113_0019903_1676_2668 322
71 3300049575 Ga0501039_0023575 Ga0501039_0023575_3574_4572 322
72 3300049575 Ga0501039_0045783 Ga0501039_0045783_304_1287 322
73 3300049578 Ga0501042_0077366 Ga0501042_0077366_1373_2356 322
74 3300049587 Ga0501071_0009677 Ga0501071_0009677_2847_3830 322
75 3300049588 Ga0501072_0011549 Ga0501072_0011549_5428_6411 322
76 3300049591 Ga0501075_0068758 Ga0501075_0068758_1109_2092 322
77 3300049592 Ga0501076_0018024 Ga0501076_0018024_924_1907 322
78 3300049593 Ga0501077_0051369 Ga0501077_0051369_924_1907 322
79 3300049741 Ga0501079_0013207 Ga0501079_0013207_3662_4645 322
80 3300049743 Ga0501081_0054753 Ga0501081_0054753_581_1564 322
81 3300049824 Ga0501045_0082876 Ga0501045_0082876_472_1455 322
82 3300054114 Ga0501084_0023130 Ga0501084_0023130_940_1932 322
83 3300060353 Ga0501082_0079130 Ga0501082_0079130_527_1510 322
84 3300061734 Ga0530510_0046085 Ga0530510_0046085_1427_2410 322
85 3300044765 Ga0466970_0019251 Ga0466970_0019251_195_1175 323
86 3300005614 Ga0068856_100000136 Ga0068856_10000013672 324
87 3300026078 Ga0207702_10000105 Ga0207702_10000105102 324
88 3300048927 Ga0496124_0026458 Ga0496124_0026458_1124_2107 324
89 3300005341 Ga0070691_10000970 Ga0070691_100009704 326
90 3300053119 Ga0500595_014028 Ga0500595_014028_1288_2310 326
91 3300005718 Ga0068866_10004817 Ga0068866_100048174 327
92 3300005937 Ga0081455_10010690 Ga0081455_100106905 327
93 3300005983 Ga0081540_1000557 Ga0081540_100055727 327
94 3300014968 Ga0157379_10246886 Ga0157379_102468862 327
95 3300025899 Ga0207642_10003444 Ga0207642_100034445 327
96 3300046499 Ga0495594_0000009 Ga0495594_0000009_41902_42900 327
97 3300046557 Ga0495622_0000097 Ga0495622_0000097_58265_59263 327
98 3300048905 Ga0496102_0090421 Ga0496102_0090421_406_1422 327
99 3300048917 Ga0496114_0000003 Ga0496114_0000003_496421_497422 327
100 3300048918 Ga0496115_0051024 Ga0496115_0051024_645_1643 327
101 3300048920 Ga0496117_0006601 Ga0496117_0006601_4631_5656 327
102 3300048922 Ga0496119_0015990 Ga0496119_0015990_1827_2843 327
103 3300048923 Ga0496120_0009403 Ga0496120_0009403_355_1371 327
104 3300048924 Ga0496121_0022580 Ga0496121_0022580_2888_3904 327
105 3300048924 Ga0496121_0167567 Ga0496121_0167567_195_1211 327
106 3300049744 Ga0501083_0009544 Ga0501083_0009544_3542_4552 327
107 3300053096 Ga0500641_0000873 Ga0500641_0000873_6401_7408 327
108 3300009147 Ga0114129_10125475 Ga0114129_101254753 328
109 3300013308 Ga0157375_10000492 Ga0157375_1000049216 328
110 3300020080 Ga0206350_10333991 Ga0206350_103339913 328
111 3300050507 nmdc:mga05p37_105886_c1 nmdc:mga05p37_105886_c1_1733_2782 328
112 3300005335 Ga0070666_10009188 Ga0070666_100091885 329
113 3300005341 Ga0070691_10000004 Ga0070691_1000000415 329
114 3300005344 Ga0070661_100000004 Ga0070661_100000004226 329
115 3300005347 Ga0070668_100010212 Ga0070668_1000102123 329
116 3300005347 Ga0070668_100019643 Ga0070668_1000196434 329
117 3300005367 Ga0070667_100003085 Ga0070667_1000030852 329
118 3300005367 Ga0070667_100068631 Ga0070667_1000686312 329
119 3300005436 Ga0070713_100000503 Ga0070713_1000005036 329
120 3300005466 Ga0070685_10000010 Ga0070685_10000010107 329
121 3300005530 Ga0070679_100000471 Ga0070679_10000047121 329
122 3300005543 Ga0070672_100000031 Ga0070672_10000003150 329
123 3300005548 Ga0070665_100002868 Ga0070665_10000286817 329
124 3300005564 Ga0070664_100193884 Ga0070664_1001938842 329
125 3300005616 Ga0068852_100064550 Ga0068852_1000645503 329
126 3300005834 Ga0068851_10002105 Ga0068851_100021053 329
127 3300005841 Ga0068863_100008832 Ga0068863_1000088324 329
128 3300005841 Ga0068863_100268176 Ga0068863_1002681762 329
129 3300005844 Ga0068862_100001309 Ga0068862_10000130924 329
130 3300005937 Ga0081455_10016053 Ga0081455_100160537 329
131 3300005983 Ga0081540_1000174 Ga0081540_100017418 329
132 3300006038 Ga0075365_10001651 Ga0075365_100016517 329
133 3300006844 Ga0075428_100243017 Ga0075428_1002430172 329
