F462008
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 546 | 243 | 545 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300027907|Ga0207428_10201979|Ga0207428_102019792 |
| Length | 325 |
| Sequence | MIVIQAHDLTKRYRVAKKREGIGGAIIDLFRPRHEMLNAVNGVSFSLERGEMVGYIGANGAGKSTTIKMLTGILTPTSGEILVNGYVPSKERRAYTRTIGAVFGQRTQLWWDIAVIESLKLLKKIYEVPDDVYREQMKDFLSQPVRTLSLGQRMRCDLAAALLHRPSIVFLDEPTIGLDVVSKENIRRFLRRVNEELKTTVILTTHDLGDIEQLCRRVIVIDQGKILYDGDLAGLKKSTGDIARLRVEIRGEDGGELLARATNGVPIEWKRIGPGLYEGEFPKDSTSVADVVRRIVTDAPVHDLAVLEPPIEEVVRKIYRREIAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 107 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 108 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 182 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 183 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 184 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 185 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 186 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 187 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 188 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 222 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 240 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 241 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 242 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 243 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.1 |
| Nodule | 0 |
| Rhizoplane | 5.68 |
| Rhizosphere | 90.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000009 | 3300000545 | Bacteria | 42024 |
| 2 | JGI24737J22298_10050373 | 3300001990 | Bacteria | 1266 |
| 3 | JGI24743J22301_10001127 | 3300001991 | Bacteria | 3584 |
| 4 | JGI24033J26618_1000063 | 3300002155 | Bacteria | 15592 |
| 5 | rootH2_10005428 | 3300003320 | Bacteria | 3373 |
| 6 | rootH2_10006650 | 3300003320 | Bacteria | 18133 |
| 7 | rootH2_10016401 | 3300003320 | Bacteria | 7400 |
| 8 | rootL2_10043152 | 3300003322 | Bacteria | 16356 |
| 9 | rootH1_10025348 | 3300003323 | Bacteria | 15775 |
| 10 | JGI25404J52841_10001788 | 3300003659 | Bacteria | 3896 |
| 11 | Ga0055530_10010894 | 3300003791 | Bacteria | 3312 |
| 12 | Ga0065704_10005956 | 3300005289 | Bacteria | 4752 |
| 13 | Ga0065704_10018270 | 3300005289 | Bacteria | 3396 |
| 14 | Ga0065704_10110450 | 3300005289 | Bacteria | 1960 |
| 15 | Ga0065704_10209150 | 3300005289 | Bacteria | 1115 |
| 16 | Ga0065712_10002047 | 3300005290 | Bacteria | 4929 |
| 17 | Ga0065712_10004529 | 3300005290 | Bacteria | 3195 |
| 18 | Ga0065712_10089630 | 3300005290 | Bacteria | 2461 |
| 19 | Ga0065712_10092062 | 3300005290 | Bacteria | 2346 |
| 20 | Ga0065712_10110450 | 3300005290 | Bacteria | 1836 |
| 21 | Ga0065715_10008361 | 3300005293 | Bacteria | 6657 |
| 22 | Ga0065715_10091931 | 3300005293 | Bacteria | 5450 |
| 23 | Ga0065715_10099155 | 3300005293 | Bacteria | 3451 |
| 24 | Ga0065715_10127476 | 3300005293 | Bacteria | 2086 |
| 25 | Ga0065715_10159950 | 3300005293 | Bacteria | 1639 |
| 26 | Ga0065707_10113797 | 3300005295 | Bacteria | 2312 |
| 27 | Ga0070658_10010667 | 3300005327 | Bacteria | 7363 |
| 28 | Ga0070658_10172350 | 3300005327 | Bacteria | 1818 |
| 29 | Ga0070676_10074588 | 3300005328 | Bacteria | 2044 |
| 30 | Ga0070676_10202940 | 3300005328 | Bacteria | 1301 |
| 31 | Ga0070683_100077013 | 3300005329 | Bacteria | 3118 |
| 32 | Ga0070683_100134048 | 3300005329 | Bacteria | 2345 |
| 33 | Ga0070683_100167155 | 3300005329 | Bacteria | 2087 |
| 34 | Ga0070690_100087288 | 3300005330 | Unclassified | 2048 |
| 35 | Ga0070690_100144709 | 3300005330 | Bacteria | 1616 |
| 36 | Ga0070670_100006070 | 3300005331 | Bacteria | 10217 |
| 37 | Ga0070670_100155829 | 3300005331 | Bacteria | 1978 |
| 38 | Ga0070677_10091281 | 3300005333 | Bacteria | 1325 |
| 39 | Ga0070666_10034276 | 3300005335 | Bacteria | 3365 |
| 40 | Ga0070666_10035080 | 3300005335 | Bacteria | 3325 |
| 41 | Ga0070680_100069990 | 3300005336 | Bacteria | 2882 |
| 42 | Ga0070680_100292079 | 3300005336 | Bacteria | 1382 |
| 43 | Ga0068868_100023781 | 3300005338 | Bacteria | 4640 |
| 44 | Ga0068868_100038723 | 3300005338 | Bacteria | 3701 |
| 45 | Ga0070689_100023688 | 3300005340 | Bacteria | 4599 |
| 46 | Ga0070689_100036215 | 3300005340 | Bacteria | 3773 |
| 47 | Ga0070689_100078245 | 3300005340 | Bacteria | 2593 |
| 48 | Ga0070687_100073720 | 3300005343 | Unclassified | 1841 |
| 49 | Ga0070661_100000788 | 3300005344 | Bacteria | 22747 |
| 50 | Ga0070661_100008265 | 3300005344 | Bacteria | 7184 |
| 51 | Ga0070661_100181409 | 3300005344 | Bacteria | 1602 |
| 52 | Ga0070668_100001931 | 3300005347 | Bacteria | 15135 |
| 53 | Ga0070668_100052358 | 3300005347 | Bacteria | 3146 |
| 54 | Ga0070669_100036447 | 3300005353 | Bacteria | 3564 |
| 55 | Ga0070669_100045734 | 3300005353 | Bacteria | 3190 |
| 56 | Ga0070669_100104198 | 3300005353 | Bacteria | 2144 |
| 57 | Ga0070669_100175551 | 3300005353 | Bacteria | 1673 |
| 58 | Ga0070675_100001426 | 3300005354 | Bacteria | 17559 |
| 59 | Ga0070675_100303742 | 3300005354 | Bacteria | 1406 |
| 60 | Ga0070675_100437990 | 3300005354 | Bacteria | 1171 |
| 61 | Ga0070671_100010298 | 3300005355 | Bacteria | 7502 |
| 62 | Ga0070671_100024517 | 3300005355 | Bacteria | 4939 |
| 63 | Ga0070671_100175541 | 3300005355 | Unclassified | 1813 |
| 64 | Ga0070674_100011159 | 3300005356 | Bacteria | 5457 |
| 65 | Ga0070674_100011784 | 3300005356 | Bacteria | 5337 |
| 66 | Ga0070673_100005630 | 3300005364 | Bacteria | 8040 |
| 67 | Ga0070688_100005067 | 3300005365 | Bacteria | 6906 |
| 68 | Ga0070688_100031651 | 3300005365 | Bacteria | 3184 |
| 69 | Ga0070688_100079916 | 3300005365 | Bacteria | 2114 |
| 70 | Ga0070659_100006359 | 3300005366 | Bacteria | 8531 |
| 71 | Ga0070659_100311642 | 3300005366 | Unclassified | 1314 |
| 72 | Ga0070709_10113801 | 3300005434 | Bacteria | 1822 |
| 73 | Ga0070714_100219283 | 3300005435 | Bacteria | 1747 |
| 74 | Ga0070714_100223906 | 3300005435 | Bacteria | 1730 |
| 75 | Ga0070714_100229730 | 3300005435 | Unclassified | 1709 |
| 76 | Ga0070713_100002205 | 3300005436 | Bacteria | 12619 |
| 77 | Ga0070713_100010603 | 3300005436 | Bacteria | 6666 |
| 78 | Ga0070710_10020816 | 3300005437 | Bacteria | 3409 |
| 79 | Ga0070710_10068336 | 3300005437 | Unclassified | 2041 |
| 80 | Ga0070711_100009047 | 3300005439 | Bacteria | 6116 |
| 81 | Ga0070711_100081017 | 3300005439 | Bacteria | 2312 |
| 82 | Ga0070705_100014022 | 3300005440 | Bacteria | 4113 |
| 83 | Ga0070705_100098276 | 3300005440 | Bacteria | 1842 |
| 84 | Ga0070705_100209464 | 3300005440 | Bacteria | 1343 |
| 85 | Ga0070700_100003873 | 3300005441 | Bacteria | 7768 |
| 86 | Ga0070708_100013304 | 3300005445 | Bacteria | 6734 |
| 87 | Ga0070708_100016953 | 3300005445 | Bacteria | 6060 |
| 88 | Ga0070708_100021827 | 3300005445 | Bacteria | 5421 |
| 89 | Ga0070708_100101511 | 3300005445 | Unclassified | 2635 |
| 90 | Ga0070708_100131620 | 3300005445 | Bacteria | 2315 |
| 91 | Ga0070708_100253799 | 3300005445 | Bacteria | 1652 |
| 92 | Ga0070663_100013988 | 3300005455 | Bacteria | 5138 |
| 93 | Ga0070678_100054406 | 3300005456 | Bacteria | 2916 |
| 94 | Ga0070678_100078967 | 3300005456 | Bacteria | 2487 |
| 95 | Ga0070678_100080474 | 3300005456 | Bacteria | 2467 |
| 96 | Ga0070678_100089327 | 3300005456 | Bacteria | 2358 |
| 97 | Ga0070662_100117808 | 3300005457 | Bacteria | 2032 |
| 98 | Ga0070681_10055781 | 3300005458 | Bacteria | 3933 |
| 99 | Ga0070681_10152872 | 3300005458 | Bacteria | 2234 |
| 100 | Ga0070681_10379759 | 3300005458 | Bacteria | 1324 |
| 101 | Ga0068867_100075612 | 3300005459 | Unclassified | 2527 |
| 102 | Ga0070685_10062305 | 3300005466 | Bacteria | 2187 |
| 103 | Ga0070706_100000486 | 3300005467 | Bacteria | 46746 |
| 104 | Ga0070706_100000682 | 3300005467 | Bacteria | 38464 |
| 105 | Ga0070706_100020767 | 3300005467 | Bacteria | 6047 |
| 106 | Ga0070706_100050788 | 3300005467 | Bacteria | 3827 |
| 107 | Ga0070706_100055019 | 3300005467 | Bacteria | 3673 |
| 108 | Ga0070706_100057677 | 3300005467 | Bacteria | 3584 |
| 109 | Ga0070706_100081188 | 3300005467 | Bacteria | 3003 |
| 110 | Ga0070706_100083158 | 3300005467 | Bacteria | 2965 |
| 111 | Ga0070706_100089070 | 3300005467 | Bacteria | 2861 |
| 112 | Ga0070706_100204596 | 3300005467 | Bacteria | 1844 |
| 113 | Ga0070706_100235119 | 3300005467 | Unclassified | 1711 |
| 114 | Ga0070707_100000439 | 3300005468 | Bacteria | 41289 |
| 115 | Ga0070707_100016084 | 3300005468 | Bacteria | 7019 |
| 116 | Ga0070707_100027295 | 3300005468 | Bacteria | 5432 |
| 117 | Ga0070707_100042472 | 3300005468 | Bacteria | 4353 |
| 118 | Ga0070707_100061615 | 3300005468 | Bacteria | 3599 |
| 119 | Ga0070707_100085073 | 3300005468 | Bacteria | 3056 |
| 120 | Ga0070707_100125199 | 3300005468 | Bacteria | 2496 |
| 121 | Ga0070707_100150068 | 3300005468 | Bacteria | 2269 |
| 122 | Ga0070698_100001910 | 3300005471 | Bacteria | 23223 |
| 123 | Ga0070698_100001955 | 3300005471 | Bacteria | 22884 |
| 124 | Ga0070698_100002836 | 3300005471 | Bacteria | 19067 |
| 125 | Ga0070698_100015938 | 3300005471 | Bacteria | 7936 |
| 126 | Ga0070698_100071646 | 3300005471 | Bacteria | 3475 |
| 127 | Ga0070698_100101532 | 3300005471 | Bacteria | 2848 |
| 128 | Ga0070698_100229660 | 3300005471 | Bacteria | 1789 |
| 129 | Ga0070699_100046511 | 3300005518 | Bacteria | 3754 |
| 130 | Ga0070699_100152415 | 3300005518 | Bacteria | 2045 |
| 131 | Ga0070679_100096098 | 3300005530 | Bacteria | 2950 |
| 132 | Ga0070684_100000867 | 3300005535 | Bacteria | 21400 |
