F462008

General Info

Members Datasets Scaffolds Average Seq Length
546 243 545 337

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10201979|Ga0207428_102019792
Length 325
Sequence MIVIQAHDLTKRYRVAKKREGIGGAIIDLFRPRHEMLNAVNGVSFSLERGEMVGYIGANGAGKSTTIKMLTGILTPTSGEILVNGYVPSKERRAYTRTIGAVFGQRTQLWWDIAVIESLKLLKKIYEVPDDVYREQMKDFLSQPVRTLSLGQRMRCDLAAALLHRPSIVFLDEPTIGLDVVSKENIRRFLRRVNEELKTTVILTTHDLGDIEQLCRRVIVIDQGKILYDGDLAGLKKSTGDIARLRVEIRGEDGGELLARATNGVPIEWKRIGPGLYEGEFPKDSTSVADVVRRIVTDAPVHDLAVLEPPIEEVVRKIYRREIAL

Samples

Sample ID Description Type Environment
1 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
240 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
241 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 5.68
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000009 3300000545 Bacteria 42024
2 JGI24737J22298_10050373 3300001990 Bacteria 1266
3 JGI24743J22301_10001127 3300001991 Bacteria 3584
4 JGI24033J26618_1000063 3300002155 Bacteria 15592
5 rootH2_10005428 3300003320 Bacteria 3373
6 rootH2_10006650 3300003320 Bacteria 18133
7 rootH2_10016401 3300003320 Bacteria 7400
8 rootL2_10043152 3300003322 Bacteria 16356
9 rootH1_10025348 3300003323 Bacteria 15775
10 JGI25404J52841_10001788 3300003659 Bacteria 3896
11 Ga0055530_10010894 3300003791 Bacteria 3312
12 Ga0065704_10005956 3300005289 Bacteria 4752
13 Ga0065704_10018270 3300005289 Bacteria 3396
14 Ga0065704_10110450 3300005289 Bacteria 1960
15 Ga0065704_10209150 3300005289 Bacteria 1115
16 Ga0065712_10002047 3300005290 Bacteria 4929
17 Ga0065712_10004529 3300005290 Bacteria 3195
18 Ga0065712_10089630 3300005290 Bacteria 2461
19 Ga0065712_10092062 3300005290 Bacteria 2346
20 Ga0065712_10110450 3300005290 Bacteria 1836
21 Ga0065715_10008361 3300005293 Bacteria 6657
22 Ga0065715_10091931 3300005293 Bacteria 5450
23 Ga0065715_10099155 3300005293 Bacteria 3451
24 Ga0065715_10127476 3300005293 Bacteria 2086
25 Ga0065715_10159950 3300005293 Bacteria 1639
26 Ga0065707_10113797 3300005295 Bacteria 2312
27 Ga0070658_10010667 3300005327 Bacteria 7363
28 Ga0070658_10172350 3300005327 Bacteria 1818
29 Ga0070676_10074588 3300005328 Bacteria 2044
30 Ga0070676_10202940 3300005328 Bacteria 1301
31 Ga0070683_100077013 3300005329 Bacteria 3118
32 Ga0070683_100134048 3300005329 Bacteria 2345
33 Ga0070683_100167155 3300005329 Bacteria 2087
34 Ga0070690_100087288 3300005330 Unclassified 2048
35 Ga0070690_100144709 3300005330 Bacteria 1616
36 Ga0070670_100006070 3300005331 Bacteria 10217
37 Ga0070670_100155829 3300005331 Bacteria 1978
38 Ga0070677_10091281 3300005333 Bacteria 1325
39 Ga0070666_10034276 3300005335 Bacteria 3365
40 Ga0070666_10035080 3300005335 Bacteria 3325
41 Ga0070680_100069990 3300005336 Bacteria 2882
42 Ga0070680_100292079 3300005336 Bacteria 1382
43 Ga0068868_100023781 3300005338 Bacteria 4640
44 Ga0068868_100038723 3300005338 Bacteria 3701
45 Ga0070689_100023688 3300005340 Bacteria 4599
46 Ga0070689_100036215 3300005340 Bacteria 3773
47 Ga0070689_100078245 3300005340 Bacteria 2593
48 Ga0070687_100073720 3300005343 Unclassified 1841
49 Ga0070661_100000788 3300005344 Bacteria 22747
50 Ga0070661_100008265 3300005344 Bacteria 7184
51 Ga0070661_100181409 3300005344 Bacteria 1602
52 Ga0070668_100001931 3300005347 Bacteria 15135
53 Ga0070668_100052358 3300005347 Bacteria 3146
54 Ga0070669_100036447 3300005353 Bacteria 3564
55 Ga0070669_100045734 3300005353 Bacteria 3190
56 Ga0070669_100104198 3300005353 Bacteria 2144
57 Ga0070669_100175551 3300005353 Bacteria 1673
58 Ga0070675_100001426 3300005354 Bacteria 17559
59 Ga0070675_100303742 3300005354 Bacteria 1406
60 Ga0070675_100437990 3300005354 Bacteria 1171
61 Ga0070671_100010298 3300005355 Bacteria 7502
62 Ga0070671_100024517 3300005355 Bacteria 4939
63 Ga0070671_100175541 3300005355 Unclassified 1813
64 Ga0070674_100011159 3300005356 Bacteria 5457
65 Ga0070674_100011784 3300005356 Bacteria 5337
66 Ga0070673_100005630 3300005364 Bacteria 8040
67 Ga0070688_100005067 3300005365 Bacteria 6906
68 Ga0070688_100031651 3300005365 Bacteria 3184
69 Ga0070688_100079916 3300005365 Bacteria 2114
70 Ga0070659_100006359 3300005366 Bacteria 8531
71 Ga0070659_100311642 3300005366 Unclassified 1314
72 Ga0070709_10113801 3300005434 Bacteria 1822
73 Ga0070714_100219283 3300005435 Bacteria 1747
74 Ga0070714_100223906 3300005435 Bacteria 1730
75 Ga0070714_100229730 3300005435 Unclassified 1709
76 Ga0070713_100002205 3300005436 Bacteria 12619
77 Ga0070713_100010603 3300005436 Bacteria 6666
78 Ga0070710_10020816 3300005437 Bacteria 3409
79 Ga0070710_10068336 3300005437 Unclassified 2041
80 Ga0070711_100009047 3300005439 Bacteria 6116
81 Ga0070711_100081017 3300005439 Bacteria 2312
82 Ga0070705_100014022 3300005440 Bacteria 4113
83 Ga0070705_100098276 3300005440 Bacteria 1842
84 Ga0070705_100209464 3300005440 Bacteria 1343
85 Ga0070700_100003873 3300005441 Bacteria 7768
86 Ga0070708_100013304 3300005445 Bacteria 6734
87 Ga0070708_100016953 3300005445 Bacteria 6060
88 Ga0070708_100021827 3300005445 Bacteria 5421
89 Ga0070708_100101511 3300005445 Unclassified 2635
90 Ga0070708_100131620 3300005445 Bacteria 2315
91 Ga0070708_100253799 3300005445 Bacteria 1652
92 Ga0070663_100013988 3300005455 Bacteria 5138
93 Ga0070678_100054406 3300005456 Bacteria 2916
94 Ga0070678_100078967 3300005456 Bacteria 2487
95 Ga0070678_100080474 3300005456 Bacteria 2467
96 Ga0070678_100089327 3300005456 Bacteria 2358
97 Ga0070662_100117808 3300005457 Bacteria 2032
98 Ga0070681_10055781 3300005458 Bacteria 3933
99 Ga0070681_10152872 3300005458 Bacteria 2234
100 Ga0070681_10379759 3300005458 Bacteria 1324
101 Ga0068867_100075612 3300005459 Unclassified 2527
102 Ga0070685_10062305 3300005466 Bacteria 2187
103 Ga0070706_100000486 3300005467 Bacteria 46746
104 Ga0070706_100000682 3300005467 Bacteria 38464
105 Ga0070706_100020767 3300005467 Bacteria 6047
106 Ga0070706_100050788 3300005467 Bacteria 3827
107 Ga0070706_100055019 3300005467 Bacteria 3673
108 Ga0070706_100057677 3300005467 Bacteria 3584
109 Ga0070706_100081188 3300005467 Bacteria 3003
110 Ga0070706_100083158 3300005467 Bacteria 2965
111 Ga0070706_100089070 3300005467 Bacteria 2861
112 Ga0070706_100204596 3300005467 Bacteria 1844
113 Ga0070706_100235119 3300005467 Unclassified 1711
114 Ga0070707_100000439 3300005468 Bacteria 41289
115 Ga0070707_100016084 3300005468 Bacteria 7019
116 Ga0070707_100027295 3300005468 Bacteria 5432
117 Ga0070707_100042472 3300005468 Bacteria 4353
118 Ga0070707_100061615 3300005468 Bacteria 3599
119 Ga0070707_100085073 3300005468 Bacteria 3056
120 Ga0070707_100125199 3300005468 Bacteria 2496
121 Ga0070707_100150068 3300005468 Bacteria 2269
122 Ga0070698_100001910 3300005471 Bacteria 23223
123 Ga0070698_100001955 3300005471 Bacteria 22884
124 Ga0070698_100002836 3300005471 Bacteria 19067
125 Ga0070698_100015938 3300005471 Bacteria 7936
126 Ga0070698_100071646 3300005471 Bacteria 3475
127 Ga0070698_100101532 3300005471 Bacteria 2848
128 Ga0070698_100229660 3300005471 Bacteria 1789
129 Ga0070699_100046511 3300005518 Bacteria 3754
130 Ga0070699_100152415 3300005518 Bacteria 2045
131 Ga0070679_100096098 3300005530 Bacteria 2950
132 Ga0070684_100000867 3300005535 Bacteria 21400
133 Ga0070684_100005822 3300005535 Bacteria 9483
134 Ga0070684_100217013 3300005535 Unclassified 1745
135 Ga0070697_100000863 3300005536 Bacteria 22791
136 Ga0070697_100001033 3300005536 Bacteria 21037
137 Ga0070697_100002512 3300005536 Bacteria 14111
138 Ga0070697_100008554 3300005536 Bacteria 7993
139 Ga0070697_100041927 3300005536 Bacteria 3705
140 Ga0070697_100042181 3300005536 Bacteria 3692
141 Ga0070697_100047090 3300005536 Bacteria 3497
142 Ga0070697_100092839 3300005536 Bacteria 2498
143 Ga0070697_100097846 3300005536 Bacteria 2435