134 3300006846 Ga0075430_100026320 Ga0075430_1000263202 329
135 3300006847 Ga0075431_100003746 Ga0075431_1000037462 329
136 3300006871 Ga0075434_100001338 Ga0075434_10000133815 329
137 3300009101 Ga0105247_10000131 Ga0105247_1000013151 329
138 3300009147 Ga0114129_10030345 Ga0114129_100303456 329
139 3300009148 Ga0105243_10010381 Ga0105243_100103814 329
140 3300009176 Ga0105242_10000063 Ga0105242_1000006354 329
141 3300009176 Ga0105242_10000428 Ga0105242_1000042827 329
142 3300009177 Ga0105248_10192317 Ga0105248_101923173 329
143 3300009545 Ga0105237_10237342 Ga0105237_102373423 329
144 3300009553 Ga0105249_10004038 Ga0105249_100040386 329
145 3300010375 Ga0105239_10210502 Ga0105239_102105023 329
146 3300013297 Ga0157378_10018349 Ga0157378_100183493 329
147 3300013308 Ga0157375_10030090 Ga0157375_100300907 329
148 3300014326 Ga0157380_10000007 Ga0157380_1000000742 329
149 3300014968 Ga0157379_10049463 Ga0157379_100494632 329
150 3300025321 Ga0207656_10002076 Ga0207656_100020764 329
151 3300025900 Ga0207710_10000268 Ga0207710_1000026830 329
152 3300025903 Ga0207680_10004865 Ga0207680_100048655 329
153 3300025913 Ga0207695_10251788 Ga0207695_102517881 329
154 3300025915 Ga0207693_10014431 Ga0207693_100144314 329
155 3300025920 Ga0207649_10000003 Ga0207649_1000000334 329
156 3300025921 Ga0207652_10000412 Ga0207652_1000041223 329
157 3300025928 Ga0207700_10000003 Ga0207700_10000003185 329
158 3300025931 Ga0207644_10152774 Ga0207644_101527742 329
159 3300025934 Ga0207686_10000124 Ga0207686_100001245 329
160 3300025934 Ga0207686_10000395 Ga0207686_1000039514 329
161 3300025940 Ga0207691_10000178 Ga0207691_1000017836 329
162 3300025941 Ga0207711_10073917 Ga0207711_100739173 329
163 3300025944 Ga0207661_10003560 Ga0207661_100035605 329
164 3300025944 Ga0207661_10005006 Ga0207661_1000500610 329
165 3300025949 Ga0207667_10470726 Ga0207667_104707262 329
166 3300025961 Ga0207712_10019638 Ga0207712_100196385 329
167 3300025972 Ga0207668_10006557 Ga0207668_100065576 329
168 3300025986 Ga0207658_10015937 Ga0207658_100159373 329
169 3300026067 Ga0207678_10002172 Ga0207678_100021723 329
170 3300026075 Ga0207708_10225037 Ga0207708_102250373 329
171 3300026088 Ga0207641_10006453 Ga0207641_100064539 329
172 3300026116 Ga0207674_10414054 Ga0207674_104140541 329
173 3300027907 Ga0207428_10013276 Ga0207428_100132765 329
174 3300028379 Ga0268266_10000526 Ga0268266_1000052626 329
175 3300028379 Ga0268266_10000990 Ga0268266_1000099031 329
176 3300028380 Ga0268265_10008679 Ga0268265_100086796 329
177 3300028381 Ga0268264_10024255 Ga0268264_100242555 329
178 3300028563 Ga0265319_1000010 Ga0265319_100001037 329
179 3300028800 Ga0265338_10000287 Ga0265338_1000028772 329
180 3300031241 Ga0265325_10051053 Ga0265325_100510532 329
181 3300037418 Ga0395900_0008759 Ga0395900_0008759_67_1080 329
182 3300037466 Ga0395898_0032878 Ga0395898_0032878_3050_4063 329
183 3300037466 Ga0395898_0168643 Ga0395898_0168643_831_1850 329
184 3300038443 Ga0395901_0144181 Ga0395901_0144181_1138_2151 329
185 3300041512 Ga0451853_1416621 Ga0451853_1416621_124_1146 329
186 3300046459 Ga0495629_0000828 Ga0495629_0000828_15080_16084 329
187 3300046459 Ga0495629_0010841 Ga0495629_0010841_420_1424 329
188 3300046461 Ga0495641_0016090 Ga0495641_0016090_2083_3087 329
189 3300046476 Ga0495662_0002109 Ga0495662_0002109_765_1772 329
190 3300046507 Ga0495606_0000017 Ga0495606_0000017_62771_63775 329
191 3300046517 Ga0495630_0000032 Ga0495630_0000032_80324_81328 329
192 3300046536 Ga0495587_0000272 Ga0495587_0000272_12094_13098 329
193 3300046674 Ga0495588_0000073 Ga0495588_0000073_166295_167299 329
194 3300046690 Ga0495624_0000691 Ga0495624_0000691_10460_11464 329
195 3300047319 Ga0495674_0000039 Ga0495674_0000039_92250_93263 329
196 3300047321 Ga0495676_0007903 Ga0495676_0007903_8156_9160 329
197 3300047321 Ga0495676_0028720 Ga0495676_0028720_3069_4073 329
198 3300047444 Ga0495675_0046104 Ga0495675_0046104_1394_2407 329
199 3300047673 Ga0495593_0068616 Ga0495593_0068616_685_1689 329