| 133 | Ga0070684_100005822 | 3300005535 | Bacteria | 9483 |
| 134 | Ga0070684_100217013 | 3300005535 | Unclassified | 1745 |
| 135 | Ga0070697_100000863 | 3300005536 | Bacteria | 22791 |
| 136 | Ga0070697_100001033 | 3300005536 | Bacteria | 21037 |
| 137 | Ga0070697_100002512 | 3300005536 | Bacteria | 14111 |
| 138 | Ga0070697_100008554 | 3300005536 | Bacteria | 7993 |
| 139 | Ga0070697_100041927 | 3300005536 | Bacteria | 3705 |
| 140 | Ga0070697_100042181 | 3300005536 | Bacteria | 3692 |
| 141 | Ga0070697_100047090 | 3300005536 | Bacteria | 3497 |
| 142 | Ga0070697_100092839 | 3300005536 | Bacteria | 2498 |
| 143 | Ga0070697_100097846 | 3300005536 | Bacteria | 2435 |
| 144 | Ga0070697_100121632 | 3300005536 | Bacteria | 2184 |
| 145 | Ga0070697_100189869 | 3300005536 | Bacteria | 1743 |
| 146 | Ga0070697_100266370 | 3300005536 | Bacteria | 1468 |
| 147 | Ga0068853_100000019 | 3300005539 | Bacteria | 163178 |
| 148 | Ga0070672_100004102 | 3300005543 | Bacteria | 9511 |
| 149 | Ga0070672_100017190 | 3300005543 | Bacteria | 5201 |
| 150 | Ga0070672_100182741 | 3300005543 | Bacteria | 1748 |
| 151 | Ga0070686_100016315 | 3300005544 | Unclassified | 4318 |
| 152 | Ga0070695_100047723 | 3300005545 | Bacteria | 2736 |
| 153 | Ga0070696_100016980 | 3300005546 | Bacteria | 4910 |
| 154 | Ga0070665_100000045 | 3300005548 | Bacteria | 275023 |
| 155 | Ga0070665_100044076 | 3300005548 | Bacteria | 4480 |
| 156 | Ga0070665_100061296 | 3300005548 | Bacteria | 3770 |
| 157 | Ga0070665_100082822 | 3300005548 | Bacteria | 3213 |
| 158 | Ga0070665_100093570 | 3300005548 | Unclassified | 3011 |
| 159 | Ga0070665_100117564 | 3300005548 | Bacteria | 2661 |
| 160 | Ga0070665_100330318 | 3300005548 | Bacteria | 1529 |
| 161 | Ga0070704_100003377 | 3300005549 | Bacteria | 9155 |
| 162 | Ga0070704_100098571 | 3300005549 | Unclassified | 2196 |
| 163 | Ga0070664_100133864 | 3300005564 | Bacteria | 2178 |
| 164 | Ga0070664_100366233 | 3300005564 | Bacteria | 1313 |
| 165 | Ga0068856_100000034 | 3300005614 | Bacteria | 124288 |
| 166 | Ga0068856_100037919 | 3300005614 | Bacteria | 4730 |
| 167 | Ga0070702_100058211 | 3300005615 | Bacteria | 2238 |
| 168 | Ga0068852_100115316 | 3300005616 | Bacteria | 2449 |
| 169 | Ga0068863_100055186 | 3300005841 | Bacteria | 3763 |
| 170 | Ga0068863_100102701 | 3300005841 | Bacteria | 2719 |
| 171 | Ga0068863_100196370 | 3300005841 | Bacteria | 1940 |
| 172 | Ga0068858_100014527 | 3300005842 | Bacteria | 7418 |
| 173 | Ga0068858_100042252 | 3300005842 | Bacteria | 4227 |
| 174 | Ga0068858_100050555 | 3300005842 | Bacteria | 3847 |
| 175 | Ga0068858_100079108 | 3300005842 | Bacteria | 3055 |
| 176 | Ga0068858_100145821 | 3300005842 | Bacteria | 2223 |
| 177 | Ga0068860_100000267 | 3300005843 | Bacteria | 76469 |
| 178 | Ga0068860_100007230 | 3300005843 | Bacteria | 11100 |
| 179 | Ga0068860_100424984 | 3300005843 | Bacteria | 1318 |
| 180 | Ga0081455_10000647 | 3300005937 | Bacteria | 45079 |
| 181 | Ga0081455_10004485 | 3300005937 | Bacteria | 15617 |
| 182 | Ga0081455_10006460 | 3300005937 | Bacteria | 12563 |
| 183 | Ga0081455_10009604 | 3300005937 | Bacteria | 9935 |
| 184 | Ga0081455_10036756 | 3300005937 | Bacteria | 4356 |
| 185 | Ga0081455_10133291 | 3300005937 | Bacteria | 1939 |
| 186 | Ga0081538_10089434 | 3300005981 | Bacteria | 1598 |
| 187 | Ga0081540_1000014 | 3300005983 | Bacteria | 179266 |
| 188 | Ga0081540_1009067 | 3300005983 | Bacteria | 6874 |
| 189 | Ga0081540_1018113 | 3300005983 | Bacteria | 4334 |
| 190 | Ga0081539_10000026 | 3300005985 | Bacteria | 330830 |
| 191 | Ga0081539_10001918 | 3300005985 | Bacteria | 32176 |
| 192 | Ga0081539_10018211 | 3300005985 | Bacteria | 4887 |
| 193 | Ga0081539_10024423 | 3300005985 | Bacteria | 3921 |
| 194 | Ga0070717_10000722 | 3300006028 | Bacteria | 21468 |
| 195 | Ga0070717_10022602 | 3300006028 | Bacteria | 4971 |
| 196 | Ga0070717_10025634 | 3300006028 | Bacteria | 4692 |
| 197 | Ga0070717_10105109 | 3300006028 | Bacteria | 2403 |
| 198 | Ga0070717_10143990 | 3300006028 | Bacteria | 2057 |
| 199 | Ga0070717_10208540 | 3300006028 | Bacteria | 1714 |
| 200 | Ga0070715_10064642 | 3300006163 | Bacteria | 1617 |
| 201 | Ga0070716_100022413 | 3300006173 | Bacteria | 3338 |
| 202 | Ga0070716_100022474 | 3300006173 | Unclassified | 3334 |
| 203 | Ga0070712_100012423 | 3300006175 | Bacteria | 5414 |
| 204 | Ga0070712_100111713 | 3300006175 | Bacteria | 2041 |
| 205 | Ga0070712_100271488 | 3300006175 | Bacteria | 1363 |
| 206 | Ga0097621_100095912 | 3300006237 | Bacteria | 2488 |
| 207 | Ga0097621_100166811 | 3300006237 | Bacteria | 1896 |
| 208 | Ga0068871_100004871 | 3300006358 | Bacteria | 9378 |
| 209 | Ga0068871_100116582 | 3300006358 | Bacteria | 2252 |
| 210 | Ga0075434_100152428 | 3300006871 | Bacteria | 2332 |
| 211 | Ga0075434_100215594 | 3300006871 | Bacteria | 1939 |
| 212 | Ga0068865_100051332 | 3300006881 | Bacteria | 2854 |
| 213 | Ga0068865_100100784 | 3300006881 | Bacteria | 2114 |
| 214 | Ga0075436_100020242 | 3300006914 | Bacteria | 4566 |
| 215 | Ga0099795_10042549 | 3300007788 | Unclassified | 1622 |
| 216 | Ga0105240_10000043 | 3300009093 | Bacteria | 254256 |
| 217 | Ga0105240_10051315 | 3300009093 | Bacteria | 5192 |
| 218 | Ga0111539_10099327 | 3300009094 | Bacteria | 3418 |
| 219 | Ga0105245_10120109 | 3300009098 | Bacteria | 2454 |
| 220 | Ga0105245_10349057 | 3300009098 | Bacteria | 1465 |
| 221 | Ga0105245_10436561 | 3300009098 | Bacteria | 1315 |
| 222 | Ga0105245_10502662 | 3300009098 | Bacteria | 1228 |
| 223 | Ga0105247_10054966 | 3300009101 | Unclassified | 2457 |
| 224 | Ga0114129_10000103 | 3300009147 | Bacteria | 83612 |
| 225 | Ga0114129_10035429 | 3300009147 | Bacteria | 7050 |
| 226 | Ga0114129_10374906 | 3300009147 | Bacteria | 1880 |
| 227 | Ga0105241_10201501 | 3300009174 | Bacteria | 1662 |
| 228 | Ga0105242_10029291 | 3300009176 | Bacteria | 4390 |
| 229 | Ga0105248_10333253 | 3300009177 | Bacteria | 1709 |
| 230 | Ga0105237_10001748 | 3300009545 | Bacteria | 28071 |
| 231 | Ga0105237_10188280 | 3300009545 | Bacteria | 2064 |
| 232 | Ga0105237_10288777 | 3300009545 | Bacteria | 1643 |
| 233 | Ga0105238_10044916 | 3300009551 | Bacteria | 4465 |
| 234 | Ga0105249_10024448 | 3300009553 | Bacteria | 5429 |
| 235 | Ga0105249_10237894 | 3300009553 | Bacteria | 1799 |
| 236 | Ga0105239_10551247 | 3300010375 | Bacteria | 1313 |
| 237 | Ga0157371_10038347 | 3300013102 | Bacteria | 3429 |
| 238 | Ga0157374_10000057 | 3300013296 | Bacteria | 117036 |
| 239 | Ga0157374_10004496 | 3300013296 | Bacteria | 11716 |
| 240 | Ga0157374_10007233 | 3300013296 | Bacteria | 9458 |
| 241 | Ga0157374_10037911 | 3300013296 | Bacteria | 4428 |
| 242 | Ga0157374_10044145 | 3300013296 | Bacteria | 4120 |
| 243 | Ga0157374_10081132 | 3300013296 | Bacteria | 3078 |
| 244 | Ga0157374_10087899 | 3300013296 | Bacteria | 2959 |
| 245 | Ga0157374_10176713 | 3300013296 | Bacteria | 2084 |
| 246 | Ga0157374_10201975 | 3300013296 | Unclassified | 1947 |
| 247 | Ga0157378_10018503 | 3300013297 | Bacteria | 6122 |
| 248 | Ga0157378_10024006 | 3300013297 | Bacteria | 5364 |
| 249 | Ga0157378_10054393 | 3300013297 | Bacteria | 3564 |
| 250 | Ga0157378_10068364 | 3300013297 | Bacteria | 3186 |
| 251 | Ga0157378_10071172 | 3300013297 | Bacteria | 3123 |
| 252 | Ga0157378_10078171 | 3300013297 | Bacteria | 2984 |
| 253 | Ga0157378_10112062 | 3300013297 | Bacteria | 2502 |
| 254 | Ga0157378_10229860 | 3300013297 | Bacteria | 1767 |
| 255 | Ga0163162_10025378 | 3300013306 | Bacteria | 5855 |
| 256 | Ga0163162_10047251 | 3300013306 | Bacteria | 4314 |
| 257 | Ga0163162_10060882 | 3300013306 | Bacteria | 3812 |
| 258 | Ga0163162_10144190 | 3300013306 | Unclassified | 2496 |
| 259 | Ga0163162_10602761 | 3300013306 | Bacteria | 1224 |
| 260 | Ga0157372_10057724 | 3300013307 | Bacteria | 4339 |
| 261 | Ga0157372_10112022 | 3300013307 | Bacteria | 3126 |
| 262 | Ga0157375_10008603 | 3300013308 | Bacteria | 8936 |
| 263 | Ga0157375_10010745 | 3300013308 | Bacteria | 8068 |
| 264 | Ga0157375_10023425 | 3300013308 | Bacteria | 5697 |
| 265 | Ga0157375_10064562 | 3300013308 | Bacteria | 3645 |
| 266 | Ga0157375_10176708 | 3300013308 | Unclassified | 2285 |
| 267 | Ga0157375_10179016 | 3300013308 | Bacteria | 2271 |
| 268 | Ga0157375_10297905 | 3300013308 | Bacteria | 1776 |
| 269 | Ga0157375_10719957 | 3300013308 | Bacteria | 1151 |
| 270 | Ga0157377_10028407 | 3300014745 | Bacteria | 3010 |
| 271 | Ga0157379_10000955 | 3300014968 | Bacteria | 23432 |
| 272 | Ga0157376_10000167 | 3300014969 | Bacteria | 45629 |
| 273 | Ga0157376_10023967 | 3300014969 | Bacteria | 4787 |
| 274 | Ga0157376_10321217 | 3300014969 | Bacteria | 1472 |
| 275 | Ga0163161_10001720 | 3300017792 | Bacteria | 16042 |
| 276 | Ga0213872_10003443 | 3300021361 | Bacteria | 8796 |
| 277 | Ga0213872_10016774 | 3300021361 | Unclassified | 3396 |
| 278 | Ga0213872_10040464 | 3300021361 | Unclassified | 2128 |
| 279 | Ga0213872_10071725 | 3300021361 | Bacteria | 1561 |
| 280 | Ga0213872_10072238 | 3300021361 | Bacteria | 1554 |
| 281 | Ga0213876_10000436 | 3300021384 | Bacteria | 34060 |
| 282 | Ga0213876_10015249 | 3300021384 | Bacteria | 4070 |
| 283 | Ga0213876_10033943 | 3300021384 | Bacteria | 2690 |
| 284 | Ga0207666_1000551 | 3300025271 | Bacteria | 4547 |
| 285 | Ga0207673_1001689 | 3300025290 | Bacteria | 2440 |
| 286 | Ga0209050_1001026 | 3300025298 | Bacteria | 34801 |
| 287 | Ga0207697_10000711 | 3300025315 | Bacteria | 18972 |