144 Ga0070697_100121632 3300005536 Bacteria 2184
145 Ga0070697_100189869 3300005536 Bacteria 1743
146 Ga0070697_100266370 3300005536 Bacteria 1468
147 Ga0068853_100000019 3300005539 Bacteria 163178
148 Ga0070672_100004102 3300005543 Bacteria 9511
149 Ga0070672_100017190 3300005543 Bacteria 5201
150 Ga0070672_100182741 3300005543 Bacteria 1748
151 Ga0070686_100016315 3300005544 Unclassified 4318
152 Ga0070695_100047723 3300005545 Bacteria 2736
153 Ga0070696_100016980 3300005546 Bacteria 4910
154 Ga0070665_100000045 3300005548 Bacteria 275023
155 Ga0070665_100044076 3300005548 Bacteria 4480
156 Ga0070665_100061296 3300005548 Bacteria 3770
157 Ga0070665_100082822 3300005548 Bacteria 3213
158 Ga0070665_100093570 3300005548 Unclassified 3011
159 Ga0070665_100117564 3300005548 Bacteria 2661
160 Ga0070665_100330318 3300005548 Bacteria 1529
161 Ga0070704_100003377 3300005549 Bacteria 9155
162 Ga0070704_100098571 3300005549 Unclassified 2196
163 Ga0070664_100133864 3300005564 Bacteria 2178
164 Ga0070664_100366233 3300005564 Bacteria 1313
165 Ga0068856_100000034 3300005614 Bacteria 124288
166 Ga0068856_100037919 3300005614 Bacteria 4730
167 Ga0070702_100058211 3300005615 Bacteria 2238
168 Ga0068852_100115316 3300005616 Bacteria 2449
169 Ga0068863_100055186 3300005841 Bacteria 3763
170 Ga0068863_100102701 3300005841 Bacteria 2719
171 Ga0068863_100196370 3300005841 Bacteria 1940
172 Ga0068858_100014527 3300005842 Bacteria 7418
173 Ga0068858_100042252 3300005842 Bacteria 4227
174 Ga0068858_100050555 3300005842 Bacteria 3847
175 Ga0068858_100079108 3300005842 Bacteria 3055
176 Ga0068858_100145821 3300005842 Bacteria 2223
177 Ga0068860_100000267 3300005843 Bacteria 76469
178 Ga0068860_100007230 3300005843 Bacteria 11100
179 Ga0068860_100424984 3300005843 Bacteria 1318
180 Ga0081455_10000647 3300005937 Bacteria 45079
181 Ga0081455_10004485 3300005937 Bacteria 15617
182 Ga0081455_10006460 3300005937 Bacteria 12563
183 Ga0081455_10009604 3300005937 Bacteria 9935
184 Ga0081455_10036756 3300005937 Bacteria 4356
185 Ga0081455_10133291 3300005937 Bacteria 1939
186 Ga0081538_10089434 3300005981 Bacteria 1598
187 Ga0081540_1000014 3300005983 Bacteria 179266
188 Ga0081540_1009067 3300005983 Bacteria 6874
189 Ga0081540_1018113 3300005983 Bacteria 4334
190 Ga0081539_10000026 3300005985 Bacteria 330830
191 Ga0081539_10001918 3300005985 Bacteria 32176
192 Ga0081539_10018211 3300005985 Bacteria 4887
193 Ga0081539_10024423 3300005985 Bacteria 3921
194 Ga0070717_10000722 3300006028 Bacteria 21468
195 Ga0070717_10022602 3300006028 Bacteria 4971
196 Ga0070717_10025634 3300006028 Bacteria 4692
197 Ga0070717_10105109 3300006028 Bacteria 2403
198 Ga0070717_10143990 3300006028 Bacteria 2057
199 Ga0070717_10208540 3300006028 Bacteria 1714
200 Ga0070715_10064642 3300006163 Bacteria 1617
201 Ga0070716_100022413 3300006173 Bacteria 3338
202 Ga0070716_100022474 3300006173 Unclassified 3334
203 Ga0070712_100012423 3300006175 Bacteria 5414
204 Ga0070712_100111713 3300006175 Bacteria 2041
205 Ga0070712_100271488 3300006175 Bacteria 1363
206 Ga0097621_100095912 3300006237 Bacteria 2488
207 Ga0097621_100166811 3300006237 Bacteria 1896
208 Ga0068871_100004871 3300006358 Bacteria 9378
209 Ga0068871_100116582 3300006358 Bacteria 2252
210 Ga0075434_100152428 3300006871 Bacteria 2332
211 Ga0075434_100215594 3300006871 Bacteria 1939
212 Ga0068865_100051332 3300006881 Bacteria 2854
213 Ga0068865_100100784 3300006881 Bacteria 2114
214 Ga0075436_100020242 3300006914 Bacteria 4566
215 Ga0099795_10042549 3300007788 Unclassified 1622
216 Ga0105240_10000043 3300009093 Bacteria 254256
217 Ga0105240_10051315 3300009093 Bacteria 5192
218 Ga0111539_10099327 3300009094 Bacteria 3418
219 Ga0105245_10120109 3300009098 Bacteria 2454
220 Ga0105245_10349057 3300009098 Bacteria 1465
221 Ga0105245_10436561 3300009098 Bacteria 1315
222 Ga0105245_10502662 3300009098 Bacteria 1228
223 Ga0105247_10054966 3300009101 Unclassified 2457
224 Ga0114129_10000103 3300009147 Bacteria 83612
225 Ga0114129_10035429 3300009147 Bacteria 7050
226 Ga0114129_10374906 3300009147 Bacteria 1880
227 Ga0105241_10201501 3300009174 Bacteria 1662
228 Ga0105242_10029291 3300009176 Bacteria 4390
229 Ga0105248_10333253 3300009177 Bacteria 1709
230 Ga0105237_10001748 3300009545 Bacteria 28071
231 Ga0105237_10188280 3300009545 Bacteria 2064
232 Ga0105237_10288777 3300009545 Bacteria 1643
233 Ga0105238_10044916 3300009551 Bacteria 4465
234 Ga0105249_10024448 3300009553 Bacteria 5429
235 Ga0105249_10237894 3300009553 Bacteria 1799
236 Ga0105239_10551247 3300010375 Bacteria 1313
237 Ga0157371_10038347 3300013102 Bacteria 3429
238 Ga0157374_10000057 3300013296 Bacteria 117036
239 Ga0157374_10004496 3300013296 Bacteria 11716
240 Ga0157374_10007233 3300013296 Bacteria 9458
241 Ga0157374_10037911 3300013296 Bacteria 4428
242 Ga0157374_10044145 3300013296 Bacteria 4120
243 Ga0157374_10081132 3300013296 Bacteria 3078
244 Ga0157374_10087899 3300013296 Bacteria 2959
245 Ga0157374_10176713 3300013296 Bacteria 2084
246 Ga0157374_10201975 3300013296 Unclassified 1947
247 Ga0157378_10018503 3300013297 Bacteria 6122
248 Ga0157378_10024006 3300013297 Bacteria 5364
249 Ga0157378_10054393 3300013297 Bacteria 3564
250 Ga0157378_10068364 3300013297 Bacteria 3186
251 Ga0157378_10071172 3300013297 Bacteria 3123
252 Ga0157378_10078171 3300013297 Bacteria 2984
253 Ga0157378_10112062 3300013297 Bacteria 2502
254 Ga0157378_10229860 3300013297 Bacteria 1767
255 Ga0163162_10025378 3300013306 Bacteria 5855
256 Ga0163162_10047251 3300013306 Bacteria 4314
257 Ga0163162_10060882 3300013306 Bacteria 3812
258 Ga0163162_10144190 3300013306 Unclassified 2496
259 Ga0163162_10602761 3300013306 Bacteria 1224
260 Ga0157372_10057724 3300013307 Bacteria 4339
261 Ga0157372_10112022 3300013307 Bacteria 3126
262 Ga0157375_10008603 3300013308 Bacteria 8936
263 Ga0157375_10010745 3300013308 Bacteria 8068
264 Ga0157375_10023425 3300013308 Bacteria 5697
265 Ga0157375_10064562 3300013308 Bacteria 3645
266 Ga0157375_10176708 3300013308 Unclassified 2285
267 Ga0157375_10179016 3300013308 Bacteria 2271
268 Ga0157375_10297905 3300013308 Bacteria 1776
269 Ga0157375_10719957 3300013308 Bacteria 1151
270 Ga0157377_10028407 3300014745 Bacteria 3010
271 Ga0157379_10000955 3300014968 Bacteria 23432
272 Ga0157376_10000167 3300014969 Bacteria 45629
273 Ga0157376_10023967 3300014969 Bacteria 4787
274 Ga0157376_10321217 3300014969 Bacteria 1472
275 Ga0163161_10001720 3300017792 Bacteria 16042
276 Ga0213872_10003443 3300021361 Bacteria 8796
277 Ga0213872_10016774 3300021361 Unclassified 3396
278 Ga0213872_10040464 3300021361 Unclassified 2128
279 Ga0213872_10071725 3300021361 Bacteria 1561
280 Ga0213872_10072238 3300021361 Bacteria 1554
281 Ga0213876_10000436 3300021384 Bacteria 34060
282 Ga0213876_10015249 3300021384 Bacteria 4070
283 Ga0213876_10033943 3300021384 Bacteria 2690
284 Ga0207666_1000551 3300025271 Bacteria 4547
285 Ga0207673_1001689 3300025290 Bacteria 2440
286 Ga0209050_1001026 3300025298 Bacteria 34801
287 Ga0207697_10000711 3300025315 Bacteria 18972
288 Ga0207697_10001019 3300025315 Bacteria 15693
289 Ga0207697_10001026 3300025315 Bacteria 15584
290 Ga0207697_10002216 3300025315 Bacteria 10156
291 Ga0207697_10006343 3300025315 Bacteria 5362
292 Ga0207697_10011392 3300025315 Bacteria 3762
293 Ga0207697_10035311 3300025315 Bacteria 2046
294 Ga0207697_10038616 3300025315 Bacteria 1958
295 Ga0207697_10057290 3300025315 Unclassified 1617
296 Ga0207647_10022787 3300025904 Bacteria 4154
297 Ga0207699_10006262 3300025906 Bacteria 5749
298 Ga0207645_10007467 3300025907 Bacteria 7718
299 Ga0207645_10025105 3300025907 Bacteria 3859
300 Ga0207705_10010015 3300025909 Bacteria 6900