200 3300048903 Ga0496100_0000001 Ga0496100_0000001_86184_87188 329
201 3300048904 Ga0496101_0000028 Ga0496101_0000028_86173_87177 329
202 3300048905 Ga0496102_0000749 Ga0496102_0000749_14687_15691 329
203 3300048906 Ga0496103_0000481 Ga0496103_0000481_26658_27662 329
204 3300048906 Ga0496103_0152873 Ga0496103_0152873_45_1067 329
205 3300048907 Ga0496104_0000010 Ga0496104_0000010_212648_213652 329
206 3300048908 Ga0496105_0000005 Ga0496105_0000005_212648_213652 329
207 3300048909 Ga0496106_0000218 Ga0496106_0000218_19187_20191 329
208 3300048910 Ga0496107_0000002 Ga0496107_0000002_161300_162304 329
209 3300048911 Ga0496108_0030741 Ga0496108_0030741_1707_2714 329
210 3300048912 Ga0496109_0000221 Ga0496109_0000221_53220_54233 329
211 3300048913 Ga0496110_0118739 Ga0496110_0118739_164_1168 329
212 3300048917 Ga0496114_0190191 Ga0496114_0190191_504_1508 329
213 3300048918 Ga0496115_0000016 Ga0496115_0000016_39456_40460 329
214 3300048919 Ga0496116_0001008 Ga0496116_0001008_28078_29109 329
215 3300048922 Ga0496119_0004936 Ga0496119_0004936_8306_9337 329
216 3300048922 Ga0496119_0015223 Ga0496119_0015223_817_1827 329
217 3300048924 Ga0496121_0021469 Ga0496121_0021469_4577_5587 329
218 3300048927 Ga0496124_0237578 Ga0496124_0237578_329_1342 329
219 3300049568 Ga0501031_0006509 Ga0501031_0006509_6323_7330 329
220 3300049569 Ga0501032_0007300 Ga0501032_0007300_572_1579 329
221 3300049570 Ga0501033_0001901 Ga0501033_0001901_17008_18015 329
222 3300049572 Ga0501036_0001783 Ga0501036_0001783_184_1191 329
223 3300049573 Ga0501037_0001034 Ga0501037_0001034_19381_20388 329
224 3300049574 Ga0501038_0002131 Ga0501038_0002131_6551_7558 329
225 3300049576 Ga0501040_0075248 Ga0501040_0075248_1157_2164 329
226 3300049579 Ga0501043_0009548 Ga0501043_0009548_6441_7448 329
227 3300049580 Ga0501046_0011259 Ga0501046_0011259_236_1243 329
228 3300049581 Ga0501047_0013797 Ga0501047_0013797_6511_7518 329
229 3300049581 Ga0501047_0015422 Ga0501047_0015422_6124_7158 329
230 3300049581 Ga0501047_0075389 Ga0501047_0075389_532_1539 329
231 3300049581 Ga0501047_0200521 Ga0501047_0200521_503_1516 329
232 3300049582 Ga0501048_0008391 Ga0501048_0008391_6412_7419 329
233 3300049583 Ga0501067_0201205 Ga0501067_0201205_48_1055 329
234 3300049585 Ga0501069_0047144 Ga0501069_0047144_1203_2216 329
235 3300049586 Ga0501070_0001885 Ga0501070_0001885_17234_18241 329
236 3300049587 Ga0501071_0058417 Ga0501071_0058417_1140_2153 329
237 3300049587 Ga0501071_0215211 Ga0501071_0215211_238_1245 329
238 3300049589 Ga0501073_0022180 Ga0501073_0022180_3398_4405 329
239 3300049592 Ga0501076_0025434 Ga0501076_0025434_105_1118 329
240 3300049741 Ga0501079_0106903 Ga0501079_0106903_148_1155 329
241 3300049742 Ga0501080_0332763 Ga0501080_0332763_196_1203 329
242 3300049744 Ga0501083_0032875 Ga0501083_0032875_2318_3325 329
243 3300049822 Ga0501035_0012533 Ga0501035_0012533_157_1164 329
244 3300049823 Ga0501044_0017031 Ga0501044_0017031_167_1174 329
245 3300049823 Ga0501044_0243704 Ga0501044_0243704_571_1584 329
246 3300049824 Ga0501045_0198254 Ga0501045_0198254_352_1359 329
247 3300050507 nmdc:mga05p37_19674_c1 nmdc:mga05p37_19674_c1_6004_7059 329
248 3300050509 nmdc:mga0qj67_36725_c1 nmdc:mga0qj67_36725_c1_2677_3681 329
249 3300050510 nmdc:mga06r32_15234_c1 nmdc:mga06r32_15234_c1_1693_2748 329
250 3300050511 nmdc:mga08y16_2963_c1 nmdc:mga08y16_2963_c1_9795_10850 329
251 3300050512 nmdc:mga0n895_25001_c1 nmdc:mga0n895_25001_c1_2341_3396 329
252 3300050515 nmdc:mga0a205_61369_c1 nmdc:mga0a205_61369_c1_1309_2364 329
253 3300053077 Ga0495601_0201060 Ga0495601_0201060_150_1154 329
254 3300053078 Ga0495612_0003068 Ga0495612_0003068_4857_5861 329
255 3300053083 Ga0495655_0000005 Ga0495655_0000005_250784_251788 329
256 3300053094 Ga0500566_0001830 Ga0500566_0001830_5604_6608 329
257 3300053129 Ga0500628_000013 Ga0500628_000013_5860_6864 329
258 3300001977 JGI24746J21847_1002058 JGI24746J21847_10020585 330