| 288 | Ga0207697_10001019 | 3300025315 | Bacteria | 15693 |
| 289 | Ga0207697_10001026 | 3300025315 | Bacteria | 15584 |
| 290 | Ga0207697_10002216 | 3300025315 | Bacteria | 10156 |
| 291 | Ga0207697_10006343 | 3300025315 | Bacteria | 5362 |
| 292 | Ga0207697_10011392 | 3300025315 | Bacteria | 3762 |
| 293 | Ga0207697_10035311 | 3300025315 | Bacteria | 2046 |
| 294 | Ga0207697_10038616 | 3300025315 | Bacteria | 1958 |
| 295 | Ga0207697_10057290 | 3300025315 | Unclassified | 1617 |
| 296 | Ga0207647_10022787 | 3300025904 | Bacteria | 4154 |
| 297 | Ga0207699_10006262 | 3300025906 | Bacteria | 5749 |
| 298 | Ga0207645_10007467 | 3300025907 | Bacteria | 7718 |
| 299 | Ga0207645_10025105 | 3300025907 | Bacteria | 3859 |
| 300 | Ga0207705_10010015 | 3300025909 | Bacteria | 6900 |
| 301 | Ga0207684_10000732 | 3300025910 | Bacteria | 38532 |
| 302 | Ga0207684_10000736 | 3300025910 | Bacteria | 38478 |
| 303 | Ga0207684_10022277 | 3300025910 | Bacteria | 5409 |
| 304 | Ga0207684_10023202 | 3300025910 | Bacteria | 5299 |
| 305 | Ga0207684_10030132 | 3300025910 | Bacteria | 4620 |
| 306 | Ga0207684_10034250 | 3300025910 | Bacteria | 4316 |
| 307 | Ga0207684_10056115 | 3300025910 | Bacteria | 3341 |
| 308 | Ga0207684_10078986 | 3300025910 | Bacteria | 2799 |
| 309 | Ga0207684_10086660 | 3300025910 | Bacteria | 2667 |
| 310 | Ga0207684_10289926 | 3300025910 | Bacteria | 1411 |
| 311 | Ga0207707_10441752 | 3300025912 | Bacteria | 1114 |
| 312 | Ga0207695_10000181 | 3300025913 | Bacteria | 185042 |
| 313 | Ga0207695_10037840 | 3300025913 | Bacteria | 5202 |
| 314 | Ga0207671_10101182 | 3300025914 | Bacteria | 2183 |
| 315 | Ga0207693_10000519 | 3300025915 | Bacteria | 34790 |
| 316 | Ga0207693_10012437 | 3300025915 | Bacteria | 6877 |
| 317 | Ga0207693_10041825 | 3300025915 | Unclassified | 3607 |
| 318 | Ga0207693_10061905 | 3300025915 | Bacteria | 2931 |
| 319 | Ga0207693_10358224 | 3300025915 | Bacteria | 1141 |
| 320 | Ga0207663_10017524 | 3300025916 | Bacteria | 3993 |
| 321 | Ga0207663_10156417 | 3300025916 | Unclassified | 1604 |
| 322 | Ga0207657_10059524 | 3300025919 | Bacteria | 3281 |
| 323 | Ga0207649_10001293 | 3300025920 | Bacteria | 14940 |
| 324 | Ga0207649_10118906 | 3300025920 | Bacteria | 1778 |
| 325 | Ga0207652_10124191 | 3300025921 | Bacteria | 2298 |
| 326 | Ga0207652_10141814 | 3300025921 | Bacteria | 2149 |
| 327 | Ga0207652_10508632 | 3300025921 | Bacteria | 1084 |
| 328 | Ga0207646_10000358 | 3300025922 | Bacteria | 61519 |
| 329 | Ga0207646_10000504 | 3300025922 | Bacteria | 52235 |
| 330 | Ga0207646_10019070 | 3300025922 | Bacteria | 6382 |
| 331 | Ga0207646_10069243 | 3300025922 | Bacteria | 3151 |
| 332 | Ga0207646_10080185 | 3300025922 | Bacteria | 2919 |
| 333 | Ga0207646_10113637 | 3300025922 | Bacteria | 2431 |
| 334 | Ga0207646_10117084 | 3300025922 | Bacteria | 2393 |
| 335 | Ga0207646_10157121 | 3300025922 | Bacteria | 2051 |
| 336 | Ga0207646_10164142 | 3300025922 | Bacteria | 2005 |
| 337 | Ga0207646_10199480 | 3300025922 | Bacteria | 1807 |
| 338 | Ga0207646_10348454 | 3300025922 | Bacteria | 1338 |
| 339 | Ga0207681_10036357 | 3300025923 | Bacteria | 3249 |
| 340 | Ga0207681_10185972 | 3300025923 | Bacteria | 1586 |
| 341 | Ga0207659_10006886 | 3300025926 | Bacteria | 6990 |
| 342 | Ga0207659_10023427 | 3300025926 | Bacteria | 4120 |
| 343 | Ga0207659_10039321 | 3300025926 | Bacteria | 3298 |
| 344 | Ga0207659_10095941 | 3300025926 | Bacteria | 2225 |
| 345 | Ga0207659_10113072 | 3300025926 | Bacteria | 2067 |
| 346 | Ga0207659_10301977 | 3300025926 | Bacteria | 1315 |
| 347 | Ga0207687_10166765 | 3300025927 | Bacteria | 1695 |
| 348 | Ga0207700_10039694 | 3300025928 | Bacteria | 3429 |
| 349 | Ga0207700_10219714 | 3300025928 | Unclassified | 1610 |
| 350 | Ga0207664_10194683 | 3300025929 | Bacteria | 1747 |
| 351 | Ga0207644_10029901 | 3300025931 | Bacteria | 3782 |
| 352 | Ga0207644_10032104 | 3300025931 | Bacteria | 3661 |
| 353 | Ga0207644_10091874 | 3300025931 | Bacteria | 2264 |
| 354 | Ga0207644_10093635 | 3300025931 | Unclassified | 2243 |
| 355 | Ga0207644_10310470 | 3300025931 | Bacteria | 1273 |
| 356 | Ga0207644_10402378 | 3300025931 | Bacteria | 1119 |
| 357 | Ga0207706_10008411 | 3300025933 | Bacteria | 9522 |
| 358 | Ga0207706_10012445 | 3300025933 | Bacteria | 7752 |
| 359 | Ga0207706_10025875 | 3300025933 | Bacteria | 5255 |
| 360 | Ga0207706_10157172 | 3300025933 | Bacteria | 1999 |
| 361 | Ga0207670_10033258 | 3300025936 | Bacteria | 3321 |
| 362 | Ga0207670_10158742 | 3300025936 | Unclassified | 1686 |
| 363 | Ga0207669_10013374 | 3300025937 | Bacteria | 4072 |
| 364 | Ga0207669_10020170 | 3300025937 | Bacteria | 3488 |
| 365 | Ga0207669_10186104 | 3300025937 | Bacteria | 1493 |
| 366 | Ga0207704_10041027 | 3300025938 | Bacteria | 2710 |
| 367 | Ga0207665_10002889 | 3300025939 | Bacteria | 11524 |
| 368 | Ga0207665_10076280 | 3300025939 | Bacteria | 2298 |
| 369 | Ga0207665_10120287 | 3300025939 | Bacteria | 1854 |
| 370 | Ga0207665_10304853 | 3300025939 | Bacteria | 1191 |
| 371 | Ga0207691_10010431 | 3300025940 | Bacteria | 8914 |
| 372 | Ga0207691_10028541 | 3300025940 | Bacteria | 5224 |
| 373 | Ga0207691_10153220 | 3300025940 | Bacteria | 2026 |
| 374 | Ga0207691_10228090 | 3300025940 | Bacteria | 1613 |
| 375 | Ga0207691_10421093 | 3300025940 | Bacteria | 1138 |
| 376 | Ga0207711_10310151 | 3300025941 | Bacteria | 1457 |
| 377 | Ga0207661_10086125 | 3300025944 | Bacteria | 2606 |
| 378 | Ga0207661_10090864 | 3300025944 | Bacteria | 2543 |
| 379 | Ga0207679_10121424 | 3300025945 | Bacteria | 2081 |
| 380 | Ga0207651_10030013 | 3300025960 | Bacteria | 3455 |
| 381 | Ga0207651_10062025 | 3300025960 | Bacteria | 2603 |
| 382 | Ga0207651_10273957 | 3300025960 | Bacteria | 1391 |
| 383 | Ga0207712_10082106 | 3300025961 | Bacteria | 2349 |
| 384 | Ga0207668_10021116 | 3300025972 | Bacteria | 4149 |
| 385 | Ga0207677_10038703 | 3300026023 | Bacteria | 3129 |
| 386 | Ga0207677_10214718 | 3300026023 | Bacteria | 1539 |
| 387 | Ga0207677_10239180 | 3300026023 | Bacteria | 1468 |
| 388 | Ga0207677_10290301 | 3300026023 | Bacteria | 1347 |
| 389 | Ga0207703_10003475 | 3300026035 | Bacteria | 13192 |
| 390 | Ga0207703_10021358 | 3300026035 | Bacteria | 5068 |
| 391 | Ga0207703_10042374 | 3300026035 | Bacteria | 3651 |
| 392 | Ga0207703_10092542 | 3300026035 | Bacteria | 2545 |
| 393 | Ga0207639_10000032 | 3300026041 | Bacteria | 163200 |
| 394 | Ga0207678_10009556 | 3300026067 | Bacteria | 8530 |
| 395 | Ga0207678_10260615 | 3300026067 | Bacteria | 1486 |
| 396 | Ga0207708_10003639 | 3300026075 | Bacteria | 11369 |
| 397 | Ga0207702_10001213 | 3300026078 | Bacteria | 26152 |
| 398 | Ga0207641_10025943 | 3300026088 | Bacteria | 4835 |
| 399 | Ga0207641_10044372 | 3300026088 | Bacteria | 3739 |
| 400 | Ga0207648_10046947 | 3300026089 | Bacteria | 3786 |
| 401 | Ga0207675_100042959 | 3300026118 | Bacteria | 4221 |
| 402 | Ga0207683_10002403 | 3300026121 | Bacteria | 16353 |
| 403 | Ga0207683_10006136 | 3300026121 | Bacteria | 10295 |
| 404 | Ga0207683_10010617 | 3300026121 | Bacteria | 7854 |
| 405 | Ga0207683_10034825 | 3300026121 | Bacteria | 4378 |
| 406 | Ga0207683_10039296 | 3300026121 | Bacteria | 4128 |
| 407 | Ga0207683_10087370 | 3300026121 | Bacteria | 2773 |
| 408 | Ga0207428_10201979 | 3300027907 | Bacteria | 1495 |
| 409 | Ga0268266_10000035 | 3300028379 | Bacteria | 351632 |
| 410 | Ga0268266_10005284 | 3300028379 | Bacteria | 12125 |
| 411 | Ga0268266_10104972 | 3300028379 | Bacteria | 2495 |
| 412 | Ga0268264_10000357 | 3300028381 | Bacteria | 68576 |
| 413 | Ga0268264_10015640 | 3300028381 | Bacteria | 6214 |
| 414 | Ga0307405_10000705 | 3300031731 | Bacteria | 12985 |
| 415 | Ga0307410_10005922 | 3300031852 | Bacteria | 6536 |
| 416 | Ga0307406_10004526 | 3300031901 | Bacteria | 7572 |
| 417 | Ga0307407_10000488 | 3300031903 | Bacteria | 12215 |
| 418 | Ga0307412_10012198 | 3300031911 | Bacteria | 4997 |
| 419 | Ga0307409_100002090 | 3300031995 | Bacteria | 10270 |
| 420 | Ga0307409_100045942 | 3300031995 | Bacteria | 3302 |
| 421 | Ga0307409_100085208 | 3300031995 | Bacteria | 2568 |
| 422 | Ga0307416_100001096 | 3300032002 | Bacteria | 14491 |
| 423 | Ga0307414_10003838 | 3300032004 | Bacteria | 8088 |
| 424 | Ga0307411_10000856 | 3300032005 | Bacteria | 11439 |
| 425 | Ga0307415_100038346 | 3300032126 | Bacteria | 3157 |
| 426 | Ga0373936_0029733 | 3300035113 | Bacteria | 2152 |
| 427 | Ga0373957_0042064 | 3300035120 | Bacteria | 1723 |
| 428 | Ga0373946_0030606 | 3300035171 | Bacteria | 2150 |
| 429 | Ga0373955_0013148 | 3300035172 | Bacteria | 3993 |
| 430 | Ga0373935_0029415 | 3300035692 | Unclassified | 3401 |
| 431 | Ga0373937_0356522 | 3300036401 | Bacteria | 1386 |
| 432 | Ga0373925_0145570 | 3300037068 | Bacteria | 1857 |
| 433 | Ga0373925_0155570 | 3300037068 | Unclassified | 1798 |
| 434 | Ga0395899_0000032 | 3300037312 | Bacteria | 312705 |
| 435 | Ga0395899_0063447 | 3300037312 | Bacteria | 2718 |
| 436 | Ga0395900_0021221 | 3300037418 | Bacteria | 6641 |
| 437 | Ga0395900_0093654 | 3300037418 | Bacteria | 3086 |
| 438 | Ga0395900_0177328 | 3300037418 | Bacteria | 2167 |
| 439 | Ga0395898_0000562 | 3300037466 | Bacteria | 69459 |
| 440 | Ga0395898_0009649 | 3300037466 | Bacteria | 10134 |
| 441 | Ga0395905_0047592 | 3300037471 | Bacteria | 4018 |
| 442 | Ga0436364_0757601 | 3300037853 | Bacteria | 2902 |
| 443 | Ga0395901_0023212 | 3300038443 | Bacteria | 6359 |