301 Ga0207684_10000732 3300025910 Bacteria 38532
302 Ga0207684_10000736 3300025910 Bacteria 38478
303 Ga0207684_10022277 3300025910 Bacteria 5409
304 Ga0207684_10023202 3300025910 Bacteria 5299
305 Ga0207684_10030132 3300025910 Bacteria 4620
306 Ga0207684_10034250 3300025910 Bacteria 4316
307 Ga0207684_10056115 3300025910 Bacteria 3341
308 Ga0207684_10078986 3300025910 Bacteria 2799
309 Ga0207684_10086660 3300025910 Bacteria 2667
310 Ga0207684_10289926 3300025910 Bacteria 1411
311 Ga0207707_10441752 3300025912 Bacteria 1114
312 Ga0207695_10000181 3300025913 Bacteria 185042
313 Ga0207695_10037840 3300025913 Bacteria 5202
314 Ga0207671_10101182 3300025914 Bacteria 2183
315 Ga0207693_10000519 3300025915 Bacteria 34790
316 Ga0207693_10012437 3300025915 Bacteria 6877
317 Ga0207693_10041825 3300025915 Unclassified 3607
318 Ga0207693_10061905 3300025915 Bacteria 2931
319 Ga0207693_10358224 3300025915 Bacteria 1141
320 Ga0207663_10017524 3300025916 Bacteria 3993
321 Ga0207663_10156417 3300025916 Unclassified 1604
322 Ga0207657_10059524 3300025919 Bacteria 3281
323 Ga0207649_10001293 3300025920 Bacteria 14940
324 Ga0207649_10118906 3300025920 Bacteria 1778
325 Ga0207652_10124191 3300025921 Bacteria 2298
326 Ga0207652_10141814 3300025921 Bacteria 2149
327 Ga0207652_10508632 3300025921 Bacteria 1084
328 Ga0207646_10000358 3300025922 Bacteria 61519
329 Ga0207646_10000504 3300025922 Bacteria 52235
330 Ga0207646_10019070 3300025922 Bacteria 6382
331 Ga0207646_10069243 3300025922 Bacteria 3151
332 Ga0207646_10080185 3300025922 Bacteria 2919
333 Ga0207646_10113637 3300025922 Bacteria 2431
334 Ga0207646_10117084 3300025922 Bacteria 2393
335 Ga0207646_10157121 3300025922 Bacteria 2051
336 Ga0207646_10164142 3300025922 Bacteria 2005
337 Ga0207646_10199480 3300025922 Bacteria 1807
338 Ga0207646_10348454 3300025922 Bacteria 1338
339 Ga0207681_10036357 3300025923 Bacteria 3249
340 Ga0207681_10185972 3300025923 Bacteria 1586
341 Ga0207659_10006886 3300025926 Bacteria 6990
342 Ga0207659_10023427 3300025926 Bacteria 4120
343 Ga0207659_10039321 3300025926 Bacteria 3298
344 Ga0207659_10095941 3300025926 Bacteria 2225
345 Ga0207659_10113072 3300025926 Bacteria 2067
346 Ga0207659_10301977 3300025926 Bacteria 1315
347 Ga0207687_10166765 3300025927 Bacteria 1695
348 Ga0207700_10039694 3300025928 Bacteria 3429
349 Ga0207700_10219714 3300025928 Unclassified 1610
350 Ga0207664_10194683 3300025929 Bacteria 1747
351 Ga0207644_10029901 3300025931 Bacteria 3782
352 Ga0207644_10032104 3300025931 Bacteria 3661
353 Ga0207644_10091874 3300025931 Bacteria 2264
354 Ga0207644_10093635 3300025931 Unclassified 2243
355 Ga0207644_10310470 3300025931 Bacteria 1273
356 Ga0207644_10402378 3300025931 Bacteria 1119
357 Ga0207706_10008411 3300025933 Bacteria 9522
358 Ga0207706_10012445 3300025933 Bacteria 7752
359 Ga0207706_10025875 3300025933 Bacteria 5255
360 Ga0207706_10157172 3300025933 Bacteria 1999
361 Ga0207670_10033258 3300025936 Bacteria 3321
362 Ga0207670_10158742 3300025936 Unclassified 1686
363 Ga0207669_10013374 3300025937 Bacteria 4072
364 Ga0207669_10020170 3300025937 Bacteria 3488
365 Ga0207669_10186104 3300025937 Bacteria 1493
366 Ga0207704_10041027 3300025938 Bacteria 2710
367 Ga0207665_10002889 3300025939 Bacteria 11524
368 Ga0207665_10076280 3300025939 Bacteria 2298
369 Ga0207665_10120287 3300025939 Bacteria 1854
370 Ga0207665_10304853 3300025939 Bacteria 1191
371 Ga0207691_10010431 3300025940 Bacteria 8914
372 Ga0207691_10028541 3300025940 Bacteria 5224
373 Ga0207691_10153220 3300025940 Bacteria 2026
374 Ga0207691_10228090 3300025940 Bacteria 1613
375 Ga0207691_10421093 3300025940 Bacteria 1138
376 Ga0207711_10310151 3300025941 Bacteria 1457
377 Ga0207661_10086125 3300025944 Bacteria 2606
378 Ga0207661_10090864 3300025944 Bacteria 2543
379 Ga0207679_10121424 3300025945 Bacteria 2081
380 Ga0207651_10030013 3300025960 Bacteria 3455
381 Ga0207651_10062025 3300025960 Bacteria 2603
382 Ga0207651_10273957 3300025960 Bacteria 1391
383 Ga0207712_10082106 3300025961 Bacteria 2349
384 Ga0207668_10021116 3300025972 Bacteria 4149
385 Ga0207677_10038703 3300026023 Bacteria 3129
386 Ga0207677_10214718 3300026023 Bacteria 1539
387 Ga0207677_10239180 3300026023 Bacteria 1468
388 Ga0207677_10290301 3300026023 Bacteria 1347
389 Ga0207703_10003475 3300026035 Bacteria 13192
390 Ga0207703_10021358 3300026035 Bacteria 5068
391 Ga0207703_10042374 3300026035 Bacteria 3651
392 Ga0207703_10092542 3300026035 Bacteria 2545
393 Ga0207639_10000032 3300026041 Bacteria 163200
394 Ga0207678_10009556 3300026067 Bacteria 8530
395 Ga0207678_10260615 3300026067 Bacteria 1486
396 Ga0207708_10003639 3300026075 Bacteria 11369
397 Ga0207702_10001213 3300026078 Bacteria 26152
398 Ga0207641_10025943 3300026088 Bacteria 4835
399 Ga0207641_10044372 3300026088 Bacteria 3739
400 Ga0207648_10046947 3300026089 Bacteria 3786
401 Ga0207675_100042959 3300026118 Bacteria 4221
402 Ga0207683_10002403 3300026121 Bacteria 16353
403 Ga0207683_10006136 3300026121 Bacteria 10295
404 Ga0207683_10010617 3300026121 Bacteria 7854
405 Ga0207683_10034825 3300026121 Bacteria 4378
406 Ga0207683_10039296 3300026121 Bacteria 4128
407 Ga0207683_10087370 3300026121 Bacteria 2773
408 Ga0207428_10201979 3300027907 Bacteria 1495
409 Ga0268266_10000035 3300028379 Bacteria 351632
410 Ga0268266_10005284 3300028379 Bacteria 12125
411 Ga0268266_10104972 3300028379 Bacteria 2495
412 Ga0268264_10000357 3300028381 Bacteria 68576
413 Ga0268264_10015640 3300028381 Bacteria 6214
414 Ga0307405_10000705 3300031731 Bacteria 12985
415 Ga0307410_10005922 3300031852 Bacteria 6536
416 Ga0307406_10004526 3300031901 Bacteria 7572
417 Ga0307407_10000488 3300031903 Bacteria 12215
418 Ga0307412_10012198 3300031911 Bacteria 4997
419 Ga0307409_100002090 3300031995 Bacteria 10270
420 Ga0307409_100045942 3300031995 Bacteria 3302
421 Ga0307409_100085208 3300031995 Bacteria 2568
422 Ga0307416_100001096 3300032002 Bacteria 14491
423 Ga0307414_10003838 3300032004 Bacteria 8088
424 Ga0307411_10000856 3300032005 Bacteria 11439
425 Ga0307415_100038346 3300032126 Bacteria 3157
426 Ga0373936_0029733 3300035113 Bacteria 2152
427 Ga0373957_0042064 3300035120 Bacteria 1723
428 Ga0373946_0030606 3300035171 Bacteria 2150
429 Ga0373955_0013148 3300035172 Bacteria 3993
430 Ga0373935_0029415 3300035692 Unclassified 3401
431 Ga0373937_0356522 3300036401 Bacteria 1386
432 Ga0373925_0145570 3300037068 Bacteria 1857
433 Ga0373925_0155570 3300037068 Unclassified 1798
434 Ga0395899_0000032 3300037312 Bacteria 312705
435 Ga0395899_0063447 3300037312 Bacteria 2718
436 Ga0395900_0021221 3300037418 Bacteria 6641
437 Ga0395900_0093654 3300037418 Bacteria 3086
438 Ga0395900_0177328 3300037418 Bacteria 2167
439 Ga0395898_0000562 3300037466 Bacteria 69459
440 Ga0395898_0009649 3300037466 Bacteria 10134
441 Ga0395905_0047592 3300037471 Bacteria 4018
442 Ga0436364_0757601 3300037853 Bacteria 2902
443 Ga0395901_0023212 3300038443 Bacteria 6359
444 Ga0395901_0078520 3300038443 Bacteria 3447
445 Ga0436365_0273579 3300039437 Bacteria 2609
446 Ga0436365_0331687 3300039437 Bacteria 2289
447 Ga0436365_0341737 3300039437 Bacteria 3888
448 Ga0436365_1611898 3300039437 Bacteria 31421
449 Ga0436365_1670361 3300039437 Bacteria 34125
450 Ga0436360_0112463 3300039438 Bacteria 3054
451 Ga0436360_0805228 3300039438 Bacteria 7230
452 Ga0436360_1368532 3300039438 Bacteria 2039
453 Ga0436361_0185988 3300039447 Bacteria 4222
454 Ga0436361_0370321 3300039447 Bacteria 2993
455 Ga0436361_0379036 3300039447 Bacteria 3414
456 Ga0436361_0913064 3300039447 Bacteria 4625
457 Ga0436361_0981302 3300039447 Bacteria 4385
458 Ga0436361_1022396 3300039447 Unclassified 1271
459 Ga0436363_0385326 3300039450 Bacteria 21920