259 3300002074 JGI24748J21848_1000356 JGI24748J21848_10003565 330
260 3300002239 JGI24034J26672_10000216 JGI24034J26672_100002164 330
261 3300005329 Ga0070683_100023947 Ga0070683_1000239475 330
262 3300005337 Ga0070682_100000023 Ga0070682_100000023154 330
263 3300005337 Ga0070682_100000026 Ga0070682_100000026164 330
264 3300005338 Ga0068868_100000694 Ga0068868_1000006946 330
265 3300005340 Ga0070689_100210380 Ga0070689_1002103802 330
266 3300005354 Ga0070675_100000050 Ga0070675_10000005028 330
267 3300005356 Ga0070674_100000141 Ga0070674_10000014124 330
268 3300005365 Ga0070688_100000686 Ga0070688_10000068615 330
269 3300005365 Ga0070688_100076412 Ga0070688_1000764123 330
270 3300005366 Ga0070659_100003678 Ga0070659_10000367812 330
271 3300005436 Ga0070713_100119207 Ga0070713_1001192072 330
272 3300005466 Ga0070685_10001080 Ga0070685_100010807 330
273 3300005535 Ga0070684_100012351 Ga0070684_1000123514 330
274 3300005535 Ga0070684_100048700 Ga0070684_1000487005 330
275 3300005578 Ga0068854_100000082 Ga0068854_10000008265 330
276 3300005718 Ga0068866_10000004 Ga0068866_1000000415 330
277 3300005841 Ga0068863_100000261 Ga0068863_1000002619 330
278 3300005937 Ga0081455_10047858 Ga0081455_100478582 330
279 3300009098 Ga0105245_10000040 Ga0105245_1000004045 330
280 3300009098 Ga0105245_10000117 Ga0105245_1000011716 330
281 3300009098 Ga0105245_10006841 Ga0105245_100068415 330
282 3300009553 Ga0105249_10000218 Ga0105249_1000021831 330
283 3300013104 Ga0157370_10004940 Ga0157370_100049406 330
284 3300013296 Ga0157374_10001719 Ga0157374_1000171910 330
285 3300013297 Ga0157378_10023605 Ga0157378_100236052 330
286 3300013307 Ga0157372_10000146 Ga0157372_1000014618 330
287 3300014326 Ga0157380_10001343 Ga0157380_100013436 330
288 3300014969 Ga0157376_10010885 Ga0157376_100108853 330
289 3300020081 Ga0206354_10497300 Ga0206354_104973002 330
290 3300020081 Ga0206354_11031077 Ga0206354_110310772 330
291 3300020082 Ga0206353_11807736 Ga0206353_118077364 330
292 3300022467 Ga0224712_10022571 Ga0224712_100225711 330
293 3300025899 Ga0207642_10000005 Ga0207642_10000005192 330
294 3300025926 Ga0207659_10000055 Ga0207659_1000005529 330
295 3300025927 Ga0207687_10000046 Ga0207687_1000004616 330
296 3300025927 Ga0207687_10000070 Ga0207687_1000007078 330
297 3300025927 Ga0207687_10006279 Ga0207687_100062794 330
298 3300025932 Ga0207690_10002537 Ga0207690_100025373 330
299 3300025936 Ga0207670_10142256 Ga0207670_101422562 330
300 3300025937 Ga0207669_10000021 Ga0207669_1000002135 330
301 3300025941 Ga0207711_10000011 Ga0207711_10000011394 330
302 3300025944 Ga0207661_10002170 Ga0207661_100021705 330
303 3300025961 Ga0207712_10000027 Ga0207712_10000027224 330
304 3300025981 Ga0207640_10000054 Ga0207640_1000005440 330
305 3300026023 Ga0207677_10001111 Ga0207677_1000111110 330
306 3300026088 Ga0207641_10000062 Ga0207641_10000062127 330
307 3300026118 Ga0207675_100160315 Ga0207675_1001603152 330
308 3300026142 Ga0207698_10000015 Ga0207698_1000001593 330
309 3300028556 Ga0265337_1001256 Ga0265337_100125613 330
310 3300028558 Ga0265326_10000127 Ga0265326_100001277 330
311 3300028654 Ga0265322_10000005 Ga0265322_10000005172 330
312 3300028666 Ga0265336_10026744 Ga0265336_100267443 330
313 3300031239 Ga0265328_10019084 Ga0265328_100190844 330
314 3300031240 Ga0265320_10000010 Ga0265320_10000010218 330
315 3300031242 Ga0265329_10001050 Ga0265329_1000105011 330
316 3300031249 Ga0265339_10016752 Ga0265339_100167525 330
317 3300031250 Ga0265331_10000217 Ga0265331_1000021726 330
318 3300031251 Ga0265327_10000040 Ga0265327_1000004088 330
319 3300031344 Ga0265316_10035110 Ga0265316_100351103 330
320 3300031711 Ga0265314_10000491 Ga0265314_1000049151 330
321 3300031712 Ga0265342_10059103 Ga0265342_100591032 330
322 3300031995 Ga0307409_100453414 Ga0307409_1004534141 330
323 3300032126 Ga0307415_100011748 Ga0307415_1000117483 330
324 3300032133 Ga0316583_10056789 Ga0316583_100567892 330