| 444 | Ga0395901_0078520 | 3300038443 | Bacteria | 3447 |
| 445 | Ga0436365_0273579 | 3300039437 | Bacteria | 2609 |
| 446 | Ga0436365_0331687 | 3300039437 | Bacteria | 2289 |
| 447 | Ga0436365_0341737 | 3300039437 | Bacteria | 3888 |
| 448 | Ga0436365_1611898 | 3300039437 | Bacteria | 31421 |
| 449 | Ga0436365_1670361 | 3300039437 | Bacteria | 34125 |
| 450 | Ga0436360_0112463 | 3300039438 | Bacteria | 3054 |
| 451 | Ga0436360_0805228 | 3300039438 | Bacteria | 7230 |
| 452 | Ga0436360_1368532 | 3300039438 | Bacteria | 2039 |
| 453 | Ga0436361_0185988 | 3300039447 | Bacteria | 4222 |
| 454 | Ga0436361_0370321 | 3300039447 | Bacteria | 2993 |
| 455 | Ga0436361_0379036 | 3300039447 | Bacteria | 3414 |
| 456 | Ga0436361_0913064 | 3300039447 | Bacteria | 4625 |
| 457 | Ga0436361_0981302 | 3300039447 | Bacteria | 4385 |
| 458 | Ga0436361_1022396 | 3300039447 | Unclassified | 1271 |
| 459 | Ga0436363_0385326 | 3300039450 | Bacteria | 21920 |
| 460 | Ga0436363_0452248 | 3300039450 | Bacteria | 2644 |
| 461 | Ga0439451_013534 | 3300042009 | Bacteria | 1649 |
| 462 | Ga0451577_0001850 | 3300042876 | Bacteria | 26973 |
| 463 | Ga0466965_0002850 | 3300044683 | Bacteria | 7459 |
| 464 | Ga0466964_0074513 | 3300044706 | Bacteria | 1443 |
| 465 | Ga0466971_0000487 | 3300044719 | Bacteria | 15562 |
| 466 | Ga0466957_0009885 | 3300044842 | Bacteria | 5456 |
| 467 | Ga0466957_0024527 | 3300044842 | Bacteria | 3569 |
| 468 | Ga0451576_0025966 | 3300045051 | Bacteria | 6305 |
| 469 | Ga0466967_0065309 | 3300045976 | Bacteria | 3239 |
| 470 | Ga0495592_0002133 | 3300046454 | Bacteria | 13918 |
| 471 | Ga0495603_0154795 | 3300046455 | Bacteria | 1331 |
| 472 | Ga0495651_0198775 | 3300046462 | Bacteria | 1405 |
| 473 | Ga0495628_0001627 | 3300046516 | Bacteria | 20557 |
| 474 | Ga0495643_0000191 | 3300046522 | Bacteria | 97250 |
| 475 | Ga0495652_0010248 | 3300046529 | Bacteria | 8498 |
| 476 | Ga0495652_0169736 | 3300046529 | Bacteria | 1685 |
| 477 | Ga0495586_0082222 | 3300046535 | Bacteria | 1771 |
| 478 | Ga0495645_0035622 | 3300046543 | Unclassified | 3627 |
| 479 | Ga0495588_0041340 | 3300046674 | Bacteria | 2354 |
| 480 | Ga0495599_0018811 | 3300046678 | Unclassified | 4305 |
| 481 | Ga0495623_0020374 | 3300046679 | Bacteria | 4285 |
| 482 | Ga0495658_0140495 | 3300046683 | Unclassified | 1477 |
| 483 | Ga0495669_0010184 | 3300046684 | Bacteria | 3970 |
| 484 | Ga0495613_0112788 | 3300046689 | Unclassified | 1958 |
| 485 | Ga0495674_0190222 | 3300047319 | Bacteria | 1706 |
| 486 | Ga0495675_0003717 | 3300047444 | Bacteria | 9221 |
| 487 | Ga0495684_0014707 | 3300047471 | Bacteria | 6024 |
| 488 | Ga0495602_0032833 | 3300048088 | Unclassified | 4881 |
| 489 | Ga0496100_0054692 | 3300048903 | Unclassified | 2604 |
| 490 | Ga0496101_0003972 | 3300048904 | Bacteria | 9255 |
| 491 | Ga0496101_0116185 | 3300048904 | Bacteria | 2019 |
| 492 | Ga0496101_0223513 | 3300048904 | Bacteria | 1462 |
| 493 | Ga0496103_0008787 | 3300048906 | Bacteria | 5994 |
| 494 | Ga0496104_0024302 | 3300048907 | Bacteria | 5574 |
| 495 | Ga0496105_0021269 | 3300048908 | Bacteria | 5250 |
| 496 | Ga0496105_0042228 | 3300048908 | Bacteria | 3759 |
| 497 | Ga0496106_0023644 | 3300048909 | Bacteria | 4565 |
| 498 | Ga0496106_0133490 | 3300048909 | Bacteria | 1948 |
| 499 | Ga0496107_0004082 | 3300048910 | Bacteria | 9836 |
| 500 | Ga0496107_0181093 | 3300048910 | Unclassified | 1565 |
| 501 | Ga0496109_0055227 | 3300048912 | Bacteria | 3623 |
| 502 | Ga0496109_0114042 | 3300048912 | Bacteria | 2514 |
| 503 | Ga0496109_0117764 | 3300048912 | Bacteria | 2473 |
| 504 | Ga0496109_0208225 | 3300048912 | Bacteria | 1839 |
| 505 | Ga0496109_0292020 | 3300048912 | Bacteria | 1537 |
| 506 | Ga0496110_0068757 | 3300048913 | Bacteria | 3135 |
| 507 | Ga0496110_0275593 | 3300048913 | Bacteria | 1532 |
| 508 | Ga0496112_0007814 | 3300048915 | Bacteria | 9520 |
| 509 | Ga0496112_0042702 | 3300048915 | Bacteria | 4437 |
| 510 | Ga0496112_0058570 | 3300048915 | Bacteria | 3794 |
| 511 | Ga0496112_0077685 | 3300048915 | Bacteria | 3283 |
| 512 | Ga0496112_0108381 | 3300048915 | Bacteria | 2748 |
| 513 | Ga0496114_0012098 | 3300048917 | Bacteria | 6905 |
| 514 | Ga0496114_0123450 | 3300048917 | Bacteria | 2229 |
| 515 | Ga0496115_0004994 | 3300048918 | Bacteria | 9635 |
| 516 | Ga0496115_0007640 | 3300048918 | Bacteria | 7965 |
| 517 | Ga0496115_0088217 | 3300048918 | Bacteria | 2532 |
| 518 | Ga0496115_0095108 | 3300048918 | Bacteria | 2438 |
| 519 | Ga0496115_0155598 | 3300048918 | Bacteria | 1889 |
| 520 | Ga0501031_0004941 | 3300049568 | Bacteria | 8667 |
| 521 | Ga0501032_0003948 | 3300049569 | Bacteria | 11255 |
| 522 | Ga0501033_0000131 | 3300049570 | Bacteria | 72998 |
| 523 | Ga0501033_0000235 | 3300049570 | Bacteria | 53367 |
| 524 | Ga0501036_0123665 | 3300049572 | Bacteria | 2185 |
| 525 | Ga0501037_0000022 | 3300049573 | Bacteria | 147056 |
| 526 | Ga0501038_0013985 | 3300049574 | Bacteria | 7313 |
| 527 | Ga0501038_0032147 | 3300049574 | Bacteria | 4631 |
| 528 | Ga0501043_0001901 | 3300049579 | Bacteria | 17895 |
| 529 | Ga0501043_0009488 | 3300049579 | Bacteria | 7632 |
| 530 | Ga0501047_0028502 | 3300049581 | Bacteria | 5384 |
| 531 | Ga0501070_0000394 | 3300049586 | Bacteria | 40082 |
| 532 | Ga0501075_0356289 | 3300049591 | Bacteria | 1115 |
| 533 | Ga0501081_0158189 | 3300049743 | Bacteria | 1631 |
| 534 | Ga0501035_0000003 | 3300049822 | Bacteria | 557461 |
| 535 | Ga0501044_0000669 | 3300049823 | Bacteria | 41390 |
| 536 | nmdc:mga05p37_192038_c2 | 3300050507 | Bacteria | 1314 |
| 537 | nmdc:mga05p37_3050_c2 | 3300050507 | Bacteria | 9900 |
| 538 | nmdc:mga0n895_236461_c1 | 3300050512 | Bacteria | 1854 |
| 539 | nmdc:mga08x19_8867_c1 | 3300050514 | Bacteria | 5999 |
| 540 | Ga0495601_0001627 | 3300053077 | Bacteria | 12367 |
| 541 | Ga0500556_0002370 | 3300053104 | Bacteria | 6116 |
| 542 | Ga0500594_0031548 | 3300053118 | Bacteria | 1398 |
| 543 | Ga0500642_0042127 | 3300053130 | Bacteria | 1978 |
| 544 | Ga0500616_0004329 | 3300053153 | Bacteria | 10170 |
| 545 | Ga0466962_0000021 | 3300061719 | Bacteria | 89078 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10436561 | Ga0105245_104365611 | 271 |
| 2 | 3300048918 | Ga0496115_0155598 | Ga0496115_0155598_399_1334 | 295 |
| 3 | 3300013296 | Ga0157374_10176713 | Ga0157374_101767131 | 305 |
| 4 | 3300005445 | Ga0070708_100131620 | Ga0070708_1001316202 | 307 |
| 5 | 3300005468 | Ga0070707_100042472 | Ga0070707_1000424725 | 307 |
| 6 | 3300025922 | Ga0207646_10199480 | Ga0207646_101994802 | 307 |
| 7 | 3300009094 | Ga0111539_10099327 | Ga0111539_100993272 | 308 |
| 8 | 3300027907 | Ga0207428_10201979 | Ga0207428_102019792 | 308 |
| 9 | 3300049579 | Ga0501043_0001901 | Ga0501043_0001901_404_1330 | 308 |
| 10 | 3300025315 | Ga0207697_10038616 | Ga0207697_100386162 | 309 |
| 11 | 3300044683 | Ga0466965_0002850 | Ga0466965_0002850_2973_3902 | 309 |
| 12 | 3300044719 | Ga0466971_0000487 | Ga0466971_0000487_7160_8089 | 309 |
| 13 | 3300044842 | Ga0466957_0024527 | Ga0466957_0024527_605_1534 | 309 |
| 14 | 3300061719 | Ga0466962_0000021 | Ga0466962_0000021_51200_52129 | 309 |
| 15 | 3300005439 | Ga0070711_100081017 | Ga0070711_1000810172 | 312 |
| 16 | 3300042876 | Ga0451577_0001850 | Ga0451577_0001850_3665_4642 | 313 |
| 17 | 3300046683 | Ga0495658_0140495 | Ga0495658_0140495_10_960 | 316 |
| 18 | 3300005467 | Ga0070706_100000486 | Ga0070706_10000048625 | 317 |
| 19 | 3300025910 | Ga0207684_10000732 | Ga0207684_1000073221 | 317 |
| 20 | 3300005843 | Ga0068860_100424984 | Ga0068860_1004249842 | 318 |
| 21 | 3300013296 | Ga0157374_10000057 | Ga0157374_1000005790 | 318 |
| 22 | 3300014969 | Ga0157376_10000167 | Ga0157376_1000016712 | 318 |
| 23 | 3300006237 | Ga0097621_100166811 | Ga0097621_1001668111 | 320 |
| 24 | 3300037312 | Ga0395899_0063447 | Ga0395899_0063447_218_1186 | 320 |
| 25 | iso_pu_bacteria | 2786546548 | 2787508637 | 321 |
| 26 | 3300005458 | Ga0070681_10152872 | Ga0070681_101528722 | 323 |
| 27 | 3300025921 | Ga0207652_10141814 | Ga0207652_101418142 | 323 |
| 28 | 3300009545 | Ga0105237_10188280 | Ga0105237_101882802 | 324 |
| 29 | 3300053104 | Ga0500556_0002370 | Ga0500556_0002370_3934_4908 | 324 |
| 30 | 3300053118 | Ga0500594_0031548 | Ga0500594_0031548_264_1238 | 324 |
| 31 | 3300003323 | rootH1_10025348 | rootH1_100253485 | 325 |
| 32 | 3300005327 | Ga0070658_10172350 | Ga0070658_101723502 | 325 |
| 33 | 3300005539 | Ga0068853_100000019 | Ga0068853_10000001968 | 325 |
| 34 | 3300005548 | Ga0070665_100000045 | Ga0070665_100000045210 | 325 |
| 35 | 3300005614 | Ga0068856_100000034 | Ga0068856_10000003415 | 325 |
| 36 | 3300005842 | Ga0068858_100042252 | Ga0068858_1000422522 | 325 |
| 37 | 3300005937 | Ga0081455_10133291 | Ga0081455_101332912 | 325 |
| 38 | 3300005981 | Ga0081538_10089434 | Ga0081538_100894342 | 325 |
| 39 | 3300005983 | Ga0081540_1018113 | Ga0081540_10181132 | 325 |
| 40 | 3300009093 | Ga0105240_10051315 | Ga0105240_100513153 | 325 |
| 41 | 3300013306 | Ga0163162_10602761 | Ga0163162_106027612 | 325 |
| 42 | 3300025913 | Ga0207695_10037840 | Ga0207695_100378403 | 325 |
| 43 | 3300026035 | Ga0207703_10003475 | Ga0207703_100034759 | 325 |
| 44 | 3300026041 | Ga0207639_10000032 | Ga0207639_1000003269 | 325 |
| 45 | 3300026078 | Ga0207702_10001213 | Ga0207702_100012134 | 325 |
| 46 | 3300028379 | Ga0268266_10000035 | Ga0268266_10000035111 | 325 |
| 47 | 3300037312 | Ga0395899_0000032 | Ga0395899_0000032_248900_249877 | 325 |