460 Ga0436363_0452248 3300039450 Bacteria 2644
461 Ga0439451_013534 3300042009 Bacteria 1649
462 Ga0451577_0001850 3300042876 Bacteria 26973
463 Ga0466965_0002850 3300044683 Bacteria 7459
464 Ga0466964_0074513 3300044706 Bacteria 1443
465 Ga0466971_0000487 3300044719 Bacteria 15562
466 Ga0466957_0009885 3300044842 Bacteria 5456
467 Ga0466957_0024527 3300044842 Bacteria 3569
468 Ga0451576_0025966 3300045051 Bacteria 6305
469 Ga0466967_0065309 3300045976 Bacteria 3239
470 Ga0495592_0002133 3300046454 Bacteria 13918
471 Ga0495603_0154795 3300046455 Bacteria 1331
472 Ga0495651_0198775 3300046462 Bacteria 1405
473 Ga0495628_0001627 3300046516 Bacteria 20557
474 Ga0495643_0000191 3300046522 Bacteria 97250
475 Ga0495652_0010248 3300046529 Bacteria 8498
476 Ga0495652_0169736 3300046529 Bacteria 1685
477 Ga0495586_0082222 3300046535 Bacteria 1771
478 Ga0495645_0035622 3300046543 Unclassified 3627
479 Ga0495588_0041340 3300046674 Bacteria 2354
480 Ga0495599_0018811 3300046678 Unclassified 4305
481 Ga0495623_0020374 3300046679 Bacteria 4285
482 Ga0495658_0140495 3300046683 Unclassified 1477
483 Ga0495669_0010184 3300046684 Bacteria 3970
484 Ga0495613_0112788 3300046689 Unclassified 1958
485 Ga0495674_0190222 3300047319 Bacteria 1706
486 Ga0495675_0003717 3300047444 Bacteria 9221
487 Ga0495684_0014707 3300047471 Bacteria 6024
488 Ga0495602_0032833 3300048088 Unclassified 4881
489 Ga0496100_0054692 3300048903 Unclassified 2604
490 Ga0496101_0003972 3300048904 Bacteria 9255
491 Ga0496101_0116185 3300048904 Bacteria 2019
492 Ga0496101_0223513 3300048904 Bacteria 1462
493 Ga0496103_0008787 3300048906 Bacteria 5994
494 Ga0496104_0024302 3300048907 Bacteria 5574
495 Ga0496105_0021269 3300048908 Bacteria 5250
496 Ga0496105_0042228 3300048908 Bacteria 3759
497 Ga0496106_0023644 3300048909 Bacteria 4565
498 Ga0496106_0133490 3300048909 Bacteria 1948
499 Ga0496107_0004082 3300048910 Bacteria 9836
500 Ga0496107_0181093 3300048910 Unclassified 1565
501 Ga0496109_0055227 3300048912 Bacteria 3623
502 Ga0496109_0114042 3300048912 Bacteria 2514
503 Ga0496109_0117764 3300048912 Bacteria 2473
504 Ga0496109_0208225 3300048912 Bacteria 1839
505 Ga0496109_0292020 3300048912 Bacteria 1537
506 Ga0496110_0068757 3300048913 Bacteria 3135
507 Ga0496110_0275593 3300048913 Bacteria 1532
508 Ga0496112_0007814 3300048915 Bacteria 9520
509 Ga0496112_0042702 3300048915 Bacteria 4437
510 Ga0496112_0058570 3300048915 Bacteria 3794
511 Ga0496112_0077685 3300048915 Bacteria 3283
512 Ga0496112_0108381 3300048915 Bacteria 2748
513 Ga0496114_0012098 3300048917 Bacteria 6905
514 Ga0496114_0123450 3300048917 Bacteria 2229
515 Ga0496115_0004994 3300048918 Bacteria 9635
516 Ga0496115_0007640 3300048918 Bacteria 7965
517 Ga0496115_0088217 3300048918 Bacteria 2532
518 Ga0496115_0095108 3300048918 Bacteria 2438
519 Ga0496115_0155598 3300048918 Bacteria 1889
520 Ga0501031_0004941 3300049568 Bacteria 8667
521 Ga0501032_0003948 3300049569 Bacteria 11255
522 Ga0501033_0000131 3300049570 Bacteria 72998
523 Ga0501033_0000235 3300049570 Bacteria 53367
524 Ga0501036_0123665 3300049572 Bacteria 2185
525 Ga0501037_0000022 3300049573 Bacteria 147056
526 Ga0501038_0013985 3300049574 Bacteria 7313
527 Ga0501038_0032147 3300049574 Bacteria 4631
528 Ga0501043_0001901 3300049579 Bacteria 17895
529 Ga0501043_0009488 3300049579 Bacteria 7632
530 Ga0501047_0028502 3300049581 Bacteria 5384
531 Ga0501070_0000394 3300049586 Bacteria 40082
532 Ga0501075_0356289 3300049591 Bacteria 1115
533 Ga0501081_0158189 3300049743 Bacteria 1631
534 Ga0501035_0000003 3300049822 Bacteria 557461
535 Ga0501044_0000669 3300049823 Bacteria 41390
536 nmdc:mga05p37_192038_c2 3300050507 Bacteria 1314
537 nmdc:mga05p37_3050_c2 3300050507 Bacteria 9900
538 nmdc:mga0n895_236461_c1 3300050512 Bacteria 1854
539 nmdc:mga08x19_8867_c1 3300050514 Bacteria 5999
540 Ga0495601_0001627 3300053077 Bacteria 12367
541 Ga0500556_0002370 3300053104 Bacteria 6116
542 Ga0500594_0031548 3300053118 Bacteria 1398
543 Ga0500642_0042127 3300053130 Bacteria 1978
544 Ga0500616_0004329 3300053153 Bacteria 10170
545 Ga0466962_0000021 3300061719 Bacteria 89078

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10436561 Ga0105245_104365611 271
2 3300048918 Ga0496115_0155598 Ga0496115_0155598_399_1334 295
3 3300013296 Ga0157374_10176713 Ga0157374_101767131 305
4 3300005445 Ga0070708_100131620 Ga0070708_1001316202 307
5 3300005468 Ga0070707_100042472 Ga0070707_1000424725 307
6 3300025922 Ga0207646_10199480 Ga0207646_101994802 307
7 3300009094 Ga0111539_10099327 Ga0111539_100993272 308
8 3300027907 Ga0207428_10201979 Ga0207428_102019792 308
9 3300049579 Ga0501043_0001901 Ga0501043_0001901_404_1330 308
10 3300025315 Ga0207697_10038616 Ga0207697_100386162 309
11 3300044683 Ga0466965_0002850 Ga0466965_0002850_2973_3902 309
12 3300044719 Ga0466971_0000487 Ga0466971_0000487_7160_8089 309
13 3300044842 Ga0466957_0024527 Ga0466957_0024527_605_1534 309
14 3300061719 Ga0466962_0000021 Ga0466962_0000021_51200_52129 309
15 3300005439 Ga0070711_100081017 Ga0070711_1000810172 312
16 3300042876 Ga0451577_0001850 Ga0451577_0001850_3665_4642 313
17 3300046683 Ga0495658_0140495 Ga0495658_0140495_10_960 316
18 3300005467 Ga0070706_100000486 Ga0070706_10000048625 317
19 3300025910 Ga0207684_10000732 Ga0207684_1000073221 317
20 3300005843 Ga0068860_100424984 Ga0068860_1004249842 318
21 3300013296 Ga0157374_10000057 Ga0157374_1000005790 318
22 3300014969 Ga0157376_10000167 Ga0157376_1000016712 318
23 3300006237 Ga0097621_100166811 Ga0097621_1001668111 320
24 3300037312 Ga0395899_0063447 Ga0395899_0063447_218_1186 320
25 iso_pu_bacteria 2786546548 2787508637 321
26 3300005458 Ga0070681_10152872 Ga0070681_101528722 323
27 3300025921 Ga0207652_10141814 Ga0207652_101418142 323
28 3300009545 Ga0105237_10188280 Ga0105237_101882802 324
29 3300053104 Ga0500556_0002370 Ga0500556_0002370_3934_4908 324
30 3300053118 Ga0500594_0031548 Ga0500594_0031548_264_1238 324
31 3300003323 rootH1_10025348 rootH1_100253485 325
32 3300005327 Ga0070658_10172350 Ga0070658_101723502 325
33 3300005539 Ga0068853_100000019 Ga0068853_10000001968 325
34 3300005548 Ga0070665_100000045 Ga0070665_100000045210 325
35 3300005614 Ga0068856_100000034 Ga0068856_10000003415 325
36 3300005842 Ga0068858_100042252 Ga0068858_1000422522 325
37 3300005937 Ga0081455_10133291 Ga0081455_101332912 325
38 3300005981 Ga0081538_10089434 Ga0081538_100894342 325
39 3300005983 Ga0081540_1018113 Ga0081540_10181132 325
40 3300009093 Ga0105240_10051315 Ga0105240_100513153 325
41 3300013306 Ga0163162_10602761 Ga0163162_106027612 325
42 3300025913 Ga0207695_10037840 Ga0207695_100378403 325
43 3300026035 Ga0207703_10003475 Ga0207703_100034759 325
44 3300026041 Ga0207639_10000032 Ga0207639_1000003269 325
45 3300026078 Ga0207702_10001213 Ga0207702_100012134 325
46 3300028379 Ga0268266_10000035 Ga0268266_10000035111 325
47 3300037312 Ga0395899_0000032 Ga0395899_0000032_248900_249877 325
48 3300037466 Ga0395898_0000562 Ga0395898_0000562_49148_50125 325
49 3300044842 Ga0466957_0009885 Ga0466957_0009885_383_1360 325
50 3300046535 Ga0495586_0082222 Ga0495586_0082222_207_1196 325
51 3300003320 rootH2_10016401 rootH2_100164018 326
52 3300005366 Ga0070659_100311642 Ga0070659_1003116421 326
53 3300005842 Ga0068858_100145821 Ga0068858_1001458211 326
54 3300026035 Ga0207703_10092542 Ga0207703_100925424 326
55 3300039447 Ga0436361_0185988 Ga0436361_0185988_2747_3745 326
56 3300005842 Ga0068858_100050555 Ga0068858_1000505551 327
57 3300026035 Ga0207703_10042374 Ga0207703_100423743 327
58 3300031731 Ga0307405_10000705 Ga0307405_100007051 327
59 3300031852 Ga0307410_10005922 Ga0307410_100059222 327
60 3300031901 Ga0307406_10004526 Ga0307406_100045262 327