325 3300037471 Ga0395905_0029155 Ga0395905_0029155_1916_2932 330
326 3300045976 Ga0466967_0000002 Ga0466967_0000002_37858_38865 330
327 3300046455 Ga0495603_0000102 Ga0495603_0000102_17310_18317 330
328 3300046462 Ga0495651_0171738 Ga0495651_0171738_148_1158 330
329 3300046476 Ga0495662_0001473 Ga0495662_0001473_4411_5421 330
330 3300046511 Ga0495608_0000013 Ga0495608_0000013_85744_86751 330
331 3300046514 Ga0495618_0181771 Ga0495618_0181771_188_1234 330
332 3300046516 Ga0495628_0000794 Ga0495628_0000794_15139_16146 330
333 3300046517 Ga0495630_0007095 Ga0495630_0007095_5978_6985 330
334 3300046523 Ga0495644_0002837 Ga0495644_0002837_1097_2104 330
335 3300046529 Ga0495652_0000018 Ga0495652_0000018_80002_81009 330
336 3300046537 Ga0495598_0002543 Ga0495598_0002543_61_1068 330
337 3300046543 Ga0495645_0006138 Ga0495645_0006138_6880_7887 330
338 3300046559 Ga0495667_0000038 Ga0495667_0000038_49402_50409 330
339 3300046559 Ga0495667_0060775 Ga0495667_0060775_1073_2083 330
340 3300046642 Ga0495634_0001691 Ga0495634_0001691_6207_7214 330
341 3300046675 Ga0495657_0000003 Ga0495657_0000003_136943_137950 330
342 3300046683 Ga0495658_0002091 Ga0495658_0002091_5951_6958 330
343 3300046684 Ga0495669_0000483 Ga0495669_0000483_11841_12848 330
344 3300046689 Ga0495613_0000027 Ga0495613_0000027_129001_130008 330
345 3300046689 Ga0495613_0112287 Ga0495613_0112287_348_1358 330
346 3300046809 Ga0495600_0032852 Ga0495600_0032852_1327_2334 330
347 3300047317 Ga0495604_0000100 Ga0495604_0000100_60365_61372 330
348 3300047317 Ga0495604_0000723 Ga0495604_0000723_14598_15605 330
349 3300047317 Ga0495604_0032236 Ga0495604_0032236_2074_3081 330
350 3300047321 Ga0495676_0016441 Ga0495676_0016441_5241_6248 330
351 3300047322 Ga0495680_0001001 Ga0495680_0001001_23975_24982 330
352 3300047444 Ga0495675_0000002 Ga0495675_0000002_136943_137950 330
353 3300048088 Ga0495602_0000034 Ga0495602_0000034_87353_88360 330
354 3300048088 Ga0495602_0006995 Ga0495602_0006995_5514_6521 330
355 3300048910 Ga0496107_0151562 Ga0496107_0151562_182_1201 330
356 3300048911 Ga0496108_0000005 Ga0496108_0000005_425730_426737 330
357 3300048911 Ga0496108_0014805 Ga0496108_0014805_2207_3217 330
358 3300048912 Ga0496109_0000002 Ga0496109_0000002_108355_109362 330
359 3300048912 Ga0496109_0000378 Ga0496109_0000378_26957_27967 330
360 3300048913 Ga0496110_0000052 Ga0496110_0000052_10789_11796 330
361 3300048914 Ga0496111_0000121 Ga0496111_0000121_5402_6409 330
362 3300048915 Ga0496112_0012664 Ga0496112_0012664_2823_3830 330
363 3300048916 Ga0496113_0000005 Ga0496113_0000005_82101_83108 330
364 3300048916 Ga0496113_0063062 Ga0496113_0063062_442_1461 330
365 3300048920 Ga0496117_0074704 Ga0496117_0074704_435_1469 330
366 3300050508 nmdc:mga09592_331972_c1 nmdc:mga09592_331972_c1_146_1165 330
367 3300053077 Ga0495601_0000017 Ga0495601_0000017_16996_18003 330
368 3300053077 Ga0495601_0038538 Ga0495601_0038538_1281_2288 330
369 3300053077 Ga0495601_0084681 Ga0495601_0084681_511_1518 330
370 3300053078 Ga0495612_0084839 Ga0495612_0084839_63_1070 330
371 3300053084 Ga0495595_0000007 Ga0495595_0000007_85767_86774 330
372 3300053084 Ga0495595_0036298 Ga0495595_0036298_1162_2169 330
373 3300053085 Ga0495619_0000001 Ga0495619_0000001_447352_448362 330
374 3300053085 Ga0495619_0000026 Ga0495619_0000026_85790_86797 330
375 3300053085 Ga0495619_0000088 Ga0495619_0000088_41249_42256 330
376 3300053085 Ga0495619_0000127 Ga0495619_0000127_9114_10121 330
377 3300005340 Ga0070689_100081610 Ga0070689_1000816101 331
378 3300005356 Ga0070674_100000002 Ga0070674_10000000257 331
379 3300005439 Ga0070711_100016216 Ga0070711_1000162163 331
380 3300005439 Ga0070711_100036952 Ga0070711_1000369522 331
381 3300005457 Ga0070662_100000001 Ga0070662_10000000176 331
382 3300005458 Ga0070681_10080275 Ga0070681_100802753 331
383 3300005459 Ga0068867_100000078 Ga0068867_10000007845 331
384 3300005530 Ga0070679_100000424 Ga0070679_10000042421 331
385 3300005535 Ga0070684_100048102 Ga0070684_1000481022 331