| 48 | 3300037466 | Ga0395898_0000562 | Ga0395898_0000562_49148_50125 | 325 |
| 49 | 3300044842 | Ga0466957_0009885 | Ga0466957_0009885_383_1360 | 325 |
| 50 | 3300046535 | Ga0495586_0082222 | Ga0495586_0082222_207_1196 | 325 |
| 51 | 3300003320 | rootH2_10016401 | rootH2_100164018 | 326 |
| 52 | 3300005366 | Ga0070659_100311642 | Ga0070659_1003116421 | 326 |
| 53 | 3300005842 | Ga0068858_100145821 | Ga0068858_1001458211 | 326 |
| 54 | 3300026035 | Ga0207703_10092542 | Ga0207703_100925424 | 326 |
| 55 | 3300039447 | Ga0436361_0185988 | Ga0436361_0185988_2747_3745 | 326 |
| 56 | 3300005842 | Ga0068858_100050555 | Ga0068858_1000505551 | 327 |
| 57 | 3300026035 | Ga0207703_10042374 | Ga0207703_100423743 | 327 |
| 58 | 3300031731 | Ga0307405_10000705 | Ga0307405_100007051 | 327 |
| 59 | 3300031852 | Ga0307410_10005922 | Ga0307410_100059222 | 327 |
| 60 | 3300031901 | Ga0307406_10004526 | Ga0307406_100045262 | 327 |
| 61 | 3300031903 | Ga0307407_10000488 | Ga0307407_1000048810 | 327 |
| 62 | 3300031911 | Ga0307412_10012198 | Ga0307412_100121982 | 327 |
| 63 | 3300031995 | Ga0307409_100002090 | Ga0307409_1000020905 | 327 |
| 64 | 3300031995 | Ga0307409_100045942 | Ga0307409_1000459422 | 327 |
| 65 | 3300032002 | Ga0307416_100001096 | Ga0307416_1000010968 | 327 |
| 66 | 3300032004 | Ga0307414_10003838 | Ga0307414_100038387 | 327 |
| 67 | 3300032005 | Ga0307411_10000856 | Ga0307411_1000085610 | 327 |
| 68 | 3300039437 | Ga0436365_0341737 | Ga0436365_0341737_1570_2580 | 327 |
| 69 | 3300045051 | Ga0451576_0025966 | Ga0451576_0025966_3399_4382 | 327 |
| 70 | 3300049568 | Ga0501031_0004941 | Ga0501031_0004941_570_1559 | 327 |
| 71 | 3300049572 | Ga0501036_0123665 | Ga0501036_0123665_263_1252 | 327 |
| 72 | 3300049573 | Ga0501037_0000022 | Ga0501037_0000022_66096_67085 | 327 |
| 73 | 3300049579 | Ga0501043_0009488 | Ga0501043_0009488_6341_7330 | 327 |
| 74 | 3300049581 | Ga0501047_0028502 | Ga0501047_0028502_595_1584 | 327 |
| 75 | 3300049586 | Ga0501070_0000394 | Ga0501070_0000394_26468_27457 | 327 |
| 76 | 3300049822 | Ga0501035_0000003 | Ga0501035_0000003_539302_540291 | 327 |
| 77 | 3300049823 | Ga0501044_0000669 | Ga0501044_0000669_32846_33835 | 327 |
| 78 | 3300053153 | Ga0500616_0004329 | Ga0500616_0004329_500_1483 | 327 |
| 79 | 3300005841 | Ga0068863_100102701 | Ga0068863_1001027012 | 329 |
| 80 | 3300026088 | Ga0207641_10025943 | Ga0207641_100259433 | 329 |
| 81 | 3300001991 | JGI24743J22301_10001127 | JGI24743J22301_100011274 | 330 |
| 82 | 3300005327 | Ga0070658_10010667 | Ga0070658_100106674 | 330 |
| 83 | 3300005331 | Ga0070670_100155829 | Ga0070670_1001558292 | 330 |
| 84 | 3300005435 | Ga0070714_100219283 | Ga0070714_1002192831 | 330 |
| 85 | 3300005436 | Ga0070713_100002205 | Ga0070713_1000022055 | 330 |
| 86 | 3300009093 | Ga0105240_10000043 | Ga0105240_10000043167 | 330 |
| 87 | 3300013297 | Ga0157378_10229860 | Ga0157378_102298602 | 330 |
| 88 | 3300021361 | Ga0213872_10016774 | Ga0213872_100167743 | 330 |
| 89 | 3300021361 | Ga0213872_10071725 | Ga0213872_100717251 | 330 |
| 90 | 3300021361 | Ga0213872_10072238 | Ga0213872_100722381 | 330 |
| 91 | 3300021384 | Ga0213876_10015249 | Ga0213876_100152492 | 330 |
| 92 | 3300025909 | Ga0207705_10010015 | Ga0207705_100100159 | 330 |
| 93 | 3300025913 | Ga0207695_10000181 | Ga0207695_10000181116 | 330 |
| 94 | 3300025929 | Ga0207664_10194683 | Ga0207664_101946832 | 330 |
| 95 | 3300039437 | Ga0436365_0331687 | Ga0436365_0331687_897_1895 | 330 |
| 96 | 3300039437 | Ga0436365_1611898 | Ga0436365_1611898_8637_9641 | 330 |
| 97 | 3300039438 | Ga0436360_0805228 | Ga0436360_0805228_4327_5334 | 330 |
| 98 | 3300039438 | Ga0436360_1368532 | Ga0436360_1368532_173_1180 | 330 |
| 99 | 3300039447 | Ga0436361_0913064 | Ga0436361_0913064_2826_3830 | 330 |
| 100 | 3300039450 | Ga0436363_0452248 | Ga0436363_0452248_1495_2493 | 330 |
| 101 | 3300049570 | Ga0501033_0000131 | Ga0501033_0000131_58188_59219 | 330 |
| 102 | 3300049574 | Ga0501038_0032147 | Ga0501038_0032147_1942_2973 | 330 |
| 103 | 3300053130 | Ga0500642_0042127 | Ga0500642_0042127_364_1356 | 330 |
| 104 | 3300003791 | Ga0055530_10010894 | Ga0055530_100108943 | 331 |
| 105 | 3300005434 | Ga0070709_10113801 | Ga0070709_101138011 | 331 |
| 106 | 3300005436 | Ga0070713_100010603 | Ga0070713_1000106032 | 331 |
| 107 | 3300005437 | Ga0070710_10020816 | Ga0070710_100208162 | 331 |
| 108 | 3300005445 | Ga0070708_100013304 | Ga0070708_1000133044 | 331 |
| 109 | 3300005467 | Ga0070706_100083158 | Ga0070706_1000831581 | 331 |
| 110 | 3300005471 | Ga0070698_100001910 | Ga0070698_1000019109 | 331 |
| 111 | 3300005471 | Ga0070698_100001955 | Ga0070698_1000019553 | 331 |
| 112 | 3300005536 | Ga0070697_100041927 | Ga0070697_1000419275 | 331 |
| 113 | 3300005536 | Ga0070697_100092839 | Ga0070697_1000928392 | 331 |
| 114 | 3300006028 | Ga0070717_10022602 | Ga0070717_100226024 | 331 |
| 115 | 3300006028 | Ga0070717_10208540 | Ga0070717_102085402 | 331 |
| 116 | 3300007788 | Ga0099795_10042549 | Ga0099795_100425491 | 331 |
| 117 | 3300013307 | Ga0157372_10057724 | Ga0157372_100577242 | 331 |
| 118 | 3300021361 | Ga0213872_10003443 | Ga0213872_100034433 | 331 |
| 119 | 3300025298 | Ga0209050_1001026 | Ga0209050_10010263 | 331 |
| 120 | 3300025906 | Ga0207699_10006262 | Ga0207699_100062624 | 331 |
| 121 | 3300025910 | Ga0207684_10056115 | Ga0207684_100561152 | 331 |
| 122 | 3300025910 | Ga0207684_10086660 | Ga0207684_100866602 | 331 |
| 123 | 3300025928 | Ga0207700_10039694 | Ga0207700_100396942 | 331 |
| 124 | 3300025939 | Ga0207665_10076280 | Ga0207665_100762802 | 331 |
| 125 | 3300039447 | Ga0436361_0981302 | Ga0436361_0981302_1947_2966 | 331 |
| 126 | 3300039450 | Ga0436363_0385326 | Ga0436363_0385326_18904_19923 | 331 |
| 127 | 3300038443 | Ga0395901_0023212 | Ga0395901_0023212_1590_2591 | 332 |
| 128 | 3300039438 | Ga0436360_0112463 | Ga0436360_0112463_14_1036 | 332 |
| 129 | 3300039447 | Ga0436361_1022396 | Ga0436361_1022396_33_1037 | 332 |
| 130 | 3300002155 | JGI24033J26618_1000063 | JGI24033J26618_100006313 | 333 |
| 131 | 3300003320 | rootH2_10006650 | rootH2_100066509 | 333 |
| 132 | 3300003322 | rootL2_10043152 | rootL2_1004315212 | 333 |
| 133 | 3300005344 | Ga0070661_100000788 | Ga0070661_10000078815 | 333 |
| 134 | 3300005456 | Ga0070678_100089327 | Ga0070678_1000893272 | 333 |
| 135 | 3300009551 | Ga0105238_10044916 | Ga0105238_100449161 | 333 |
| 136 | 3300013296 | Ga0157374_10044145 | Ga0157374_100441453 | 333 |
| 137 | 3300013308 | Ga0157375_10179016 | Ga0157375_101790163 | 333 |
| 138 | 3300021384 | Ga0213876_10033943 | Ga0213876_100339432 | 333 |
| 139 | 3300025920 | Ga0207649_10001293 | Ga0207649_1000129310 | 333 |
| 140 | 3300026121 | Ga0207683_10087370 | Ga0207683_100873703 | 333 |
| 141 | 3300039437 | Ga0436365_0273579 | Ga0436365_0273579_1378_2403 | 333 |
| 142 | 3300046522 | Ga0495643_0000191 | Ga0495643_0000191_62714_63727 | 333 |
| 143 | 3300049569 | Ga0501032_0003948 | Ga0501032_0003948_2397_3398 | 333 |
| 144 | 3300049570 | Ga0501033_0000235 | Ga0501033_0000235_8080_9081 | 333 |
| 145 | 3300049574 | Ga0501038_0013985 | Ga0501038_0013985_5912_6913 | 333 |
| 146 | 3300005289 | Ga0065704_10005956 | Ga0065704_100059563 | 334 |
| 147 | 3300005290 | Ga0065712_10092062 | Ga0065712_100920623 | 334 |
| 148 | 3300005293 | Ga0065715_10008361 | Ga0065715_100083618 | 334 |
| 149 | 3300005330 | Ga0070690_100087288 | Ga0070690_1000872883 | 334 |
| 150 | 3300005338 | Ga0068868_100038723 | Ga0068868_1000387235 | 334 |
| 151 | 3300005343 | Ga0070687_100073720 | Ga0070687_1000737202 | 334 |
| 152 | 3300005347 | Ga0070668_100001931 | Ga0070668_1000019314 | 334 |
| 153 | 3300005353 | Ga0070669_100045734 | Ga0070669_1000457341 | 334 |
| 154 | 3300005437 | Ga0070710_10068336 | Ga0070710_100683362 | 334 |
| 155 | 3300005440 | Ga0070705_100014022 | Ga0070705_1000140222 | 334 |
| 156 | 3300005456 | Ga0070678_100080474 | Ga0070678_1000804742 | 334 |
| 157 | 3300005458 | Ga0070681_10379759 | Ga0070681_103797591 | 334 |
| 158 | 3300005459 | Ga0068867_100075612 | Ga0068867_1000756123 | 334 |
| 159 | 3300005467 | Ga0070706_100050788 | Ga0070706_1000507885 | 334 |
| 160 | 3300005543 | Ga0070672_100004102 | Ga0070672_1000041025 | 334 |
| 161 | 3300005546 | Ga0070696_100016980 | Ga0070696_1000169802 | 334 |
| 162 | 3300005548 | Ga0070665_100061296 | Ga0070665_1000612964 | 334 |
| 163 | 3300005548 | Ga0070665_100093570 | Ga0070665_1000935702 | 334 |
| 164 | 3300005549 | Ga0070704_100098571 | Ga0070704_1000985712 | 334 |
| 165 | 3300005614 | Ga0068856_100037919 | Ga0068856_1000379196 | 334 |
| 166 | 3300005843 | Ga0068860_100000267 | Ga0068860_10000026712 | 334 |
| 167 | 3300009098 | Ga0105245_10120109 | Ga0105245_101201091 | 334 |
| 168 | 3300009098 | Ga0105245_10502662 | Ga0105245_105026621 | 334 |
| 169 | 3300009101 | Ga0105247_10054966 | Ga0105247_100549664 | 334 |
| 170 | 3300009174 | Ga0105241_10201501 | Ga0105241_102015012 | 334 |
| 171 | 3300013102 | Ga0157371_10038347 | Ga0157371_100383474 | 334 |
| 172 | 3300013296 | Ga0157374_10201975 | Ga0157374_102019752 | 334 |
| 173 | 3300013297 | Ga0157378_10112062 | Ga0157378_101120622 | 334 |
| 174 | 3300013308 | Ga0157375_10023425 | Ga0157375_100234254 | 334 |
| 175 | 3300013308 | Ga0157375_10176708 | Ga0157375_101767082 | 334 |
| 176 | 3300017792 | Ga0163161_10001720 | Ga0163161_100017203 | 334 |
| 177 | 3300025315 | Ga0207697_10001019 | Ga0207697_1000101910 | 334 |
| 178 | 3300025912 | Ga0207707_10441752 | Ga0207707_104417521 | 334 |