61 3300031903 Ga0307407_10000488 Ga0307407_1000048810 327
62 3300031911 Ga0307412_10012198 Ga0307412_100121982 327
63 3300031995 Ga0307409_100002090 Ga0307409_1000020905 327
64 3300031995 Ga0307409_100045942 Ga0307409_1000459422 327
65 3300032002 Ga0307416_100001096 Ga0307416_1000010968 327
66 3300032004 Ga0307414_10003838 Ga0307414_100038387 327
67 3300032005 Ga0307411_10000856 Ga0307411_1000085610 327
68 3300039437 Ga0436365_0341737 Ga0436365_0341737_1570_2580 327
69 3300045051 Ga0451576_0025966 Ga0451576_0025966_3399_4382 327
70 3300049568 Ga0501031_0004941 Ga0501031_0004941_570_1559 327
71 3300049572 Ga0501036_0123665 Ga0501036_0123665_263_1252 327
72 3300049573 Ga0501037_0000022 Ga0501037_0000022_66096_67085 327
73 3300049579 Ga0501043_0009488 Ga0501043_0009488_6341_7330 327
74 3300049581 Ga0501047_0028502 Ga0501047_0028502_595_1584 327
75 3300049586 Ga0501070_0000394 Ga0501070_0000394_26468_27457 327
76 3300049822 Ga0501035_0000003 Ga0501035_0000003_539302_540291 327
77 3300049823 Ga0501044_0000669 Ga0501044_0000669_32846_33835 327
78 3300053153 Ga0500616_0004329 Ga0500616_0004329_500_1483 327
79 3300005841 Ga0068863_100102701 Ga0068863_1001027012 329
80 3300026088 Ga0207641_10025943 Ga0207641_100259433 329
81 3300001991 JGI24743J22301_10001127 JGI24743J22301_100011274 330
82 3300005327 Ga0070658_10010667 Ga0070658_100106674 330
83 3300005331 Ga0070670_100155829 Ga0070670_1001558292 330
84 3300005435 Ga0070714_100219283 Ga0070714_1002192831 330
85 3300005436 Ga0070713_100002205 Ga0070713_1000022055 330
86 3300009093 Ga0105240_10000043 Ga0105240_10000043167 330
87 3300013297 Ga0157378_10229860 Ga0157378_102298602 330
88 3300021361 Ga0213872_10016774 Ga0213872_100167743 330
89 3300021361 Ga0213872_10071725 Ga0213872_100717251 330
90 3300021361 Ga0213872_10072238 Ga0213872_100722381 330
91 3300021384 Ga0213876_10015249 Ga0213876_100152492 330
92 3300025909 Ga0207705_10010015 Ga0207705_100100159 330
93 3300025913 Ga0207695_10000181 Ga0207695_10000181116 330
94 3300025929 Ga0207664_10194683 Ga0207664_101946832 330
95 3300039437 Ga0436365_0331687 Ga0436365_0331687_897_1895 330
96 3300039437 Ga0436365_1611898 Ga0436365_1611898_8637_9641 330
97 3300039438 Ga0436360_0805228 Ga0436360_0805228_4327_5334 330
98 3300039438 Ga0436360_1368532 Ga0436360_1368532_173_1180 330
99 3300039447 Ga0436361_0913064 Ga0436361_0913064_2826_3830 330
100 3300039450 Ga0436363_0452248 Ga0436363_0452248_1495_2493 330
101 3300049570 Ga0501033_0000131 Ga0501033_0000131_58188_59219 330
102 3300049574 Ga0501038_0032147 Ga0501038_0032147_1942_2973 330
103 3300053130 Ga0500642_0042127 Ga0500642_0042127_364_1356 330
104 3300003791 Ga0055530_10010894 Ga0055530_100108943 331
105 3300005434 Ga0070709_10113801 Ga0070709_101138011 331
106 3300005436 Ga0070713_100010603 Ga0070713_1000106032 331
107 3300005437 Ga0070710_10020816 Ga0070710_100208162 331
108 3300005445 Ga0070708_100013304 Ga0070708_1000133044 331
109 3300005467 Ga0070706_100083158 Ga0070706_1000831581 331
110 3300005471 Ga0070698_100001910 Ga0070698_1000019109 331
111 3300005471 Ga0070698_100001955 Ga0070698_1000019553 331
112 3300005536 Ga0070697_100041927 Ga0070697_1000419275 331
113 3300005536 Ga0070697_100092839 Ga0070697_1000928392 331
114 3300006028 Ga0070717_10022602 Ga0070717_100226024 331
115 3300006028 Ga0070717_10208540 Ga0070717_102085402 331
116 3300007788 Ga0099795_10042549 Ga0099795_100425491 331
117 3300013307 Ga0157372_10057724 Ga0157372_100577242 331
118 3300021361 Ga0213872_10003443 Ga0213872_100034433 331
119 3300025298 Ga0209050_1001026 Ga0209050_10010263 331
120 3300025906 Ga0207699_10006262 Ga0207699_100062624 331
121 3300025910 Ga0207684_10056115 Ga0207684_100561152 331
122 3300025910 Ga0207684_10086660 Ga0207684_100866602 331
123 3300025928 Ga0207700_10039694 Ga0207700_100396942 331
124 3300025939 Ga0207665_10076280 Ga0207665_100762802 331
125 3300039447 Ga0436361_0981302 Ga0436361_0981302_1947_2966 331
126 3300039450 Ga0436363_0385326 Ga0436363_0385326_18904_19923 331
127 3300038443 Ga0395901_0023212 Ga0395901_0023212_1590_2591 332
128 3300039438 Ga0436360_0112463 Ga0436360_0112463_14_1036 332
129 3300039447 Ga0436361_1022396 Ga0436361_1022396_33_1037 332
130 3300002155 JGI24033J26618_1000063 JGI24033J26618_100006313 333
131 3300003320 rootH2_10006650 rootH2_100066509 333
132 3300003322 rootL2_10043152 rootL2_1004315212 333
133 3300005344 Ga0070661_100000788 Ga0070661_10000078815 333
134 3300005456 Ga0070678_100089327 Ga0070678_1000893272 333
135 3300009551 Ga0105238_10044916 Ga0105238_100449161 333
136 3300013296 Ga0157374_10044145 Ga0157374_100441453 333
137 3300013308 Ga0157375_10179016 Ga0157375_101790163 333
138 3300021384 Ga0213876_10033943 Ga0213876_100339432 333
139 3300025920 Ga0207649_10001293 Ga0207649_1000129310 333
140 3300026121 Ga0207683_10087370 Ga0207683_100873703 333
141 3300039437 Ga0436365_0273579 Ga0436365_0273579_1378_2403 333
142 3300046522 Ga0495643_0000191 Ga0495643_0000191_62714_63727 333
143 3300049569 Ga0501032_0003948 Ga0501032_0003948_2397_3398 333
144 3300049570 Ga0501033_0000235 Ga0501033_0000235_8080_9081 333
145 3300049574 Ga0501038_0013985 Ga0501038_0013985_5912_6913 333
146 3300005289 Ga0065704_10005956 Ga0065704_100059563 334
147 3300005290 Ga0065712_10092062 Ga0065712_100920623 334
148 3300005293 Ga0065715_10008361 Ga0065715_100083618 334
149 3300005330 Ga0070690_100087288 Ga0070690_1000872883 334
150 3300005338 Ga0068868_100038723 Ga0068868_1000387235 334
151 3300005343 Ga0070687_100073720 Ga0070687_1000737202 334
152 3300005347 Ga0070668_100001931 Ga0070668_1000019314 334
153 3300005353 Ga0070669_100045734 Ga0070669_1000457341 334
154 3300005437 Ga0070710_10068336 Ga0070710_100683362 334
155 3300005440 Ga0070705_100014022 Ga0070705_1000140222 334
156 3300005456 Ga0070678_100080474 Ga0070678_1000804742 334
157 3300005458 Ga0070681_10379759 Ga0070681_103797591 334
158 3300005459 Ga0068867_100075612 Ga0068867_1000756123 334
159 3300005467 Ga0070706_100050788 Ga0070706_1000507885 334
160 3300005543 Ga0070672_100004102 Ga0070672_1000041025 334
161 3300005546 Ga0070696_100016980 Ga0070696_1000169802 334
162 3300005548 Ga0070665_100061296 Ga0070665_1000612964 334
163 3300005548 Ga0070665_100093570 Ga0070665_1000935702 334
164 3300005549 Ga0070704_100098571 Ga0070704_1000985712 334
165 3300005614 Ga0068856_100037919 Ga0068856_1000379196 334
166 3300005843 Ga0068860_100000267 Ga0068860_10000026712 334
167 3300009098 Ga0105245_10120109 Ga0105245_101201091 334
168 3300009098 Ga0105245_10502662 Ga0105245_105026621 334
169 3300009101 Ga0105247_10054966 Ga0105247_100549664 334
170 3300009174 Ga0105241_10201501 Ga0105241_102015012 334
171 3300013102 Ga0157371_10038347 Ga0157371_100383474 334
172 3300013296 Ga0157374_10201975 Ga0157374_102019752 334
173 3300013297 Ga0157378_10112062 Ga0157378_101120622 334
174 3300013308 Ga0157375_10023425 Ga0157375_100234254 334
175 3300013308 Ga0157375_10176708 Ga0157375_101767082 334
176 3300017792 Ga0163161_10001720 Ga0163161_100017203 334
177 3300025315 Ga0207697_10001019 Ga0207697_1000101910 334
178 3300025912 Ga0207707_10441752 Ga0207707_104417521 334
179 3300025915 Ga0207693_10061905 Ga0207693_100619052 334
180 3300025916 Ga0207663_10156417 Ga0207663_101564172 334
181 3300025926 Ga0207659_10006886 Ga0207659_100068862 334
182 3300025926 Ga0207659_10023427 Ga0207659_100234274 334
183 3300025931 Ga0207644_10093635 Ga0207644_100936353 334
184 3300025931 Ga0207644_10402378 Ga0207644_104023781 334
185 3300025933 Ga0207706_10025875 Ga0207706_100258753 334
186 3300025937 Ga0207669_10186104 Ga0207669_101861042 334
187 3300025939 Ga0207665_10002889 Ga0207665_100028899 334
188 3300025940 Ga0207691_10010431 Ga0207691_100104316 334