386 3300005535 Ga0070684_100143343 Ga0070684_1001433432 331
387 3300005547 Ga0070693_100001579 Ga0070693_1000015795 331
388 3300005548 Ga0070665_100000022 Ga0070665_1000000229 331
389 3300005564 Ga0070664_100212796 Ga0070664_1002127963 331
390 3300005614 Ga0068856_100005657 Ga0068856_1000056576 331
391 3300005618 Ga0068864_100000090 Ga0068864_10000009069 331
392 3300005842 Ga0068858_100001180 Ga0068858_1000011809 331
393 3300005843 Ga0068860_100003017 Ga0068860_10000301716 331
394 3300005981 Ga0081538_10000814 Ga0081538_1000081419 331
395 3300005981 Ga0081538_10053974 Ga0081538_100539742 331
396 3300006038 Ga0075365_10006453 Ga0075365_100064534 331
397 3300006051 Ga0075364_10004153 Ga0075364_100041536 331
398 3300006163 Ga0070715_10000008 Ga0070715_1000000831 331
399 3300006358 Ga0068871_100086946 Ga0068871_1000869464 331
400 3300006847 Ga0075431_100022444 Ga0075431_1000224443 331
401 3300006852 Ga0075433_10000337 Ga0075433_1000033710 331
402 3300006852 Ga0075433_10185196 Ga0075433_101851962 331
403 3300006871 Ga0075434_100012705 Ga0075434_1000127056 331
404 3300006914 Ga0075436_100151343 Ga0075436_1001513433 331
405 3300009094 Ga0111539_10352080 Ga0111539_103520802 331
406 3300009098 Ga0105245_10000629 Ga0105245_1000062925 331
407 3300009148 Ga0105243_10180684 Ga0105243_101806842 331
408 3300009551 Ga0105238_10000033 Ga0105238_10000033120 331
409 3300009553 Ga0105249_10143982 Ga0105249_101439822 331
410 3300009553 Ga0105249_10563279 Ga0105249_105632791 331
411 3300010375 Ga0105239_10549574 Ga0105239_105495742 331
412 3300011119 Ga0105246_10326253 Ga0105246_103262531 331
413 3300013296 Ga0157374_10203473 Ga0157374_102034732 331
414 3300013297 Ga0157378_10101111 Ga0157378_101011112 331
415 3300013308 Ga0157375_10067540 Ga0157375_100675401 331
416 3300014968 Ga0157379_10063407 Ga0157379_100634073 331
417 3300017792 Ga0163161_10000027 Ga0163161_100000271 331
418 3300025899 Ga0207642_10000737 Ga0207642_100007375 331
419 3300025905 Ga0207685_10000012 Ga0207685_1000001231 331
420 3300025912 Ga0207707_10023616 Ga0207707_100236163 331
421 3300025915 Ga0207693_10015147 Ga0207693_100151474 331
422 3300025916 Ga0207663_10004985 Ga0207663_100049856 331
423 3300025921 Ga0207652_10000232 Ga0207652_100002322 331
424 3300025924 Ga0207694_10000012 Ga0207694_10000012121 331
425 3300025927 Ga0207687_10000095 Ga0207687_1000009554 331
426 3300025933 Ga0207706_10000003 Ga0207706_10000003253 331
427 3300025937 Ga0207669_10000003 Ga0207669_10000003237 331
428 3300025944 Ga0207661_10180341 Ga0207661_101803412 331
429 3300025945 Ga0207679_10128408 Ga0207679_101284082 331
430 3300025961 Ga0207712_10282739 Ga0207712_102827392 331
431 3300026035 Ga0207703_10000020 Ga0207703_1000002063 331
432 3300026078 Ga0207702_10001788 Ga0207702_1000178821 331
433 3300026095 Ga0207676_10000016 Ga0207676_10000016283 331
434 3300026121 Ga0207683_10033719 Ga0207683_100337192 331
435 3300028379 Ga0268266_10000029 Ga0268266_10000029440 331
436 3300028381 Ga0268264_10001191 Ga0268264_1000119118 331
437 3300036401 Ga0373937_0009257 Ga0373937_0009257_1859_2869 331
438 3300038443 Ga0395901_0345576 Ga0395901_0345576_224_1255 331
439 3300044694 Ga0466963_0000233 Ga0466963_0000233_16010_17020 331
440 3300045976 Ga0466967_0067231 Ga0466967_0067231_1581_2588 331
441 3300046454 Ga0495592_0000024 Ga0495592_0000024_121165_122175 331
442 3300046455 Ga0495603_0001201 Ga0495603_0001201_12476_13489 331
443 3300046455 Ga0495603_0001271 Ga0495603_0001271_3809_4819 331
444 3300046459 Ga0495629_0070431 Ga0495629_0070431_1167_2177 331
445 3300046461 Ga0495641_0000004 Ga0495641_0000004_72883_73893 331
446 3300046463 Ga0495653_0167298 Ga0495653_0167298_194_1204 331
447 3300046477 Ga0495664_0035968 Ga0495664_0035968_805_1821 331
448 3300046511 Ga0495608_0000661 Ga0495608_0000661_2845_3855 331
449 3300046511 Ga0495608_0020565 Ga0495608_0020565_1478_2488 331
450 3300046511 Ga0495608_0080915 Ga0495608_0080915_734_1744 331