| 179 | 3300025915 | Ga0207693_10061905 | Ga0207693_100619052 | 334 |
| 180 | 3300025916 | Ga0207663_10156417 | Ga0207663_101564172 | 334 |
| 181 | 3300025926 | Ga0207659_10006886 | Ga0207659_100068862 | 334 |
| 182 | 3300025926 | Ga0207659_10023427 | Ga0207659_100234274 | 334 |
| 183 | 3300025931 | Ga0207644_10093635 | Ga0207644_100936353 | 334 |
| 184 | 3300025931 | Ga0207644_10402378 | Ga0207644_104023781 | 334 |
| 185 | 3300025933 | Ga0207706_10025875 | Ga0207706_100258753 | 334 |
| 186 | 3300025937 | Ga0207669_10186104 | Ga0207669_101861042 | 334 |
| 187 | 3300025939 | Ga0207665_10002889 | Ga0207665_100028899 | 334 |
| 188 | 3300025940 | Ga0207691_10010431 | Ga0207691_100104316 | 334 |
| 189 | 3300025960 | Ga0207651_10273957 | Ga0207651_102739572 | 334 |
| 190 | 3300026023 | Ga0207677_10038703 | Ga0207677_100387034 | 334 |
| 191 | 3300026089 | Ga0207648_10046947 | Ga0207648_100469474 | 334 |
| 192 | 3300026121 | Ga0207683_10006136 | Ga0207683_100061366 | 334 |
| 193 | 3300026121 | Ga0207683_10039296 | Ga0207683_100392963 | 334 |
| 194 | 3300028381 | Ga0268264_10000357 | Ga0268264_1000035713 | 334 |
| 195 | 3300035113 | Ga0373936_0029733 | Ga0373936_0029733_12_1016 | 334 |
| 196 | 3300048903 | Ga0496100_0054692 | Ga0496100_0054692_342_1346 | 334 |
| 197 | 3300048904 | Ga0496101_0003972 | Ga0496101_0003972_7538_8542 | 334 |
| 198 | 3300048906 | Ga0496103_0008787 | Ga0496103_0008787_3041_4045 | 334 |
| 199 | 3300048908 | Ga0496105_0042228 | Ga0496105_0042228_161_1165 | 334 |
| 200 | 3300048909 | Ga0496106_0023644 | Ga0496106_0023644_3106_4110 | 334 |
| 201 | 3300048910 | Ga0496107_0004082 | Ga0496107_0004082_2103_3107 | 334 |
| 202 | 3300048910 | Ga0496107_0181093 | Ga0496107_0181093_512_1516 | 334 |
| 203 | 3300048912 | Ga0496109_0114042 | Ga0496109_0114042_754_1794 | 334 |
| 204 | 3300048912 | Ga0496109_0117764 | Ga0496109_0117764_32_1036 | 334 |
| 205 | 3300048915 | Ga0496112_0007814 | Ga0496112_0007814_6536_7576 | 334 |
| 206 | 3300048915 | Ga0496112_0077685 | Ga0496112_0077685_213_1217 | 334 |
| 207 | 3300048918 | Ga0496115_0007640 | Ga0496115_0007640_2667_3671 | 334 |
| 208 | 3300005290 | Ga0065712_10110450 | Ga0065712_101104502 | 335 |
| 209 | 3300005293 | Ga0065715_10159950 | Ga0065715_101599501 | 335 |
| 210 | 3300005331 | Ga0070670_100006070 | Ga0070670_10000607011 | 335 |
| 211 | 3300005333 | Ga0070677_10091281 | Ga0070677_100912811 | 335 |
| 212 | 3300005335 | Ga0070666_10034276 | Ga0070666_100342763 | 335 |
| 213 | 3300005335 | Ga0070666_10035080 | Ga0070666_100350802 | 335 |
| 214 | 3300005338 | Ga0068868_100023781 | Ga0068868_1000237815 | 335 |
| 215 | 3300005340 | Ga0070689_100023688 | Ga0070689_1000236885 | 335 |
| 216 | 3300005353 | Ga0070669_100036447 | Ga0070669_1000364472 | 335 |
| 217 | 3300005353 | Ga0070669_100104198 | Ga0070669_1001041982 | 335 |
| 218 | 3300005355 | Ga0070671_100010298 | Ga0070671_1000102986 | 335 |
| 219 | 3300005355 | Ga0070671_100024517 | Ga0070671_1000245175 | 335 |
| 220 | 3300005356 | Ga0070674_100011159 | Ga0070674_1000111592 | 335 |
| 221 | 3300005356 | Ga0070674_100011784 | Ga0070674_1000117845 | 335 |
| 222 | 3300005364 | Ga0070673_100005630 | Ga0070673_1000056303 | 335 |
| 223 | 3300005365 | Ga0070688_100005067 | Ga0070688_1000050672 | 335 |
| 224 | 3300005440 | Ga0070705_100209464 | Ga0070705_1002094642 | 335 |
| 225 | 3300005445 | Ga0070708_100021827 | Ga0070708_1000218274 | 335 |
| 226 | 3300005456 | Ga0070678_100054406 | Ga0070678_1000544062 | 335 |
| 227 | 3300005456 | Ga0070678_100078967 | Ga0070678_1000789672 | 335 |
| 228 | 3300005466 | Ga0070685_10062305 | Ga0070685_100623052 | 335 |
| 229 | 3300005467 | Ga0070706_100020767 | Ga0070706_1000207675 | 335 |
| 230 | 3300005536 | Ga0070697_100000863 | Ga0070697_1000008633 | 335 |
| 231 | 3300005543 | Ga0070672_100017190 | Ga0070672_1000171905 | 335 |
| 232 | 3300005543 | Ga0070672_100182741 | Ga0070672_1001827412 | 335 |
| 233 | 3300005548 | Ga0070665_100330318 | Ga0070665_1003303182 | 335 |
| 234 | 3300005564 | Ga0070664_100133864 | Ga0070664_1001338641 | 335 |
| 235 | 3300005564 | Ga0070664_100366233 | Ga0070664_1003662332 | 335 |
| 236 | 3300005616 | Ga0068852_100115316 | Ga0068852_1001153164 | 335 |
| 237 | 3300006175 | Ga0070712_100111713 | Ga0070712_1001117132 | 335 |
| 238 | 3300006175 | Ga0070712_100271488 | Ga0070712_1002714882 | 335 |
| 239 | 3300006881 | Ga0068865_100051332 | Ga0068865_1000513322 | 335 |
| 240 | 3300006881 | Ga0068865_100100784 | Ga0068865_1001007843 | 335 |
| 241 | 3300009147 | Ga0114129_10035429 | Ga0114129_100354295 | 335 |
| 242 | 3300009545 | Ga0105237_10288777 | Ga0105237_102887772 | 335 |
| 243 | 3300010375 | Ga0105239_10551247 | Ga0105239_105512472 | 335 |
| 244 | 3300013296 | Ga0157374_10004496 | Ga0157374_1000449611 | 335 |
| 245 | 3300013296 | Ga0157374_10007233 | Ga0157374_100072335 | 335 |
| 246 | 3300013297 | Ga0157378_10018503 | Ga0157378_100185034 | 335 |
| 247 | 3300013297 | Ga0157378_10054393 | Ga0157378_100543932 | 335 |
| 248 | 3300013306 | Ga0163162_10025378 | Ga0163162_100253786 | 335 |
| 249 | 3300013306 | Ga0163162_10047251 | Ga0163162_100472512 | 335 |
| 250 | 3300013306 | Ga0163162_10060882 | Ga0163162_100608822 | 335 |
| 251 | 3300013308 | Ga0157375_10008603 | Ga0157375_100086039 | 335 |
| 252 | 3300014969 | Ga0157376_10321217 | Ga0157376_103212172 | 335 |
| 253 | 3300025315 | Ga0207697_10002216 | Ga0207697_100022168 | 335 |
| 254 | 3300025315 | Ga0207697_10011392 | Ga0207697_100113923 | 335 |
| 255 | 3300025907 | Ga0207645_10025105 | Ga0207645_100251056 | 335 |
| 256 | 3300025914 | Ga0207671_10101182 | Ga0207671_101011822 | 335 |
| 257 | 3300025915 | Ga0207693_10041825 | Ga0207693_100418254 | 335 |
| 258 | 3300025923 | Ga0207681_10036357 | Ga0207681_100363573 | 335 |
| 259 | 3300025926 | Ga0207659_10113072 | Ga0207659_101130722 | 335 |
| 260 | 3300025931 | Ga0207644_10029901 | Ga0207644_100299012 | 335 |
| 261 | 3300025931 | Ga0207644_10032104 | Ga0207644_100321045 | 335 |
| 262 | 3300025931 | Ga0207644_10310470 | Ga0207644_103104701 | 335 |
| 263 | 3300025933 | Ga0207706_10008411 | Ga0207706_100084112 | 335 |
| 264 | 3300025937 | Ga0207669_10013374 | Ga0207669_100133742 | 335 |
| 265 | 3300025937 | Ga0207669_10020170 | Ga0207669_100201702 | 335 |
| 266 | 3300025938 | Ga0207704_10041027 | Ga0207704_100410273 | 335 |
| 267 | 3300025940 | Ga0207691_10028541 | Ga0207691_100285415 | 335 |
| 268 | 3300025940 | Ga0207691_10228090 | Ga0207691_102280902 | 335 |
| 269 | 3300025960 | Ga0207651_10030013 | Ga0207651_100300133 | 335 |
| 270 | 3300025960 | Ga0207651_10062025 | Ga0207651_100620251 | 335 |
| 271 | 3300026023 | Ga0207677_10214718 | Ga0207677_102147182 | 335 |
| 272 | 3300026121 | Ga0207683_10002403 | Ga0207683_100024033 | 335 |
| 273 | 3300026121 | Ga0207683_10010617 | Ga0207683_100106179 | 335 |
| 274 | 3300028379 | Ga0268266_10005284 | Ga0268266_1000528411 | 335 |
| 275 | 3300036401 | Ga0373937_0356522 | Ga0373937_0356522_239_1246 | 335 |
| 276 | 3300048912 | Ga0496109_0292020 | Ga0496109_0292020_199_1206 | 335 |
| 277 | 3300048913 | Ga0496110_0275593 | Ga0496110_0275593_429_1436 | 335 |
| 278 | 3300048915 | Ga0496112_0058570 | Ga0496112_0058570_2473_3480 | 335 |
| 279 | 3300050507 | nmdc:mga05p37_192038_c2 | nmdc:mga05p37_192038_c2_45_1052 | 335 |
| 280 | 3300005328 | Ga0070676_10074588 | Ga0070676_100745882 | 336 |
| 281 | 3300005330 | Ga0070690_100144709 | Ga0070690_1001447092 | 336 |
| 282 | 3300005536 | Ga0070697_100121632 | Ga0070697_1001216322 | 336 |
| 283 | 3300005985 | Ga0081539_10001918 | Ga0081539_100019189 | 336 |
| 284 | 3300006358 | Ga0068871_100004871 | Ga0068871_10000487110 | 336 |
| 285 | 3300006871 | Ga0075434_100152428 | Ga0075434_1001524282 | 336 |
| 286 | 3300006914 | Ga0075436_100020242 | Ga0075436_1000202423 | 336 |
| 287 | 3300013297 | Ga0157378_10068364 | Ga0157378_100683642 | 336 |
| 288 | 3300013308 | Ga0157375_10297905 | Ga0157375_102979052 | 336 |
| 289 | 3300025931 | Ga0207644_10091874 | Ga0207644_100918741 | 336 |
| 290 | 3300035172 | Ga0373955_0013148 | Ga0373955_0013148_528_1538 | 336 |
| 291 | 3300037068 | Ga0373925_0155570 | Ga0373925_0155570_90_1100 | 336 |
| 292 | 3300045976 | Ga0466967_0065309 | Ga0466967_0065309_1306_2316 | 336 |
| 293 | 3300046529 | Ga0495652_0169736 | Ga0495652_0169736_441_1451 | 336 |
| 294 | 3300046679 | Ga0495623_0020374 | Ga0495623_0020374_3096_4121 | 336 |
| 295 | 3300046689 | Ga0495613_0112788 | Ga0495613_0112788_212_1222 | 336 |
| 296 | 3300047319 | Ga0495674_0190222 | Ga0495674_0190222_502_1512 | 336 |
| 297 | 3300047471 | Ga0495684_0014707 | Ga0495684_0014707_1608_2618 | 336 |
| 298 | 3300048904 | Ga0496101_0223513 | Ga0496101_0223513_69_1079 | 336 |
| 299 | 3300048912 | Ga0496109_0208225 | Ga0496109_0208225_767_1777 | 336 |
| 300 | 3300048915 | Ga0496112_0108381 | Ga0496112_0108381_42_1052 | 336 |
| 301 | 3300048917 | Ga0496114_0012098 | Ga0496114_0012098_1302_2312 | 336 |
| 302 | 3300048918 | Ga0496115_0095108 | Ga0496115_0095108_201_1211 | 336 |
| 303 | 3300050512 | nmdc:mga0n895_236461_c1 | nmdc:mga0n895_236461_c1_99_1109 | 336 |
| 304 | 3300050514 | nmdc:mga08x19_8867_c1 | nmdc:mga08x19_8867_c1_2556_3566 | 336 |
| 305 | 3300005435 | Ga0070714_100223906 | Ga0070714_1002239062 | 337 |
| 306 | 3300005842 | Ga0068858_100079108 | Ga0068858_1000791082 | 337 |
| 307 | 3300009176 | Ga0105242_10029291 | Ga0105242_100292914 | 337 |
| 308 | 3300009545 | Ga0105237_10001748 | Ga0105237_1000174819 | 337 |