189 3300025960 Ga0207651_10273957 Ga0207651_102739572 334
190 3300026023 Ga0207677_10038703 Ga0207677_100387034 334
191 3300026089 Ga0207648_10046947 Ga0207648_100469474 334
192 3300026121 Ga0207683_10006136 Ga0207683_100061366 334
193 3300026121 Ga0207683_10039296 Ga0207683_100392963 334
194 3300028381 Ga0268264_10000357 Ga0268264_1000035713 334
195 3300035113 Ga0373936_0029733 Ga0373936_0029733_12_1016 334
196 3300048903 Ga0496100_0054692 Ga0496100_0054692_342_1346 334
197 3300048904 Ga0496101_0003972 Ga0496101_0003972_7538_8542 334
198 3300048906 Ga0496103_0008787 Ga0496103_0008787_3041_4045 334
199 3300048908 Ga0496105_0042228 Ga0496105_0042228_161_1165 334
200 3300048909 Ga0496106_0023644 Ga0496106_0023644_3106_4110 334
201 3300048910 Ga0496107_0004082 Ga0496107_0004082_2103_3107 334
202 3300048910 Ga0496107_0181093 Ga0496107_0181093_512_1516 334
203 3300048912 Ga0496109_0114042 Ga0496109_0114042_754_1794 334
204 3300048912 Ga0496109_0117764 Ga0496109_0117764_32_1036 334
205 3300048915 Ga0496112_0007814 Ga0496112_0007814_6536_7576 334
206 3300048915 Ga0496112_0077685 Ga0496112_0077685_213_1217 334
207 3300048918 Ga0496115_0007640 Ga0496115_0007640_2667_3671 334
208 3300005290 Ga0065712_10110450 Ga0065712_101104502 335
209 3300005293 Ga0065715_10159950 Ga0065715_101599501 335
210 3300005331 Ga0070670_100006070 Ga0070670_10000607011 335
211 3300005333 Ga0070677_10091281 Ga0070677_100912811 335
212 3300005335 Ga0070666_10034276 Ga0070666_100342763 335
213 3300005335 Ga0070666_10035080 Ga0070666_100350802 335
214 3300005338 Ga0068868_100023781 Ga0068868_1000237815 335
215 3300005340 Ga0070689_100023688 Ga0070689_1000236885 335
216 3300005353 Ga0070669_100036447 Ga0070669_1000364472 335
217 3300005353 Ga0070669_100104198 Ga0070669_1001041982 335
218 3300005355 Ga0070671_100010298 Ga0070671_1000102986 335
219 3300005355 Ga0070671_100024517 Ga0070671_1000245175 335
220 3300005356 Ga0070674_100011159 Ga0070674_1000111592 335
221 3300005356 Ga0070674_100011784 Ga0070674_1000117845 335
222 3300005364 Ga0070673_100005630 Ga0070673_1000056303 335
223 3300005365 Ga0070688_100005067 Ga0070688_1000050672 335
224 3300005440 Ga0070705_100209464 Ga0070705_1002094642 335
225 3300005445 Ga0070708_100021827 Ga0070708_1000218274 335
226 3300005456 Ga0070678_100054406 Ga0070678_1000544062 335
227 3300005456 Ga0070678_100078967 Ga0070678_1000789672 335
228 3300005466 Ga0070685_10062305 Ga0070685_100623052 335
229 3300005467 Ga0070706_100020767 Ga0070706_1000207675 335
230 3300005536 Ga0070697_100000863 Ga0070697_1000008633 335
231 3300005543 Ga0070672_100017190 Ga0070672_1000171905 335
232 3300005543 Ga0070672_100182741 Ga0070672_1001827412 335
233 3300005548 Ga0070665_100330318 Ga0070665_1003303182 335
234 3300005564 Ga0070664_100133864 Ga0070664_1001338641 335
235 3300005564 Ga0070664_100366233 Ga0070664_1003662332 335
236 3300005616 Ga0068852_100115316 Ga0068852_1001153164 335
237 3300006175 Ga0070712_100111713 Ga0070712_1001117132 335
238 3300006175 Ga0070712_100271488 Ga0070712_1002714882 335
239 3300006881 Ga0068865_100051332 Ga0068865_1000513322 335
240 3300006881 Ga0068865_100100784 Ga0068865_1001007843 335
241 3300009147 Ga0114129_10035429 Ga0114129_100354295 335
242 3300009545 Ga0105237_10288777 Ga0105237_102887772 335
243 3300010375 Ga0105239_10551247 Ga0105239_105512472 335
244 3300013296 Ga0157374_10004496 Ga0157374_1000449611 335
245 3300013296 Ga0157374_10007233 Ga0157374_100072335 335
246 3300013297 Ga0157378_10018503 Ga0157378_100185034 335
247 3300013297 Ga0157378_10054393 Ga0157378_100543932 335
248 3300013306 Ga0163162_10025378 Ga0163162_100253786 335
249 3300013306 Ga0163162_10047251 Ga0163162_100472512 335
250 3300013306 Ga0163162_10060882 Ga0163162_100608822 335
251 3300013308 Ga0157375_10008603 Ga0157375_100086039 335
252 3300014969 Ga0157376_10321217 Ga0157376_103212172 335
253 3300025315 Ga0207697_10002216 Ga0207697_100022168 335
254 3300025315 Ga0207697_10011392 Ga0207697_100113923 335
255 3300025907 Ga0207645_10025105 Ga0207645_100251056 335
256 3300025914 Ga0207671_10101182 Ga0207671_101011822 335
257 3300025915 Ga0207693_10041825 Ga0207693_100418254 335
258 3300025923 Ga0207681_10036357 Ga0207681_100363573 335
259 3300025926 Ga0207659_10113072 Ga0207659_101130722 335
260 3300025931 Ga0207644_10029901 Ga0207644_100299012 335
261 3300025931 Ga0207644_10032104 Ga0207644_100321045 335
262 3300025931 Ga0207644_10310470 Ga0207644_103104701 335
263 3300025933 Ga0207706_10008411 Ga0207706_100084112 335
264 3300025937 Ga0207669_10013374 Ga0207669_100133742 335
265 3300025937 Ga0207669_10020170 Ga0207669_100201702 335
266 3300025938 Ga0207704_10041027 Ga0207704_100410273 335
267 3300025940 Ga0207691_10028541 Ga0207691_100285415 335
268 3300025940 Ga0207691_10228090 Ga0207691_102280902 335
269 3300025960 Ga0207651_10030013 Ga0207651_100300133 335
270 3300025960 Ga0207651_10062025 Ga0207651_100620251 335
271 3300026023 Ga0207677_10214718 Ga0207677_102147182 335
272 3300026121 Ga0207683_10002403 Ga0207683_100024033 335
273 3300026121 Ga0207683_10010617 Ga0207683_100106179 335
274 3300028379 Ga0268266_10005284 Ga0268266_1000528411 335
275 3300036401 Ga0373937_0356522 Ga0373937_0356522_239_1246 335
276 3300048912 Ga0496109_0292020 Ga0496109_0292020_199_1206 335
277 3300048913 Ga0496110_0275593 Ga0496110_0275593_429_1436 335
278 3300048915 Ga0496112_0058570 Ga0496112_0058570_2473_3480 335
279 3300050507 nmdc:mga05p37_192038_c2 nmdc:mga05p37_192038_c2_45_1052 335
280 3300005328 Ga0070676_10074588 Ga0070676_100745882 336
281 3300005330 Ga0070690_100144709 Ga0070690_1001447092 336
282 3300005536 Ga0070697_100121632 Ga0070697_1001216322 336
283 3300005985 Ga0081539_10001918 Ga0081539_100019189 336
284 3300006358 Ga0068871_100004871 Ga0068871_10000487110 336
285 3300006871 Ga0075434_100152428 Ga0075434_1001524282 336
286 3300006914 Ga0075436_100020242 Ga0075436_1000202423 336
287 3300013297 Ga0157378_10068364 Ga0157378_100683642 336
288 3300013308 Ga0157375_10297905 Ga0157375_102979052 336
289 3300025931 Ga0207644_10091874 Ga0207644_100918741 336
290 3300035172 Ga0373955_0013148 Ga0373955_0013148_528_1538 336
291 3300037068 Ga0373925_0155570 Ga0373925_0155570_90_1100 336
292 3300045976 Ga0466967_0065309 Ga0466967_0065309_1306_2316 336
293 3300046529 Ga0495652_0169736 Ga0495652_0169736_441_1451 336
294 3300046679 Ga0495623_0020374 Ga0495623_0020374_3096_4121 336
295 3300046689 Ga0495613_0112788 Ga0495613_0112788_212_1222 336
296 3300047319 Ga0495674_0190222 Ga0495674_0190222_502_1512 336
297 3300047471 Ga0495684_0014707 Ga0495684_0014707_1608_2618 336
298 3300048904 Ga0496101_0223513 Ga0496101_0223513_69_1079 336
299 3300048912 Ga0496109_0208225 Ga0496109_0208225_767_1777 336
300 3300048915 Ga0496112_0108381 Ga0496112_0108381_42_1052 336
301 3300048917 Ga0496114_0012098 Ga0496114_0012098_1302_2312 336
302 3300048918 Ga0496115_0095108 Ga0496115_0095108_201_1211 336
303 3300050512 nmdc:mga0n895_236461_c1 nmdc:mga0n895_236461_c1_99_1109 336
304 3300050514 nmdc:mga08x19_8867_c1 nmdc:mga08x19_8867_c1_2556_3566 336
305 3300005435 Ga0070714_100223906 Ga0070714_1002239062 337
306 3300005842 Ga0068858_100079108 Ga0068858_1000791082 337
307 3300009176 Ga0105242_10029291 Ga0105242_100292914 337
308 3300009545 Ga0105237_10001748 Ga0105237_1000174819 337
309 3300049591 Ga0501075_0356289 Ga0501075_0356289_65_1090 338
310 3300049743 Ga0501081_0158189 Ga0501081_0158189_405_1430 338
311 3300003320 rootH2_10005428 rootH2_100054283 339
312 3300005293 Ga0065715_10127476 Ga0065715_101274762 339
313 3300005467 Ga0070706_100235119 Ga0070706_1002351192 339
314 3300005468 Ga0070707_100000439 Ga0070707_10000043941 339
315 3300005468 Ga0070707_100061615 Ga0070707_1000616154 339