451 3300046514 Ga0495618_0000267 Ga0495618_0000267_15733_16743 331
452 3300046515 Ga0495620_0000041 Ga0495620_0000041_46762_47772 331
453 3300046516 Ga0495628_0035805 Ga0495628_0035805_2189_3199 331
454 3300046516 Ga0495628_0089356 Ga0495628_0089356_464_1480 331
455 3300046516 Ga0495628_0122167 Ga0495628_0122167_822_1838 331
456 3300046517 Ga0495630_0000026 Ga0495630_0000026_88202_89212 331
457 3300046529 Ga0495652_0086425 Ga0495652_0086425_446_1456 331
458 3300046535 Ga0495586_0000254 Ga0495586_0000254_15267_16277 331
459 3300046543 Ga0495645_0118566 Ga0495645_0118566_763_1773 331
460 3300046642 Ga0495634_0000002 Ga0495634_0000002_128808_129821 331
461 3300046642 Ga0495634_0010144 Ga0495634_0010144_4143_5159 331
462 3300046663 Ga0495635_0000005 Ga0495635_0000005_31621_32631 331
463 3300046674 Ga0495588_0073193 Ga0495588_0073193_591_1631 331
464 3300046675 Ga0495657_0021495 Ga0495657_0021495_1892_2902 331
465 3300046678 Ga0495599_0005867 Ga0495599_0005867_2962_3972 331
466 3300046678 Ga0495599_0118123 Ga0495599_0118123_480_1496 331
467 3300046681 Ga0495647_0000005 Ga0495647_0000005_99783_100796 331
468 3300046681 Ga0495647_0007800 Ga0495647_0007800_2445_3455 331
469 3300046684 Ga0495669_0084535 Ga0495669_0084535_125_1141 331
470 3300046689 Ga0495613_0009561 Ga0495613_0009561_47_1057 331
471 3300046690 Ga0495624_0000123 Ga0495624_0000123_16110_17120 331
472 3300046690 Ga0495624_0025621 Ga0495624_0025621_2474_3484 331
473 3300046694 Ga0495649_0004688 Ga0495649_0004688_2578_3588 331
474 3300047322 Ga0495680_0000007 Ga0495680_0000007_124074_125084 331
475 3300047322 Ga0495680_0000929 Ga0495680_0000929_16055_17065 331
476 3300047446 Ga0495679_006392 Ga0495679_006392_3616_4626 331
477 3300047447 Ga0495685_032826 Ga0495685_032826_66_1076 331
478 3300048903 Ga0496100_0000024 Ga0496100_0000024_68767_69777 331
479 3300048904 Ga0496101_0000072 Ga0496101_0000072_46362_47372 331
480 3300048904 Ga0496101_0024877 Ga0496101_0024877_2983_4023 331
481 3300048905 Ga0496102_0098336 Ga0496102_0098336_1537_2571 331
482 3300048905 Ga0496102_0099089 Ga0496102_0099089_986_2005 331
483 3300048906 Ga0496103_0023194 Ga0496103_0023194_1888_2928 331
484 3300048907 Ga0496104_0000008 Ga0496104_0000008_119404_120414 331
485 3300048907 Ga0496104_0000579 Ga0496104_0000579_4272_5282 331
486 3300048907 Ga0496104_0034784 Ga0496104_0034784_1096_2130 331
487 3300048908 Ga0496105_0000003 Ga0496105_0000003_119404_120414 331
488 3300048908 Ga0496105_0000051 Ga0496105_0000051_80428_81438 331
489 3300048909 Ga0496106_0000040 Ga0496106_0000040_61383_62393 331
490 3300048909 Ga0496106_0000042 Ga0496106_0000042_51505_52515 331
491 3300048909 Ga0496106_0013759 Ga0496106_0013759_4468_5502 331
492 3300048910 Ga0496107_0000025 Ga0496107_0000025_68767_69777 331
493 3300048910 Ga0496107_0021126 Ga0496107_0021126_1583_2602 331
494 3300048911 Ga0496108_0000004 Ga0496108_0000004_475221_476231 331
495 3300048911 Ga0496108_0024629 Ga0496108_0024629_1552_2586 331
496 3300048912 Ga0496109_0000013 Ga0496109_0000013_157662_158672 331
497 3300048912 Ga0496109_0067263 Ga0496109_0067263_1450_2460 331
498 3300048912 Ga0496109_0300487 Ga0496109_0300487_230_1270 331
499 3300048913 Ga0496110_0321698 Ga0496110_0321698_208_1215 331
500 3300048913 Ga0496110_0367488 Ga0496110_0367488_242_1255 331
501 3300048913 Ga0496110_0419505 Ga0496110_0419505_123_1133 331
502 3300048914 Ga0496111_0026764 Ga0496111_0026764_274_1284 331
503 3300048915 Ga0496112_0000026 Ga0496112_0000026_21867_22877 331
504 3300048915 Ga0496112_0081801 Ga0496112_0081801_104_1144 331
505 3300048916 Ga0496113_0012533 Ga0496113_0012533_2363_3397 331
506 3300048916 Ga0496113_0024909 Ga0496113_0024909_186_1196 331
507 3300048916 Ga0496113_0206548 Ga0496113_0206548_66_1076 331
508 3300048917 Ga0496114_0012219 Ga0496114_0012219_3306_4316 331
509 3300048917 Ga0496114_0267600 Ga0496114_0267600_454_1464 331
510 3300049578 Ga0501042_0087641 Ga0501042_0087641_382_1392 331