| 309 | 3300049591 | Ga0501075_0356289 | Ga0501075_0356289_65_1090 | 338 |
| 310 | 3300049743 | Ga0501081_0158189 | Ga0501081_0158189_405_1430 | 338 |
| 311 | 3300003320 | rootH2_10005428 | rootH2_100054283 | 339 |
| 312 | 3300005293 | Ga0065715_10127476 | Ga0065715_101274762 | 339 |
| 313 | 3300005467 | Ga0070706_100235119 | Ga0070706_1002351192 | 339 |
| 314 | 3300005468 | Ga0070707_100000439 | Ga0070707_10000043941 | 339 |
| 315 | 3300005468 | Ga0070707_100061615 | Ga0070707_1000616154 | 339 |
| 316 | 3300005468 | Ga0070707_100150068 | Ga0070707_1001500682 | 339 |
| 317 | 3300005536 | Ga0070697_100042181 | Ga0070697_1000421814 | 339 |
| 318 | 3300005536 | Ga0070697_100097846 | Ga0070697_1000978462 | 339 |
| 319 | 3300005536 | Ga0070697_100189869 | Ga0070697_1001898692 | 339 |
| 320 | 3300005545 | Ga0070695_100047723 | Ga0070695_1000477233 | 339 |
| 321 | 3300006871 | Ga0075434_100215594 | Ga0075434_1002155942 | 339 |
| 322 | 3300009553 | Ga0105249_10237894 | Ga0105249_102378942 | 339 |
| 323 | 3300025915 | Ga0207693_10012437 | Ga0207693_100124374 | 339 |
| 324 | 3300025922 | Ga0207646_10000358 | Ga0207646_1000035853 | 339 |
| 325 | 3300025922 | Ga0207646_10157121 | Ga0207646_101571212 | 339 |
| 326 | 3300025922 | Ga0207646_10164142 | Ga0207646_101641422 | 339 |
| 327 | 3300025926 | Ga0207659_10095941 | Ga0207659_100959412 | 339 |
| 328 | 3300025928 | Ga0207700_10219714 | Ga0207700_102197142 | 339 |
| 329 | 3300031995 | Ga0307409_100085208 | Ga0307409_1000852083 | 339 |
| 330 | 3300032126 | Ga0307415_100038346 | Ga0307415_1000383462 | 339 |
| 331 | 3300039447 | Ga0436361_0379036 | Ga0436361_0379036_2100_3146 | 339 |
| 332 | 3300005467 | Ga0070706_100081188 | Ga0070706_1000811884 | 340 |
| 333 | 3300005468 | Ga0070707_100085073 | Ga0070707_1000850732 | 340 |
| 334 | 3300005471 | Ga0070698_100015938 | Ga0070698_1000159386 | 340 |
| 335 | 3300005471 | Ga0070698_100071646 | Ga0070698_1000716462 | 340 |
| 336 | 3300005518 | Ga0070699_100046511 | Ga0070699_1000465113 | 340 |
| 337 | 3300005536 | Ga0070697_100001033 | Ga0070697_10000103314 | 340 |
| 338 | 3300005536 | Ga0070697_100047090 | Ga0070697_1000470903 | 340 |
| 339 | 3300005536 | Ga0070697_100266370 | Ga0070697_1002663702 | 340 |
| 340 | 3300005937 | Ga0081455_10004485 | Ga0081455_1000448510 | 340 |
| 341 | 3300005985 | Ga0081539_10000026 | Ga0081539_1000002641 | 340 |
| 342 | 3300005985 | Ga0081539_10024423 | Ga0081539_100244233 | 340 |
| 343 | 3300006028 | Ga0070717_10025634 | Ga0070717_100256344 | 340 |
| 344 | 3300006028 | Ga0070717_10105109 | Ga0070717_101051093 | 340 |
| 345 | 3300006173 | Ga0070716_100022474 | Ga0070716_1000224742 | 340 |
| 346 | 3300009098 | Ga0105245_10349057 | Ga0105245_103490572 | 340 |
| 347 | 3300013296 | Ga0157374_10037911 | Ga0157374_100379112 | 340 |
| 348 | 3300013297 | Ga0157378_10024006 | Ga0157378_100240065 | 340 |
| 349 | 3300013297 | Ga0157378_10078171 | Ga0157378_100781712 | 340 |
| 350 | 3300025910 | Ga0207684_10034250 | Ga0207684_100342502 | 340 |
| 351 | 3300025910 | Ga0207684_10078986 | Ga0207684_100789864 | 340 |
| 352 | 3300025922 | Ga0207646_10000504 | Ga0207646_1000050437 | 340 |
| 353 | 3300025922 | Ga0207646_10113637 | Ga0207646_101136373 | 340 |
| 354 | 3300025922 | Ga0207646_10117084 | Ga0207646_101170843 | 340 |
| 355 | 3300025922 | Ga0207646_10348454 | Ga0207646_103484541 | 340 |
| 356 | 3300025927 | Ga0207687_10166765 | Ga0207687_101667653 | 340 |
| 357 | 3300025936 | Ga0207670_10158742 | Ga0207670_101587422 | 340 |
| 358 | 3300025940 | Ga0207691_10421093 | Ga0207691_104210931 | 340 |
| 359 | 3300026023 | Ga0207677_10290301 | Ga0207677_102903011 | 340 |
| 360 | 3300026067 | Ga0207678_10260615 | Ga0207678_102606151 | 340 |
| 361 | 3300001990 | JGI24737J22298_10050373 | JGI24737J22298_100503731 | 341 |
| 362 | 3300003659 | JGI25404J52841_10001788 | JGI25404J52841_100017881 | 341 |
| 363 | 3300005289 | Ga0065704_10110450 | Ga0065704_101104501 | 341 |
| 364 | 3300005289 | Ga0065704_10209150 | Ga0065704_102091501 | 341 |
| 365 | 3300005290 | Ga0065712_10002047 | Ga0065712_100020473 | 341 |
| 366 | 3300005290 | Ga0065712_10004529 | Ga0065712_100045292 | 341 |
| 367 | 3300005290 | Ga0065712_10089630 | Ga0065712_100896303 | 341 |
| 368 | 3300005293 | Ga0065715_10091931 | Ga0065715_100919314 | 341 |
| 369 | 3300005293 | Ga0065715_10099155 | Ga0065715_100991553 | 341 |
| 370 | 3300005295 | Ga0065707_10113797 | Ga0065707_101137971 | 341 |
| 371 | 3300005328 | Ga0070676_10202940 | Ga0070676_102029401 | 341 |
| 372 | 3300005329 | Ga0070683_100077013 | Ga0070683_1000770133 | 341 |
| 373 | 3300005329 | Ga0070683_100134048 | Ga0070683_1001340482 | 341 |
| 374 | 3300005329 | Ga0070683_100167155 | Ga0070683_1001671552 | 341 |
| 375 | 3300005336 | Ga0070680_100069990 | Ga0070680_1000699903 | 341 |
| 376 | 3300005336 | Ga0070680_100292079 | Ga0070680_1002920791 | 341 |
| 377 | 3300005340 | Ga0070689_100036215 | Ga0070689_1000362154 | 341 |
| 378 | 3300005340 | Ga0070689_100078245 | Ga0070689_1000782452 | 341 |
| 379 | 3300005344 | Ga0070661_100008265 | Ga0070661_1000082657 | 341 |
| 380 | 3300005344 | Ga0070661_100181409 | Ga0070661_1001814092 | 341 |
| 381 | 3300005347 | Ga0070668_100052358 | Ga0070668_1000523583 | 341 |
| 382 | 3300005354 | Ga0070675_100001426 | Ga0070675_1000014267 | 341 |
| 383 | 3300005354 | Ga0070675_100303742 | Ga0070675_1003037422 | 341 |
| 384 | 3300005354 | Ga0070675_100437990 | Ga0070675_1004379901 | 341 |
| 385 | 3300005355 | Ga0070671_100175541 | Ga0070671_1001755412 | 341 |
| 386 | 3300005365 | Ga0070688_100031651 | Ga0070688_1000316513 | 341 |
| 387 | 3300005365 | Ga0070688_100079916 | Ga0070688_1000799162 | 341 |
| 388 | 3300005366 | Ga0070659_100006359 | Ga0070659_1000063596 | 341 |
| 389 | 3300005435 | Ga0070714_100229730 | Ga0070714_1002297301 | 341 |
| 390 | 3300005440 | Ga0070705_100098276 | Ga0070705_1000982762 | 341 |
| 391 | 3300005441 | Ga0070700_100003873 | Ga0070700_1000038737 | 341 |
| 392 | 3300005445 | Ga0070708_100016953 | Ga0070708_1000169534 | 341 |
| 393 | 3300005445 | Ga0070708_100101511 | Ga0070708_1001015112 | 341 |
| 394 | 3300005445 | Ga0070708_100253799 | Ga0070708_1002537992 | 341 |
| 395 | 3300005455 | Ga0070663_100013988 | Ga0070663_1000139884 | 341 |
| 396 | 3300005457 | Ga0070662_100117808 | Ga0070662_1001178082 | 341 |
| 397 | 3300005458 | Ga0070681_10055781 | Ga0070681_100557812 | 341 |
| 398 | 3300005467 | Ga0070706_100089070 | Ga0070706_1000890703 | 341 |
| 399 | 3300005468 | Ga0070707_100027295 | Ga0070707_1000272955 | 341 |
| 400 | 3300005468 | Ga0070707_100125199 | Ga0070707_1001251993 | 341 |
| 401 | 3300005471 | Ga0070698_100002836 | Ga0070698_10000283616 | 341 |
| 402 | 3300005518 | Ga0070699_100152415 | Ga0070699_1001524152 | 341 |
| 403 | 3300005530 | Ga0070679_100096098 | Ga0070679_1000960983 | 341 |
| 404 | 3300005535 | Ga0070684_100000867 | Ga0070684_10000086719 | 341 |
| 405 | 3300005535 | Ga0070684_100005822 | Ga0070684_1000058227 | 341 |
| 406 | 3300005535 | Ga0070684_100217013 | Ga0070684_1002170131 | 341 |
| 407 | 3300005536 | Ga0070697_100008554 | Ga0070697_1000085544 | 341 |
| 408 | 3300005544 | Ga0070686_100016315 | Ga0070686_1000163154 | 341 |
| 409 | 3300005548 | Ga0070665_100044076 | Ga0070665_1000440762 | 341 |
| 410 | 3300005548 | Ga0070665_100082822 | Ga0070665_1000828222 | 341 |
| 411 | 3300005548 | Ga0070665_100117564 | Ga0070665_1001175642 | 341 |
| 412 | 3300005549 | Ga0070704_100003377 | Ga0070704_1000033779 | 341 |
| 413 | 3300005615 | Ga0070702_100058211 | Ga0070702_1000582112 | 341 |
| 414 | 3300005841 | Ga0068863_100055186 | Ga0068863_1000551864 | 341 |
| 415 | 3300005841 | Ga0068863_100196370 | Ga0068863_1001963702 | 341 |
| 416 | 3300005842 | Ga0068858_100014527 | Ga0068858_1000145273 | 341 |
| 417 | 3300005843 | Ga0068860_100007230 | Ga0068860_1000072307 | 341 |
| 418 | 3300005937 | Ga0081455_10006460 | Ga0081455_100064608 | 341 |
| 419 | 3300005937 | Ga0081455_10009604 | Ga0081455_100096045 | 341 |
| 420 | 3300005937 | Ga0081455_10036756 | Ga0081455_100367564 | 341 |
| 421 | 3300005983 | Ga0081540_1000014 | Ga0081540_100001450 | 341 |
| 422 | 3300005985 | Ga0081539_10018211 | Ga0081539_100182113 | 341 |
| 423 | 3300006028 | Ga0070717_10143990 | Ga0070717_101439902 | 341 |
| 424 | 3300006163 | Ga0070715_10064642 | Ga0070715_100646421 | 341 |
| 425 | 3300006173 | Ga0070716_100022413 | Ga0070716_1000224133 | 341 |
| 426 | 3300006175 | Ga0070712_100012423 | Ga0070712_1000124235 | 341 |
| 427 | 3300006237 | Ga0097621_100095912 | Ga0097621_1000959122 | 341 |
| 428 | 3300006358 | Ga0068871_100116582 | Ga0068871_1001165822 | 341 |
| 429 | 3300009147 | Ga0114129_10374906 | Ga0114129_103749062 | 341 |
| 430 | 3300009177 | Ga0105248_10333253 | Ga0105248_103332532 | 341 |
| 431 | 3300009553 | Ga0105249_10024448 | Ga0105249_100244484 | 341 |
| 432 | 3300013296 | Ga0157374_10081132 | Ga0157374_100811322 | 341 |
| 433 | 3300013296 | Ga0157374_10087899 | Ga0157374_100878992 | 341 |
| 434 | 3300013297 | Ga0157378_10071172 | Ga0157378_100711722 | 341 |
| 435 | 3300013306 | Ga0163162_10144190 | Ga0163162_101441903 | 341 |
| 436 | 3300013307 | Ga0157372_10112022 | Ga0157372_101120222 | 341 |
| 437 | 3300013308 | Ga0157375_10010745 | Ga0157375_100107454 | 341 |
| 438 | 3300013308 | Ga0157375_10064562 | Ga0157375_100645624 | 341 |
| 439 | 3300013308 | Ga0157375_10719957 | Ga0157375_107199571 | 341 |
| 440 | 3300014745 | Ga0157377_10028407 | Ga0157377_100284072 | 341 |