316 3300005468 Ga0070707_100150068 Ga0070707_1001500682 339
317 3300005536 Ga0070697_100042181 Ga0070697_1000421814 339
318 3300005536 Ga0070697_100097846 Ga0070697_1000978462 339
319 3300005536 Ga0070697_100189869 Ga0070697_1001898692 339
320 3300005545 Ga0070695_100047723 Ga0070695_1000477233 339
321 3300006871 Ga0075434_100215594 Ga0075434_1002155942 339
322 3300009553 Ga0105249_10237894 Ga0105249_102378942 339
323 3300025915 Ga0207693_10012437 Ga0207693_100124374 339
324 3300025922 Ga0207646_10000358 Ga0207646_1000035853 339
325 3300025922 Ga0207646_10157121 Ga0207646_101571212 339
326 3300025922 Ga0207646_10164142 Ga0207646_101641422 339
327 3300025926 Ga0207659_10095941 Ga0207659_100959412 339
328 3300025928 Ga0207700_10219714 Ga0207700_102197142 339
329 3300031995 Ga0307409_100085208 Ga0307409_1000852083 339
330 3300032126 Ga0307415_100038346 Ga0307415_1000383462 339
331 3300039447 Ga0436361_0379036 Ga0436361_0379036_2100_3146 339
332 3300005467 Ga0070706_100081188 Ga0070706_1000811884 340
333 3300005468 Ga0070707_100085073 Ga0070707_1000850732 340
334 3300005471 Ga0070698_100015938 Ga0070698_1000159386 340
335 3300005471 Ga0070698_100071646 Ga0070698_1000716462 340
336 3300005518 Ga0070699_100046511 Ga0070699_1000465113 340
337 3300005536 Ga0070697_100001033 Ga0070697_10000103314 340
338 3300005536 Ga0070697_100047090 Ga0070697_1000470903 340
339 3300005536 Ga0070697_100266370 Ga0070697_1002663702 340
340 3300005937 Ga0081455_10004485 Ga0081455_1000448510 340
341 3300005985 Ga0081539_10000026 Ga0081539_1000002641 340
342 3300005985 Ga0081539_10024423 Ga0081539_100244233 340
343 3300006028 Ga0070717_10025634 Ga0070717_100256344 340
344 3300006028 Ga0070717_10105109 Ga0070717_101051093 340
345 3300006173 Ga0070716_100022474 Ga0070716_1000224742 340
346 3300009098 Ga0105245_10349057 Ga0105245_103490572 340
347 3300013296 Ga0157374_10037911 Ga0157374_100379112 340
348 3300013297 Ga0157378_10024006 Ga0157378_100240065 340
349 3300013297 Ga0157378_10078171 Ga0157378_100781712 340
350 3300025910 Ga0207684_10034250 Ga0207684_100342502 340
351 3300025910 Ga0207684_10078986 Ga0207684_100789864 340
352 3300025922 Ga0207646_10000504 Ga0207646_1000050437 340
353 3300025922 Ga0207646_10113637 Ga0207646_101136373 340
354 3300025922 Ga0207646_10117084 Ga0207646_101170843 340
355 3300025922 Ga0207646_10348454 Ga0207646_103484541 340
356 3300025927 Ga0207687_10166765 Ga0207687_101667653 340
357 3300025936 Ga0207670_10158742 Ga0207670_101587422 340
358 3300025940 Ga0207691_10421093 Ga0207691_104210931 340
359 3300026023 Ga0207677_10290301 Ga0207677_102903011 340
360 3300026067 Ga0207678_10260615 Ga0207678_102606151 340
361 3300001990 JGI24737J22298_10050373 JGI24737J22298_100503731 341
362 3300003659 JGI25404J52841_10001788 JGI25404J52841_100017881 341
363 3300005289 Ga0065704_10110450 Ga0065704_101104501 341
364 3300005289 Ga0065704_10209150 Ga0065704_102091501 341
365 3300005290 Ga0065712_10002047 Ga0065712_100020473 341
366 3300005290 Ga0065712_10004529 Ga0065712_100045292 341
367 3300005290 Ga0065712_10089630 Ga0065712_100896303 341
368 3300005293 Ga0065715_10091931 Ga0065715_100919314 341
369 3300005293 Ga0065715_10099155 Ga0065715_100991553 341
370 3300005295 Ga0065707_10113797 Ga0065707_101137971 341
371 3300005328 Ga0070676_10202940 Ga0070676_102029401 341
372 3300005329 Ga0070683_100077013 Ga0070683_1000770133 341
373 3300005329 Ga0070683_100134048 Ga0070683_1001340482 341
374 3300005329 Ga0070683_100167155 Ga0070683_1001671552 341
375 3300005336 Ga0070680_100069990 Ga0070680_1000699903 341
376 3300005336 Ga0070680_100292079 Ga0070680_1002920791 341
377 3300005340 Ga0070689_100036215 Ga0070689_1000362154 341
378 3300005340 Ga0070689_100078245 Ga0070689_1000782452 341
379 3300005344 Ga0070661_100008265 Ga0070661_1000082657 341
380 3300005344 Ga0070661_100181409 Ga0070661_1001814092 341
381 3300005347 Ga0070668_100052358 Ga0070668_1000523583 341
382 3300005354 Ga0070675_100001426 Ga0070675_1000014267 341
383 3300005354 Ga0070675_100303742 Ga0070675_1003037422 341
384 3300005354 Ga0070675_100437990 Ga0070675_1004379901 341
385 3300005355 Ga0070671_100175541 Ga0070671_1001755412 341
386 3300005365 Ga0070688_100031651 Ga0070688_1000316513 341
387 3300005365 Ga0070688_100079916 Ga0070688_1000799162 341
388 3300005366 Ga0070659_100006359 Ga0070659_1000063596 341
389 3300005435 Ga0070714_100229730 Ga0070714_1002297301 341
390 3300005440 Ga0070705_100098276 Ga0070705_1000982762 341
391 3300005441 Ga0070700_100003873 Ga0070700_1000038737 341
392 3300005445 Ga0070708_100016953 Ga0070708_1000169534 341
393 3300005445 Ga0070708_100101511 Ga0070708_1001015112 341
394 3300005445 Ga0070708_100253799 Ga0070708_1002537992 341
395 3300005455 Ga0070663_100013988 Ga0070663_1000139884 341
396 3300005457 Ga0070662_100117808 Ga0070662_1001178082 341
397 3300005458 Ga0070681_10055781 Ga0070681_100557812 341
398 3300005467 Ga0070706_100089070 Ga0070706_1000890703 341
399 3300005468 Ga0070707_100027295 Ga0070707_1000272955 341
400 3300005468 Ga0070707_100125199 Ga0070707_1001251993 341
401 3300005471 Ga0070698_100002836 Ga0070698_10000283616 341
402 3300005518 Ga0070699_100152415 Ga0070699_1001524152 341
403 3300005530 Ga0070679_100096098 Ga0070679_1000960983 341
404 3300005535 Ga0070684_100000867 Ga0070684_10000086719 341
405 3300005535 Ga0070684_100005822 Ga0070684_1000058227 341
406 3300005535 Ga0070684_100217013 Ga0070684_1002170131 341
407 3300005536 Ga0070697_100008554 Ga0070697_1000085544 341
408 3300005544 Ga0070686_100016315 Ga0070686_1000163154 341
409 3300005548 Ga0070665_100044076 Ga0070665_1000440762 341
410 3300005548 Ga0070665_100082822 Ga0070665_1000828222 341
411 3300005548 Ga0070665_100117564 Ga0070665_1001175642 341
412 3300005549 Ga0070704_100003377 Ga0070704_1000033779 341
413 3300005615 Ga0070702_100058211 Ga0070702_1000582112 341
414 3300005841 Ga0068863_100055186 Ga0068863_1000551864 341
415 3300005841 Ga0068863_100196370 Ga0068863_1001963702 341
416 3300005842 Ga0068858_100014527 Ga0068858_1000145273 341
417 3300005843 Ga0068860_100007230 Ga0068860_1000072307 341
418 3300005937 Ga0081455_10006460 Ga0081455_100064608 341
419 3300005937 Ga0081455_10009604 Ga0081455_100096045 341
420 3300005937 Ga0081455_10036756 Ga0081455_100367564 341
421 3300005983 Ga0081540_1000014 Ga0081540_100001450 341
422 3300005985 Ga0081539_10018211 Ga0081539_100182113 341
423 3300006028 Ga0070717_10143990 Ga0070717_101439902 341
424 3300006163 Ga0070715_10064642 Ga0070715_100646421 341
425 3300006173 Ga0070716_100022413 Ga0070716_1000224133 341
426 3300006175 Ga0070712_100012423 Ga0070712_1000124235 341
427 3300006237 Ga0097621_100095912 Ga0097621_1000959122 341
428 3300006358 Ga0068871_100116582 Ga0068871_1001165822 341
429 3300009147 Ga0114129_10374906 Ga0114129_103749062 341
430 3300009177 Ga0105248_10333253 Ga0105248_103332532 341
431 3300009553 Ga0105249_10024448 Ga0105249_100244484 341
432 3300013296 Ga0157374_10081132 Ga0157374_100811322 341
433 3300013296 Ga0157374_10087899 Ga0157374_100878992 341
434 3300013297 Ga0157378_10071172 Ga0157378_100711722 341
435 3300013306 Ga0163162_10144190 Ga0163162_101441903 341
436 3300013307 Ga0157372_10112022 Ga0157372_101120222 341
437 3300013308 Ga0157375_10010745 Ga0157375_100107454 341
438 3300013308 Ga0157375_10064562 Ga0157375_100645624 341
439 3300013308 Ga0157375_10719957 Ga0157375_107199571 341
440 3300014745 Ga0157377_10028407 Ga0157377_100284072 341
441 3300014968 Ga0157379_10000955 Ga0157379_100009556 341
442 3300014969 Ga0157376_10023967 Ga0157376_100239674 341
443 3300025271 Ga0207666_1000551 Ga0207666_10005512 341
444 3300025290 Ga0207673_1001689 Ga0207673_10016893 341
445 3300025315 Ga0207697_10000711 Ga0207697_100007118 341
446 3300025315 Ga0207697_10001026 Ga0207697_1000102613 341
447 3300025315 Ga0207697_10006343 Ga0207697_100063437 341
448 3300025315 Ga0207697_10035311 Ga0207697_100353111 341
449 3300025904 Ga0207647_10022787 Ga0207647_100227872 341
450 3300025907 Ga0207645_10007467 Ga0207645_100074679 341
451 3300025910 Ga0207684_10023202 Ga0207684_100232021 341
452 3300025915 Ga0207693_10358224 Ga0207693_103582241 341
453 3300025919 Ga0207657_10059524 Ga0207657_100595241 341
454 3300025920 Ga0207649_10118906 Ga0207649_101189062 341
455 3300025921 Ga0207652_10124191 Ga0207652_101241911 341
456 3300025921 Ga0207652_10508632 Ga0207652_105086321 341
457 3300025922 Ga0207646_10069243 Ga0207646_100692432 341
458 3300025926 Ga0207659_10039321 Ga0207659_100393212 341
459 3300025926 Ga0207659_10301977 Ga0207659_103019771 341
460 3300025933 Ga0207706_10012445 Ga0207706_100124459 341
461 3300025936 Ga0207670_10033258 Ga0207670_100332584 341
462 3300025939 Ga0207665_10120287 Ga0207665_101202871 341
463 3300025940 Ga0207691_10153220 Ga0207691_101532202 341
464 3300025941 Ga0207711_10310151 Ga0207711_103101512 341
465 3300025944 Ga0207661_10086125 Ga0207661_100861253 341
466 3300025944 Ga0207661_10090864 Ga0207661_100908642 341
467 3300025945 Ga0207679_10121424 Ga0207679_101214241 341
468 3300025961 Ga0207712_10082106 Ga0207712_100821062 341
469 3300025972 Ga0207668_10021116 Ga0207668_100211162 341
470 3300026023 Ga0207677_10239180 Ga0207677_102391801 341
471 3300026035 Ga0207703_10021358 Ga0207703_100213584 341
472 3300026067 Ga0207678_10009556 Ga0207678_100095563 341
473 3300026075 Ga0207708_10003639 Ga0207708_100036392 341
474 3300026088 Ga0207641_10044372 Ga0207641_100443722 341
475 3300026118 Ga0207675_100042959 Ga0207675_1000429594 341
476 3300026121 Ga0207683_10034825 Ga0207683_100348254 341
477 3300028379 Ga0268266_10104972 Ga0268266_101049721 341
478 3300028381 Ga0268264_10015640 Ga0268264_100156407 341
479 3300035120 Ga0373957_0042064 Ga0373957_0042064_185_1210 341
480 3300035692 Ga0373935_0029415 Ga0373935_0029415_353_1378 341
481 3300037418 Ga0395900_0021221 Ga0395900_0021221_3636_4661 341
482 3300037418 Ga0395900_0093654 Ga0395900_0093654_1936_2961 341
483 3300037418 Ga0395900_0177328 Ga0395900_0177328_620_1645 341
484 3300037466 Ga0395898_0009649 Ga0395898_0009649_365_1390 341
485 3300037471 Ga0395905_0047592 Ga0395905_0047592_915_1940 341
486 3300038443 Ga0395901_0078520 Ga0395901_0078520_973_1998 341
487 3300042009 Ga0439451_013534 Ga0439451_013534_300_1325 341
488 3300044706 Ga0466964_0074513 Ga0466964_0074513_218_1243 341
489 3300046454 Ga0495592_0002133 Ga0495592_0002133_10157_11182 341
490 3300046455 Ga0495603_0154795 Ga0495603_0154795_11_1036 341
491 3300046462 Ga0495651_0198775 Ga0495651_0198775_285_1310 341
492 3300046516 Ga0495628_0001627 Ga0495628_0001627_7583_8608 341
493 3300046529 Ga0495652_0010248 Ga0495652_0010248_3009_4034 341
494 3300046543 Ga0495645_0035622 Ga0495645_0035622_906_1931 341
495 3300046678 Ga0495599_0018811 Ga0495599_0018811_1777_2802 341
496 3300047444 Ga0495675_0003717 Ga0495675_0003717_4994_6019 341
497 3300048088 Ga0495602_0032833 Ga0495602_0032833_618_1643 341
498 3300048904 Ga0496101_0116185 Ga0496101_0116185_274_1299 341
499 3300048907 Ga0496104_0024302 Ga0496104_0024302_2508_3533 341
500 3300048908 Ga0496105_0021269 Ga0496105_0021269_2463_3488 341
501 3300048909 Ga0496106_0133490 Ga0496106_0133490_818_1843 341
502 3300048912 Ga0496109_0055227 Ga0496109_0055227_1332_2357 341
503 3300048913 Ga0496110_0068757 Ga0496110_0068757_1886_2911 341
504 3300048915 Ga0496112_0042702 Ga0496112_0042702_1940_2965 341
505 3300048917 Ga0496114_0123450 Ga0496114_0123450_817_1842 341
506 3300048918 Ga0496115_0004994 Ga0496115_0004994_1231_2256 341
507 3300048918 Ga0496115_0088217 Ga0496115_0088217_168_1193 341
508 3300053077 Ga0495601_0001627 Ga0495601_0001627_4870_5895 341
509 3300005467 Ga0070706_100000682 Ga0070706_10000068230 342
510 3300005467 Ga0070706_100204596 Ga0070706_1002045962 342
511 3300005468 Ga0070707_100016084 Ga0070707_1000160843 342
512 3300005471 Ga0070698_100101532 Ga0070698_1001015323 342
513 3300005471 Ga0070698_100229660 Ga0070698_1002296602 342
514 3300005536 Ga0070697_100002512 Ga0070697_1000025126 342
515 3300006028 Ga0070717_10000722 Ga0070717_1000072212 342
516 3300025910 Ga0207684_10000736 Ga0207684_1000073615 342
517 3300025910 Ga0207684_10289926 Ga0207684_102899262 342
518 3300025922 Ga0207646_10019070 Ga0207646_100190706 342
519 3300005467 Ga0070706_100055019 Ga0070706_1000550193 343
520 3300005467 Ga0070706_100057677 Ga0070706_1000576773 343
521 3300005937 Ga0081455_10000647 Ga0081455_1000064725 343
522 3300005983 Ga0081540_1009067 Ga0081540_10090674 343
523 3300009147 Ga0114129_10000103 Ga0114129_1000010350 343
524 3300025910 Ga0207684_10022277 Ga0207684_100222772 343
525 3300025910 Ga0207684_10030132 Ga0207684_100301322 343
526 3300025922 Ga0207646_10080185 Ga0207646_100801852 343
527 3300050507 nmdc:mga05p37_3050_c2 nmdc:mga05p37_3050_c2_1035_2066 343
528 3300005289 Ga0065704_10018270 Ga0065704_100182701 344
529 3300005353 Ga0070669_100175551 Ga0070669_1001755511 344
530 3300005439 Ga0070711_100009047 Ga0070711_1000090475 344
531 3300021361 Ga0213872_10040464 Ga0213872_100404642 344
532 3300021384 Ga0213876_10000436 Ga0213876_1000043619 344
533 3300025315 Ga0207697_10057290 Ga0207697_100572902 344
534 3300025915 Ga0207693_10000519 Ga0207693_1000051927 344
535 3300025916 Ga0207663_10017524 Ga0207663_100175243 344
536 3300025923 Ga0207681_10185972 Ga0207681_101859722 344
537 3300025933 Ga0207706_10157172 Ga0207706_101571722 344
538 3300025939 Ga0207665_10304853 Ga0207665_103048531 344
539 3300035171 Ga0373946_0030606 Ga0373946_0030606_552_1622 344
540 3300037068 Ga0373925_0145570 Ga0373925_0145570_223_1293 344
541 3300037853 Ga0436364_0757601 Ga0436364_0757601_1088_2200 344
542 3300039437 Ga0436365_1670361 Ga0436365_1670361_15132_16316 344
543 3300039447 Ga0436361_0370321 Ga0436361_0370321_345_1403 344
544 3300046674 Ga0495588_0041340 Ga0495588_0041340_328_1398 344
545 3300046684 Ga0495669_0010184 Ga0495669_0010184_1061_2131 344
546 3300000545 CNXas_1000009 CNXas_100000925 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

40

176

0.83

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

112

209

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.9003 4 250
7nnt-assembly1.cif.gz_B cryo-em structure of the folate-specific ecf transporter complex in ddm micelles 0.8951 40 244
6xgz-assembly3.cif.gz_E crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.8946 2 245
6xgz-assembly2.cif.gz_C crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.8898 2 244
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.8881 1 240
ID Description Score Start End Superfamily
af_Q9XW49_440_685_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9302 1 248 3.40.50.300
af_Q2FVS3_1_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9273 1 243 3.40.50.300
af_A4HV32_726_961_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9254 2 246 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9226 1 245 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9208 4 248 3.40.50.300
ID Description Score Start End GO Terms
AF-T1AL51-F1-model_v4 ABC transporter, ATP binding/permease protein 0.9308 1 247 GO:0005524
GO:0016887
AF-A0A6G2UJN6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9298 2 217 GO:0005524
GO:0016887
GO:0046677
AF-A0A7I7SA04-F1-model_v4 deleted 0.9297 38 248
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9297 1 205 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9292 1 246 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
85.06 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map