511 3300050491 nmdc:mga00v17_3816_c1 nmdc:mga00v17_3816_c1_4354_5385 331
512 3300050492 nmdc:mga0yw44_76137_c1 nmdc:mga0yw44_76137_c1_767_1798 331
513 3300050507 nmdc:mga05p37_122843_c1 nmdc:mga05p37_122843_c1_1829_2866 331
514 3300050510 nmdc:mga06r32_34834_c1 nmdc:mga06r32_34834_c1_1288_2295 331
515 3300050512 nmdc:mga0n895_150585_c1 nmdc:mga0n895_150585_c1_1241_2260 331
516 3300050514 nmdc:mga08x19_234741_c1 nmdc:mga08x19_234741_c1_56_1075 331
517 3300050515 nmdc:mga0a205_219773_c1 nmdc:mga0a205_219773_c1_424_1446 331
518 3300050515 nmdc:mga0a205_4_c1 nmdc:mga0a205_4_c1_132397_133404 331
519 3300053077 Ga0495601_0000318 Ga0495601_0000318_18470_19480 331
520 3300053077 Ga0495601_0024434 Ga0495601_0024434_2526_3536 331
521 3300053077 Ga0495601_0028110 Ga0495601_0028110_502_1512 331
522 3300053077 Ga0495601_0048712 Ga0495601_0048712_1368_2378 331
523 3300053078 Ga0495612_0000155 Ga0495612_0000155_6179_7195 331
524 3300053078 Ga0495612_0020692 Ga0495612_0020692_575_1585 331
525 3300053084 Ga0495595_0000378 Ga0495595_0000378_303_1313 331
526 3300053084 Ga0495595_0058305 Ga0495595_0058305_383_1393 331
527 3300053085 Ga0495619_0000346 Ga0495619_0000346_4362_5372 331
528 3300053085 Ga0495619_0006101 Ga0495619_0006101_3236_4246 331
529 3300053085 Ga0495619_0039095 Ga0495619_0039095_1835_2845 331
530 3300053085 Ga0495619_0127908 Ga0495619_0127908_553_1563 331
531 3300053123 Ga0500614_001618 Ga0500614_001618_1819_2829 331
532 3300005842 Ga0068858_100000046 Ga0068858_10000004680 332
533 3300005985 Ga0081539_10000776 Ga0081539_1000077634 332
534 3300026035 Ga0207703_10000042 Ga0207703_1000004245 332
535 3300037418 Ga0395900_0146668 Ga0395900_0146668_885_1895 332
536 3300046660 Ga0495625_0000243 Ga0495625_0000243_82069_83082 332
537 3300049741 Ga0501079_0080196 Ga0501079_0080196_300_1322 332
538 3300060353 Ga0501082_0187661 Ga0501082_0187661_458_1483 332
539 3300005937 Ga0081455_10009497 Ga0081455_100094975 333
540 3300005937 Ga0081455_10113472 Ga0081455_101134722 333
541 3300006844 Ga0075428_100024481 Ga0075428_1000244816 333
542 3300006846 Ga0075430_100019608 Ga0075430_1000196083 333
543 3300046463 Ga0495653_0077145 Ga0495653_0077145_389_1414 333
544 3300046516 Ga0495628_0243944 Ga0495628_0243944_116_1138 333
545 3300050509 nmdc:mga0qj67_84895_c1 nmdc:mga0qj67_84895_c1_341_1357 333
546 3300046511 Ga0495608_0018918 Ga0495608_0018918_1682_2710 335
547 3300000549 LJQas_1006601 LJQas_10066012 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

155

234

0.89

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

12

305

0.87

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

56

288

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.907 9 316
3zdn-assembly2.cif.gz_D d11-c mutant of monoamine oxidase from aspergillus niger 0.899 9 40
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.8978 9 316
5mh4-assembly1.cif.gz_A crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) 0.8907 11 316
4up3-assembly1.cif.gz_B crystal structure of the mutant c140s,c286q thioredoxin reductase from entamoeba histolytica 0.886 9 316
ID Description Score Start End Superfamily
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9879 123 247 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9808 123 247 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.98 123 247 3.50.50.60
4zn0C02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9748 123 247 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9725 123 247 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3C0YJU2-F1-model_v4 deleted 0.9932 141 207
AF-A0A6B3EPH4-F1-model_v4 FAD-dependent oxidoreductase 0.9846 119 233 GO:0016668
AF-A0A6N6X486-F1-model_v4 deleted 0.9573 119 243
AF-A0A3D5UWY6-F1-model_v4 Thioredoxin-disulfide reductase 0.9565 148 238 GO:0016491
AF-A0A2H9SVM5-F1-model_v4 Thioredoxin-disulfide reductase 0.9492 8 314 GO:0016491

Feature Viewer

pLDDT pTM Quality
89.05 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map