| 441 | 3300014968 | Ga0157379_10000955 | Ga0157379_100009556 | 341 |
| 442 | 3300014969 | Ga0157376_10023967 | Ga0157376_100239674 | 341 |
| 443 | 3300025271 | Ga0207666_1000551 | Ga0207666_10005512 | 341 |
| 444 | 3300025290 | Ga0207673_1001689 | Ga0207673_10016893 | 341 |
| 445 | 3300025315 | Ga0207697_10000711 | Ga0207697_100007118 | 341 |
| 446 | 3300025315 | Ga0207697_10001026 | Ga0207697_1000102613 | 341 |
| 447 | 3300025315 | Ga0207697_10006343 | Ga0207697_100063437 | 341 |
| 448 | 3300025315 | Ga0207697_10035311 | Ga0207697_100353111 | 341 |
| 449 | 3300025904 | Ga0207647_10022787 | Ga0207647_100227872 | 341 |
| 450 | 3300025907 | Ga0207645_10007467 | Ga0207645_100074679 | 341 |
| 451 | 3300025910 | Ga0207684_10023202 | Ga0207684_100232021 | 341 |
| 452 | 3300025915 | Ga0207693_10358224 | Ga0207693_103582241 | 341 |
| 453 | 3300025919 | Ga0207657_10059524 | Ga0207657_100595241 | 341 |
| 454 | 3300025920 | Ga0207649_10118906 | Ga0207649_101189062 | 341 |
| 455 | 3300025921 | Ga0207652_10124191 | Ga0207652_101241911 | 341 |
| 456 | 3300025921 | Ga0207652_10508632 | Ga0207652_105086321 | 341 |
| 457 | 3300025922 | Ga0207646_10069243 | Ga0207646_100692432 | 341 |
| 458 | 3300025926 | Ga0207659_10039321 | Ga0207659_100393212 | 341 |
| 459 | 3300025926 | Ga0207659_10301977 | Ga0207659_103019771 | 341 |
| 460 | 3300025933 | Ga0207706_10012445 | Ga0207706_100124459 | 341 |
| 461 | 3300025936 | Ga0207670_10033258 | Ga0207670_100332584 | 341 |
| 462 | 3300025939 | Ga0207665_10120287 | Ga0207665_101202871 | 341 |
| 463 | 3300025940 | Ga0207691_10153220 | Ga0207691_101532202 | 341 |
| 464 | 3300025941 | Ga0207711_10310151 | Ga0207711_103101512 | 341 |
| 465 | 3300025944 | Ga0207661_10086125 | Ga0207661_100861253 | 341 |
| 466 | 3300025944 | Ga0207661_10090864 | Ga0207661_100908642 | 341 |
| 467 | 3300025945 | Ga0207679_10121424 | Ga0207679_101214241 | 341 |
| 468 | 3300025961 | Ga0207712_10082106 | Ga0207712_100821062 | 341 |
| 469 | 3300025972 | Ga0207668_10021116 | Ga0207668_100211162 | 341 |
| 470 | 3300026023 | Ga0207677_10239180 | Ga0207677_102391801 | 341 |
| 471 | 3300026035 | Ga0207703_10021358 | Ga0207703_100213584 | 341 |
| 472 | 3300026067 | Ga0207678_10009556 | Ga0207678_100095563 | 341 |
| 473 | 3300026075 | Ga0207708_10003639 | Ga0207708_100036392 | 341 |
| 474 | 3300026088 | Ga0207641_10044372 | Ga0207641_100443722 | 341 |
| 475 | 3300026118 | Ga0207675_100042959 | Ga0207675_1000429594 | 341 |
| 476 | 3300026121 | Ga0207683_10034825 | Ga0207683_100348254 | 341 |
| 477 | 3300028379 | Ga0268266_10104972 | Ga0268266_101049721 | 341 |
| 478 | 3300028381 | Ga0268264_10015640 | Ga0268264_100156407 | 341 |
| 479 | 3300035120 | Ga0373957_0042064 | Ga0373957_0042064_185_1210 | 341 |
| 480 | 3300035692 | Ga0373935_0029415 | Ga0373935_0029415_353_1378 | 341 |
| 481 | 3300037418 | Ga0395900_0021221 | Ga0395900_0021221_3636_4661 | 341 |
| 482 | 3300037418 | Ga0395900_0093654 | Ga0395900_0093654_1936_2961 | 341 |
| 483 | 3300037418 | Ga0395900_0177328 | Ga0395900_0177328_620_1645 | 341 |
| 484 | 3300037466 | Ga0395898_0009649 | Ga0395898_0009649_365_1390 | 341 |
| 485 | 3300037471 | Ga0395905_0047592 | Ga0395905_0047592_915_1940 | 341 |
| 486 | 3300038443 | Ga0395901_0078520 | Ga0395901_0078520_973_1998 | 341 |
| 487 | 3300042009 | Ga0439451_013534 | Ga0439451_013534_300_1325 | 341 |
| 488 | 3300044706 | Ga0466964_0074513 | Ga0466964_0074513_218_1243 | 341 |
| 489 | 3300046454 | Ga0495592_0002133 | Ga0495592_0002133_10157_11182 | 341 |
| 490 | 3300046455 | Ga0495603_0154795 | Ga0495603_0154795_11_1036 | 341 |
| 491 | 3300046462 | Ga0495651_0198775 | Ga0495651_0198775_285_1310 | 341 |
| 492 | 3300046516 | Ga0495628_0001627 | Ga0495628_0001627_7583_8608 | 341 |
| 493 | 3300046529 | Ga0495652_0010248 | Ga0495652_0010248_3009_4034 | 341 |
| 494 | 3300046543 | Ga0495645_0035622 | Ga0495645_0035622_906_1931 | 341 |
| 495 | 3300046678 | Ga0495599_0018811 | Ga0495599_0018811_1777_2802 | 341 |
| 496 | 3300047444 | Ga0495675_0003717 | Ga0495675_0003717_4994_6019 | 341 |
| 497 | 3300048088 | Ga0495602_0032833 | Ga0495602_0032833_618_1643 | 341 |
| 498 | 3300048904 | Ga0496101_0116185 | Ga0496101_0116185_274_1299 | 341 |
| 499 | 3300048907 | Ga0496104_0024302 | Ga0496104_0024302_2508_3533 | 341 |
| 500 | 3300048908 | Ga0496105_0021269 | Ga0496105_0021269_2463_3488 | 341 |
| 501 | 3300048909 | Ga0496106_0133490 | Ga0496106_0133490_818_1843 | 341 |
| 502 | 3300048912 | Ga0496109_0055227 | Ga0496109_0055227_1332_2357 | 341 |
| 503 | 3300048913 | Ga0496110_0068757 | Ga0496110_0068757_1886_2911 | 341 |
| 504 | 3300048915 | Ga0496112_0042702 | Ga0496112_0042702_1940_2965 | 341 |
| 505 | 3300048917 | Ga0496114_0123450 | Ga0496114_0123450_817_1842 | 341 |
| 506 | 3300048918 | Ga0496115_0004994 | Ga0496115_0004994_1231_2256 | 341 |
| 507 | 3300048918 | Ga0496115_0088217 | Ga0496115_0088217_168_1193 | 341 |
| 508 | 3300053077 | Ga0495601_0001627 | Ga0495601_0001627_4870_5895 | 341 |
| 509 | 3300005467 | Ga0070706_100000682 | Ga0070706_10000068230 | 342 |
| 510 | 3300005467 | Ga0070706_100204596 | Ga0070706_1002045962 | 342 |
| 511 | 3300005468 | Ga0070707_100016084 | Ga0070707_1000160843 | 342 |
| 512 | 3300005471 | Ga0070698_100101532 | Ga0070698_1001015323 | 342 |
| 513 | 3300005471 | Ga0070698_100229660 | Ga0070698_1002296602 | 342 |
| 514 | 3300005536 | Ga0070697_100002512 | Ga0070697_1000025126 | 342 |
| 515 | 3300006028 | Ga0070717_10000722 | Ga0070717_1000072212 | 342 |
| 516 | 3300025910 | Ga0207684_10000736 | Ga0207684_1000073615 | 342 |
| 517 | 3300025910 | Ga0207684_10289926 | Ga0207684_102899262 | 342 |
| 518 | 3300025922 | Ga0207646_10019070 | Ga0207646_100190706 | 342 |
| 519 | 3300005467 | Ga0070706_100055019 | Ga0070706_1000550193 | 343 |
| 520 | 3300005467 | Ga0070706_100057677 | Ga0070706_1000576773 | 343 |
| 521 | 3300005937 | Ga0081455_10000647 | Ga0081455_1000064725 | 343 |
| 522 | 3300005983 | Ga0081540_1009067 | Ga0081540_10090674 | 343 |
| 523 | 3300009147 | Ga0114129_10000103 | Ga0114129_1000010350 | 343 |
| 524 | 3300025910 | Ga0207684_10022277 | Ga0207684_100222772 | 343 |
| 525 | 3300025910 | Ga0207684_10030132 | Ga0207684_100301322 | 343 |
| 526 | 3300025922 | Ga0207646_10080185 | Ga0207646_100801852 | 343 |
| 527 | 3300050507 | nmdc:mga05p37_3050_c2 | nmdc:mga05p37_3050_c2_1035_2066 | 343 |
| 528 | 3300005289 | Ga0065704_10018270 | Ga0065704_100182701 | 344 |
| 529 | 3300005353 | Ga0070669_100175551 | Ga0070669_1001755511 | 344 |
| 530 | 3300005439 | Ga0070711_100009047 | Ga0070711_1000090475 | 344 |
| 531 | 3300021361 | Ga0213872_10040464 | Ga0213872_100404642 | 344 |
| 532 | 3300021384 | Ga0213876_10000436 | Ga0213876_1000043619 | 344 |
| 533 | 3300025315 | Ga0207697_10057290 | Ga0207697_100572902 | 344 |
| 534 | 3300025915 | Ga0207693_10000519 | Ga0207693_1000051927 | 344 |
| 535 | 3300025916 | Ga0207663_10017524 | Ga0207663_100175243 | 344 |
| 536 | 3300025923 | Ga0207681_10185972 | Ga0207681_101859722 | 344 |
| 537 | 3300025933 | Ga0207706_10157172 | Ga0207706_101571722 | 344 |
| 538 | 3300025939 | Ga0207665_10304853 | Ga0207665_103048531 | 344 |
| 539 | 3300035171 | Ga0373946_0030606 | Ga0373946_0030606_552_1622 | 344 |
| 540 | 3300037068 | Ga0373925_0145570 | Ga0373925_0145570_223_1293 | 344 |
| 541 | 3300037853 | Ga0436364_0757601 | Ga0436364_0757601_1088_2200 | 344 |
| 542 | 3300039437 | Ga0436365_1670361 | Ga0436365_1670361_15132_16316 | 344 |
| 543 | 3300039447 | Ga0436361_0370321 | Ga0436361_0370321_345_1403 | 344 |
| 544 | 3300046674 | Ga0495588_0041340 | Ga0495588_0041340_328_1398 | 344 |
| 545 | 3300046684 | Ga0495669_0010184 | Ga0495669_0010184_1061_2131 | 344 |
| 546 | 3300000545 | CNXas_1000009 | CNXas_100000925 | 345 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3puy-assembly1.cif.gz_B | crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state | 0.9003 | 4 | 250 |
| 7nnt-assembly1.cif.gz_B | cryo-em structure of the folate-specific ecf transporter complex in ddm micelles | 0.8951 | 40 | 244 |
| 6xgz-assembly3.cif.gz_E | crystal structure of e. coli mlafb abc transport subunits in the monomeric state | 0.8946 | 2 | 245 |
| 6xgz-assembly2.cif.gz_C | crystal structure of e. coli mlafb abc transport subunits in the monomeric state | 0.8898 | 2 | 244 |
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.8881 | 1 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XW49_440_685_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9302 | 1 | 248 | 3.40.50.300 |
| af_Q2FVS3_1_233_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9273 | 1 | 243 | 3.40.50.300 |
| af_A4HV32_726_961_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9254 | 2 | 246 | 3.40.50.300 |
| af_P36879_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9226 | 1 | 245 | 3.40.50.300 |
| af_A1ZBS3_1241_1472_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9208 | 4 | 248 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1AL51-F1-model_v4 | ABC transporter, ATP binding/permease protein | 0.9308 | 1 | 247 |
GO:0005524
GO:0016887 |
| AF-A0A6G2UJN6-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9298 | 2 | 217 |
GO:0005524
GO:0016887 GO:0046677 |
| AF-A0A7I7SA04-F1-model_v4 | deleted | 0.9297 | 38 | 248 |
|
| AF-A0A511X0H7-F1-model_v4 | ABC transporter domain-containing protein | 0.9297 | 1 | 205 |
GO:0005524
GO:0016887 |
| AF-A0A7C6CAI4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9292 | 1 | 246 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar