F462005

General Info

Members Datasets Scaffolds Average Seq Length
546 216 1092 135

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_11535690|Ga0207708_115356902
Length 123
Sequence MRFKVGDTASVIKTFTQEDIEKFADLSGDRNPIHLDEEHAKGTRFGRRIAHGMLTSSLISNVIGNELPGLGSIYLGQTLQFTITARATVISVREDKPIVKIKTVCTNQRDEVVIKGEATVLVE

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
163 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
173 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
174 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
175 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
176 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
177 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
178 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
179 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
180 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
181 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
182 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
183 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
184 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
185 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
186 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
187 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
188 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
189 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
190 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
191 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
192 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
193 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
194 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
195 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
196 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
201 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
202 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
203 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
204 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
205 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
206 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
207 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
208 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
209 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.83
Rhizosphere 97.99
Stem 0
Stem Tuber 0
Unclassified 41.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_11535690 3300026075 Unclassified 585
2 JGI24749J21850_1007611 3300002076 Unclassified 1509
3 JGI24751J29686_10000007 3300002459 Bacteria 129562
4 JGI25406J46586_10097565 3300003203 Bacteria 879
5 rootH2_10199793 3300003320 Unclassified 2175
6 Ga0065714_10064426 3300005288 Bacteria 186606
7 Ga0065704_10101841 3300005289 Bacteria 2224
8 Ga0065704_10130515 3300005289 Bacteria 1635
9 Ga0065704_10196595 3300005289 Unclassified 1165
10 Ga0065712_10067732 3300005290 Bacteria 130748
11 Ga0065712_10074443 3300005290 Bacteria 4094
12 Ga0065712_10099867 3300005290 Bacteria 2078
13 Ga0065715_10034673 3300005293 Bacteria 2137
14 Ga0065715_10037974 3300005293 Unclassified 1366
15 Ga0065715_10089198 3300005293 Bacteria 12701
16 Ga0065715_10096539 3300005293 Unclassified 3861
17 Ga0065715_10353412 3300005293 Bacteria 947
18 Ga0065715_10436535 3300005293 Unclassified 841
19 Ga0065715_10508052 3300005293 Unclassified 774
20 Ga0065707_10110399 3300005295 Bacteria 2431
21 Ga0065707_10161826 3300005295 Bacteria 1556
22 Ga0070676_10922826 3300005328 Unclassified 651
23 Ga0070676_11338199 3300005328 Bacteria 548
24 Ga0070690_100232901 3300005330 Bacteria 1296
25 Ga0070690_100645564 3300005330 Unclassified 808
26 Ga0070690_100935055 3300005330 Unclassified 680
27 Ga0070670_100000043 3300005331 Bacteria 141622
28 Ga0070670_100137451 3300005331 Unclassified 2112
29 Ga0070670_100240664 3300005331 Unclassified 1575
30 Ga0070670_101220215 3300005331 Unclassified 687
31 Ga0070677_10166865 3300005333 Unclassified 1037
32 Ga0068869_100029073 3300005334 Bacteria 3868
33 Ga0068869_100280187 3300005334 Unclassified 1340
34 Ga0068869_100351866 3300005334 Unclassified 1201
35 Ga0068869_100724002 3300005334 Unclassified 850
36 Ga0068869_100821377 3300005334 Unclassified 800
37 Ga0070666_10124014 3300005335 Bacteria 1792
38 Ga0070682_100248198 3300005337 Bacteria 1282
39 Ga0070682_101794870 3300005337 Unclassified 535
40 Ga0070660_100833656 3300005339 Unclassified 776
41 Ga0070660_100914592 3300005339 Unclassified 740
42 Ga0070660_100944078 3300005339 Unclassified 728
43 Ga0070689_100001432 3300005340 Bacteria 15211
44 Ga0070689_100248012 3300005340 Unclassified 1468
45 Ga0070691_10476510 3300005341 Unclassified 717
46 Ga0070687_100155391 3300005343 Unclassified 1347
47 Ga0070692_10888294 3300005345 Unclassified 615
48 Ga0070669_100002916 3300005353 Bacteria 12319
49 Ga0070669_100285192 3300005353 Unclassified 1324
50 Ga0070669_100292481 3300005353 Unclassified 1308
51 Ga0070671_100892645 3300005355 Unclassified 776
52 Ga0070671_101165183 3300005355 Unclassified 678
53 Ga0070674_100789093 3300005356 Bacteria 819
54 Ga0070674_102193672 3300005356 Unclassified 504
55 Ga0070673_100003740 3300005364 Bacteria 9541
56 Ga0070673_100068070 3300005364 Unclassified 2850
57 Ga0070673_100220945 3300005364 Unclassified 1640
58 Ga0070673_101311830 3300005364 Bacteria 680
59 Ga0070673_101533258 3300005364 Unclassified 629
60 Ga0070688_101154219 3300005365 Bacteria 621
61 Ga0070659_100251402 3300005366 Unclassified 1465
62 Ga0070701_10071625 3300005438 Bacteria 1854
63 Ga0070701_10309204 3300005438 Unclassified 974
64 Ga0070705_100222882 3300005440 Bacteria 1307
65 Ga0070705_100259970 3300005440 Unclassified 1224
66 Ga0070705_100900149 3300005440 Unclassified 712
67 Ga0070700_100000080 3300005441 Bacteria 64459
68 Ga0070700_100001193 3300005441 Bacteria 12869
69 Ga0070700_100085273 3300005441 Bacteria 2049
70 Ga0070700_100135098 3300005441 Unclassified 1669
71 Ga0070700_100393873 3300005441 Unclassified 1039
72 Ga0070700_100488412 3300005441 Unclassified 945
73 Ga0070700_101224608 3300005441 Unclassified 628
74 Ga0070700_101632089 3300005441 Unclassified 551
75 Ga0070694_100094718 3300005444 Bacteria 2101
76 Ga0070694_100487516 3300005444 Unclassified 979
77 Ga0070694_100778797 3300005444 Unclassified 783
78 Ga0070694_101691934 3300005444 Unclassified 538
79 Ga0070678_101223906 3300005456 Bacteria 697
80 Ga0070662_100076845 3300005457 Bacteria 2476
81 Ga0070662_100077826 3300005457 Bacteria 2462
82 Ga0068867_100079259 3300005459 Unclassified 2472
83 Ga0068867_100506261 3300005459 Bacteria 1039
84 Ga0068867_100535986 3300005459 Unclassified 1012
85 Ga0068867_101229616 3300005459 Unclassified 689
86 Ga0070685_10158772 3300005466 Bacteria 1439
87 Ga0070706_100000031 3300005467 Bacteria 153504
88 Ga0070707_100831658 3300005468 Unclassified 887
89 Ga0070707_101490791 3300005468 Bacteria 643
90 Ga0070698_100089128 3300005471 Unclassified 3069
91 Ga0070699_100046230 3300005518 Bacteria 3768
92 Ga0070679_100394921 3300005530 Unclassified 1329
93 Ga0070697_100011145 3300005536 Bacteria 7025
94 Ga0070697_100074495 3300005536 Bacteria 2789
95 Ga0070697_101139929 3300005536 Bacteria 694
96 Ga0070697_101253325 3300005536 Unclassified 661
97 Ga0068853_100101991 3300005539 Unclassified 2539
98 Ga0068853_100733366 3300005539 Bacteria 944
99 Ga0068853_100933598 3300005539 Bacteria 834
100 Ga0068853_101141636 3300005539 Unclassified 752
101 Ga0070672_101179936 3300005543 Unclassified 682
102 Ga0070695_100101529 3300005545 Unclassified 1938
103 Ga0070695_100145280 3300005545 Unclassified 1649
104 Ga0070695_100929157 3300005545 Unclassified 704
105 Ga0070695_100966152 3300005545 Unclassified 691
106 Ga0070696_100068239 3300005546 Bacteria 2496
107 Ga0070696_100465363 3300005546 Unclassified 1000
108 Ga0070696_101258674 3300005546 Unclassified 627
109 Ga0070693_100251427 3300005547 Bacteria 1172
110 Ga0070693_100521279 3300005547 Unclassified 846
111 Ga0070693_100970307 3300005547 Unclassified 641
112 Ga0070704_100188158 3300005549 Unclassified 1657
113 Ga0070704_100245092 3300005549 Unclassified 1469
114 Ga0070704_100417842 3300005549 Bacteria 1148
115 Ga0070704_100479412 3300005549 Bacteria 1076
116 Ga0070664_100277880 3300005564 Bacteria 1510
117 Ga0070664_100634986 3300005564 Unclassified 992
118 Ga0070664_100671569 3300005564 Bacteria 964
119 Ga0070664_102132176 3300005564 Unclassified 532
120 Ga0068857_100062898 3300005577 Bacteria 3300
121 Ga0068857_100113534 3300005577 Unclassified 2436
122 Ga0068857_100304938 3300005577 Unclassified 1468
123 Ga0068857_100350185 3300005577 Unclassified 1368
124 Ga0068857_101465645 3300005577 Bacteria 665
125 Ga0068854_100195737 3300005578 Bacteria 1586
126 Ga0068854_100559676 3300005578 Bacteria 971
127 Ga0068854_101013247 3300005578 Bacteria 736
128 Ga0070702_100009689 3300005615 Bacteria 4724
129 Ga0070702_100028841 3300005615 Bacteria 3012
130 Ga0070702_100083445 3300005615 Bacteria 1919
131 Ga0070702_100215451 3300005615 Bacteria 1281
132 Ga0070702_100426719 3300005615 Unclassified 955
133 Ga0070702_100435062 3300005615 Unclassified 948
134 Ga0068859_100001336 3300005617 Bacteria 25188
135 Ga0068859_100014105 3300005617 Bacteria 8014
136 Ga0068859_100116411 3300005617 Bacteria 2737
137 Ga0068859_100140947 3300005617 Unclassified 2484
138 Ga0068859_100155304 3300005617 Bacteria 2365
139 Ga0068859_100183509 3300005617 Bacteria 2175
140 Ga0068859_100207806 3300005617 Bacteria 2044
141 Ga0068859_100221550 3300005617 Unclassified 1979
142 Ga0068859_100308794 3300005617 Unclassified 1675
143 Ga0068859_100314638 3300005617 Bacteria 1659
144 Ga0068859_100367079 3300005617 Bacteria 1535
145 Ga0068859_100591771 3300005617 Bacteria 1203
146 Ga0068859_100735450 3300005617 Unclassified 1076
147 Ga0068864_100010487 3300005618 Bacteria 7657
148 Ga0068864_100143258 3300005618 Bacteria 2158
149 Ga0068866_10007749 3300005718 Bacteria 4505
150 Ga0068861_100028882 3300005719 Bacteria 4051
151 Ga0068861_100031559 3300005719 Unclassified 3892
152 Ga0068861_100375604 3300005719 Unclassified 1254
153 Ga0068861_100563377 3300005719 Unclassified 1040
154 Ga0068861_101311895 3300005719 Unclassified 704
155 Ga0068861_101375376 3300005719 Unclassified 689
156 Ga0068851_10718577 3300005834 Unclassified 616
157 Ga0068870_10043569 3300005840 Unclassified 2341
158 Ga0068870_10177765 3300005840 Bacteria 1275
159 Ga0068863_100021022 3300005841 Bacteria 6233
160 Ga0068863_100048175 3300005841 Unclassified 4041
161 Ga0068863_100587141 3300005841 Unclassified 1102
162 Ga0068863_102236219 3300005841 Unclassified 557
163 Ga0068858_100115758 3300005842 Bacteria 2505
164 Ga0068858_100160801 3300005842 Bacteria 2114
165 Ga0068858_100161961 3300005842 Bacteria 2106
166 Ga0068858_100777069 3300005842 Unclassified 934
167 Ga0068858_101066907 3300005842 Unclassified 793
168 Ga0068858_101848416 3300005842 Unclassified 597
169 Ga0068860_100024515 3300005843 Bacteria 5828
170 Ga0068860_100086733 3300005843 Bacteria 2980
171 Ga0068860_100421034 3300005843 Unclassified 1324
172 Ga0068860_100648997 3300005843 Bacteria 1063
173 Ga0068860_100709079 3300005843 Unclassified 1016
174 Ga0068860_100812527 3300005843 Unclassified 948
175 Ga0068860_100873095 3300005843 Unclassified 915
176 Ga0068860_101557638 3300005843 Bacteria 683
177 Ga0068862_100025377 3300005844 Bacteria 4975
178 Ga0068862_100092956 3300005844 Bacteria 2630
179 Ga0068862_101788225 3300005844 Bacteria 624
180 Ga0081539_10000605 3300005985 Bacteria 72953
181 Ga0081539_10335100 3300005985 Bacteria 640
182 Ga0097621_100053776 3300006237 Bacteria 3282
183 Ga0097621_101894110 3300006237 Unclassified 569
184 Ga0068871_102064042 3300006358 Unclassified 543
185 Ga0075428_100116448 3300006844 Bacteria 2911
186 Ga0075428_100819414 3300006844 Unclassified 989
187 Ga0075428_101569955 3300006844 Bacteria 688
188 Ga0075428_102292737 3300006844 Unclassified 556
189 Ga0075430_100016057 3300006846 Bacteria 6375
190 Ga0075430_100064812 3300006846 Bacteria 3070
191 Ga0075430_100410653 3300006846 Bacteria 1117
192 Ga0075431_100113133 3300006847 Bacteria 2801
193 Ga0075431_100344519 3300006847 Unclassified 1499
194 Ga0075431_100568905 3300006847 Unclassified 1119
195 Ga0075431_100711768 3300006847 Bacteria 981
196 Ga0075433_10005965 3300006852 Bacteria 9593
197 Ga0075433_10049668 3300006852 Bacteria 3649
198 Ga0075433_10562564 3300006852 Bacteria 1002
199 Ga0075433_10814740 3300006852 Bacteria 815
200 Ga0075433_10832643 3300006852 Bacteria 806
201 Ga0075434_100269374 3300006871 Bacteria 1722
202 Ga0075429_100135098 3300006880 Unclassified 2159
203 Ga0097620_100001336 3300006931 Bacteria 25188
204 Ga0097620_100014106 3300006931 Bacteria 8014
205 Ga0097620_100116409 3300006931 Bacteria 2737
206 Ga0097620_100140947 3300006931 Unclassified 2484
207 Ga0097620_100155289 3300006931 Bacteria 2365
208 Ga0097620_100183516 3300006931 Bacteria 2175
209 Ga0097620_100207800 3300006931 Bacteria 2044
210 Ga0097620_100221559 3300006931 Unclassified 1979
211 Ga0097620_100308801 3300006931 Unclassified 1675
212 Ga0097620_100314636 3300006931 Bacteria 1659
213 Ga0097620_100367068 3300006931 Bacteria 1535
214 Ga0097620_100591787 3300006931 Bacteria 1203
215 Ga0097620_100735474 3300006931 Unclassified 1076
216 Ga0075435_100004311 3300007076 Bacteria 9780
217 Ga0075435_101493558 3300007076 Bacteria 592
218 Ga0105251_10411017 3300009011 Unclassified 623
219 Ga0105244_10216061 3300009036 Unclassified 900
220 Ga0105240_10133663 3300009093 Bacteria 2972
221 Ga0105240_10218586 3300009093 Bacteria 2221
222 Ga0105240_11157511 3300009093 Bacteria 821
223 Ga0105240_12326507 3300009093 Unclassified 555
224 Ga0111539_10073801 3300009094 Bacteria 4021
225 Ga0111539_10139456 3300009094 Bacteria 2839
226 Ga0111539_10304735 3300009094 Bacteria 1854
227 Ga0111539_10380734 3300009094 Bacteria 1643
228 Ga0105247_10003721 3300009101 Bacteria 9896
229 Ga0105247_10198191 3300009101 Bacteria 1348
230 Ga0105247_10575164 3300009101 Bacteria 832
231 Ga0105247_10789486 3300009101 Unclassified 723
232 Ga0105247_10989391 3300009101 Unclassified 656
233 Ga0105247_11041761 3300009101 Unclassified 642
234 Ga0114129_10144230 3300009147 Unclassified 3262
235 Ga0114129_10166725 3300009147 Bacteria 3005
236 Ga0114129_10454060 3300009147 Bacteria 1680
237 Ga0114129_10619037 3300009147 Bacteria 1401
238 Ga0114129_13329413 3300009147 Unclassified 519
239 Ga0105243_10036772 3300009148 Unclassified 3803
240 Ga0105243_10182158 3300009148 Unclassified 1828
241 Ga0105243_10285184 3300009148 Bacteria 1489
242 Ga0105243_10311604 3300009148 Bacteria 1430
243 Ga0105243_10721422 3300009148 Unclassified 974
244 Ga0105243_11061604 3300009148 Unclassified 816
245 Ga0105243_11134065 3300009148 Unclassified 792
246 Ga0105243_11818870 3300009148 Unclassified 640
247 Ga0105241_10101275 3300009174 Bacteria 2290
248 Ga0105241_10139588 3300009174 Unclassified 1972
249 Ga0105241_10200694 3300009174 Unclassified 1666
250 Ga0105241_10240830 3300009174 Bacteria 1529
251 Ga0105241_10706803 3300009174 Unclassified 921
252 Ga0105241_12024526 3300009174 Unclassified 567
253 Ga0105242_10024542 3300009176 Unclassified 4762
254 Ga0105242_10306813 3300009176 Bacteria 1451
255 Ga0105242_10742363 3300009176 Bacteria 965
256 Ga0105242_11226285 3300009176 Bacteria 770
257 Ga0105242_12196945 3300009176 Bacteria 597
258 Ga0105248_10054441 3300009177 Bacteria 4486
259 Ga0105248_10605634 3300009177 Unclassified 1236
260 Ga0105248_10686578 3300009177 Unclassified 1155
261 Ga0105248_10883546 3300009177 Unclassified 1009
262 Ga0105237_10434226 3300009545 Bacteria 1319
263 Ga0105237_10537164 3300009545 Unclassified 1176
264 Ga0105237_10900758 3300009545 Bacteria 891
265 Ga0105238_10002831 3300009551 Bacteria 17307
266 Ga0105238_10028664 3300009551 Bacteria 5671
267 Ga0105249_10064455 3300009553 Bacteria 3369
268 Ga0105249_10193669 3300009553 Bacteria 1985
269 Ga0105249_10792289 3300009553 Bacteria 1011
270 Ga0105249_12626189 3300009553 Unclassified 576
271 Ga0105239_10100956 3300010375 Archaea 3192
272 Ga0105239_12601724 3300010375 Unclassified 590
273 Ga0105246_10459462 3300011119 Unclassified 1072
274 Ga0105246_10860159 3300011119 Bacteria 810
275 Ga0105246_11442307 3300011119 Bacteria 644
276 Ga0157373_10014840 3300013100 Bacteria 5706
277 Ga0157373_10622148 3300013100 Unclassified 787
278 Ga0157373_10800031 3300013100 Unclassified 695
279 Ga0157371_10410291 3300013102 Unclassified 992
280 Ga0157378_10061900 3300013297 Unclassified 3342
281 Ga0157378_10353419 3300013297 Unclassified 1436
282 Ga0157378_10432921 3300013297 Bacteria 1302
283 Ga0157378_10504222 3300013297 Bacteria 1209
284 Ga0157378_12813222 3300013297 Unclassified 539
285 Ga0163162_10287663 3300013306 Bacteria 1775
286 Ga0163162_10305728 3300013306 Bacteria 1722
287 Ga0163162_10617351 3300013306 Unclassified 1210
288 Ga0163162_10727666 3300013306 Unclassified 1113
289 Ga0163162_10838899 3300013306 Unclassified 1035
290 Ga0157372_10007416 3300013307 Bacteria 11666
291 Ga0157372_13385662 3300013307 Bacteria 507
292 Ga0157375_10016654 3300013308 Bacteria 6611
293 Ga0157375_10176185 3300013308 Bacteria 2288
294 Ga0157375_10274946 3300013308 Bacteria 1846
295 Ga0157375_10405494 3300013308 Unclassified 1530
296 Ga0157375_10851810 3300013308 Unclassified 1058
297 Ga0157375_11202764 3300013308 Unclassified 889
298 Ga0157375_11515756 3300013308 Unclassified 792
299 Ga0157375_12012404 3300013308 Unclassified 687
300 Ga0157375_12247962 3300013308 Bacteria 650
301 Ga0157375_12776769 3300013308 Unclassified 585
302 Ga0163163_10000559 3300014325 Bacteria 32681
303 Ga0163163_10267173 3300014325 Bacteria 1762
304 Ga0163163_10935067 3300014325 Unclassified 930
305 Ga0157380_10008300 3300014326 Bacteria 7402
306 Ga0157380_10112730 3300014326 Bacteria 2289
307 Ga0157380_10496294 3300014326 Unclassified 1184
308 Ga0157380_12107457 3300014326 Bacteria 627
309 Ga0157377_10429600 3300014745 Bacteria 907
310 Ga0157377_11133389 3300014745 Unclassified 601
311 Ga0157379_10310573 3300014968 Bacteria 1438
312 Ga0157376_10457910 3300014969 Unclassified 1246
313 Ga0207642_10022471 3300025899 Bacteria 2502
314 Ga0207710_10006954 3300025900 Bacteria 4811
315 Ga0207710_10097009 3300025900 Unclassified 1387
316 Ga0207647_10026027 3300025904 Unclassified 3833
317 Ga0207647_10071877 3300025904 Bacteria 2087
318 Ga0207645_10835075 3300025907 Unclassified 626
319 Ga0207643_10023573 3300025908 Bacteria 3394
320 Ga0207643_10023615 3300025908 Unclassified 3391
321 Ga0207684_10000110 3300025910 Bacteria 153722
322 Ga0207654_10342602 3300025911 Bacteria 1027
323 Ga0207654_10419906 3300025911 Unclassified 933
324 Ga0207654_10464187 3300025911 Unclassified 890
325 Ga0207654_11239536 3300025911 Unclassified 544
326 Ga0207695_10056413 3300025913 Bacteria 4087
327 Ga0207671_10126748 3300025914 Bacteria 1956
328 Ga0207671_10510676 3300025914 Bacteria 958
329 Ga0207662_10396251 3300025918 Unclassified 935
330 Ga0207657_10581961 3300025919 Bacteria 874
331 Ga0207657_11024829 3300025919 Unclassified 633
332 Ga0207652_10336796 3300025921 Unclassified 1362
333 Ga0207681_10361746 3300025923 Unclassified 1164
334 Ga0207681_10405982 3300025923 Unclassified 1101
335 Ga0207694_10008912 3300025924 Bacteria 7574
336 Ga0207694_10054843 3300025924 Bacteria 3094
337 Ga0207650_10000009 3300025925 Bacteria 483583
338 Ga0207650_10110864 3300025925 Unclassified 2124
339 Ga0207650_10152500 3300025925 Unclassified 1824
340 Ga0207650_10740417 3300025925 Bacteria 831
341 Ga0207659_10454570 3300025926 Unclassified 1079
342 Ga0207687_10426104 3300025927 Bacteria 1096
343 Ga0207690_10224837 3300025932 Unclassified 1438
344 Ga0207706_10072728 3300025933 Bacteria 3023
345 Ga0207706_10115518 3300025933 Unclassified 2360
346 Ga0207686_10401485 3300025934 Unclassified 1044
347 Ga0207709_10005477 3300025935 Bacteria 7206
348 Ga0207709_10156255 3300025935 Bacteria 1585
349 Ga0207709_10212769 3300025935 Unclassified 1389
350 Ga0207670_10000752 3300025936 Bacteria 17026
351 Ga0207670_10418117 3300025936 Unclassified 1075
352 Ga0207670_11409298 3300025936 Bacteria 592
353 Ga0207704_10110184 3300025938 Bacteria 1859
354 Ga0207704_11251689 3300025938 Unclassified 633
355 Ga0207691_11012667 3300025940 Unclassified 693
356 Ga0207711_10092070 3300025941 Unclassified 2668
357 Ga0207711_10393590 3300025941 Bacteria 1287
358 Ga0207711_10553465 3300025941 Unclassified 1073
359 Ga0207689_10028238 3300025942 Bacteria 4693
360 Ga0207689_10217306 3300025942 Unclassified 1579
361 Ga0207689_10361548 3300025942 Unclassified 1207
362 Ga0207689_11100368 3300025942 Bacteria 670
363 Ga0207679_10076082 3300025945 Bacteria 2549
364 Ga0207679_10116629 3300025945 Bacteria 2117
365 Ga0207651_10003359 3300025960 Bacteria 7849
366 Ga0207651_10112944 3300025960 Unclassified 2043
367 Ga0207651_10784449 3300025960 Unclassified 844
368 Ga0207651_11620333 3300025960 Unclassified 583
369 Ga0207712_10221599 3300025961 Unclassified 1513
370 Ga0207712_10521524 3300025961 Unclassified 1018
371 Ga0207712_10584336 3300025961 Unclassified 964
372 Ga0207712_10793830 3300025961 Unclassified 832
373 Ga0207712_11239443 3300025961 Unclassified 666
374 Ga0207640_10691958 3300025981 Bacteria 873
375 Ga0207703_10045805 3300026035 Bacteria 3519
376 Ga0207703_10097291 3300026035 Bacteria 2487
377 Ga0207703_10160677 3300026035 Bacteria 1968
378 Ga0207703_10233127 3300026035 Unclassified 1651
379 Ga0207703_10245745 3300026035 Unclassified 1611
380 Ga0207703_10898265 3300026035 Bacteria 848
381 Ga0207703_11517347 3300026035 Unclassified 645
382 Ga0207639_10472562 3300026041 Bacteria 1141
383 Ga0207708_10001953 3300026075 Bacteria 15207
384 Ga0207708_10016422 3300026075 Bacteria 5567
385 Ga0207708_10031732 3300026075 Bacteria 4011
386 Ga0207708_10121657 3300026075 Bacteria 2034
387 Ga0207708_10129591 3300026075 Bacteria 1971
388 Ga0207708_10678915 3300026075 Unclassified 879
389 Ga0207641_10035855 3300026088 Bacteria 4136
390 Ga0207641_10121040 3300026088 Bacteria 2336
391 Ga0207641_10521087 3300026088 Bacteria 1156
392 Ga0207648_10131397 3300026089 Unclassified 2204
393 Ga0207648_10226590 3300026089 Bacteria 1662
394 Ga0207648_10232603 3300026089 Bacteria 1640
395 Ga0207648_10988487 3300026089 Bacteria 788
396 Ga0207676_10072806 3300026095 Bacteria 2763
397 Ga0207676_10609835 3300026095 Bacteria 1049
398 Ga0207674_10030260 3300026116 Bacteria 5694
399 Ga0207674_10037693 3300026116 Bacteria 5024
400 Ga0207674_10080118 3300026116 Unclassified 3269
401 Ga0207674_10171250 3300026116 Bacteria 2124
402 Ga0207674_10397996 3300026116 Bacteria 1331
403 Ga0207674_10441908 3300026116 Bacteria 1257
404 Ga0207674_10475740 3300026116 Bacteria 1207
405 Ga0207674_10689585 3300026116 Bacteria 986
406 Ga0207675_100021636 3300026118 Bacteria 5988
407 Ga0207675_100127884 3300026118 Unclassified 2408
408 Ga0207675_100241104 3300026118 Bacteria 1747
409 Ga0207675_100321601 3300026118 Bacteria 1510
410 Ga0207675_100328428 3300026118 Bacteria 1494
411 Ga0207675_100617689 3300026118 Bacteria 1088
412 Ga0207675_102001748 3300026118 Unclassified 597
413 Ga0209983_1044194 3300027665 Unclassified 968
414 Ga0207428_10062860 3300027907 Bacteria 2934
415 Ga0207428_10288671 3300027907 Bacteria 1216
416 Ga0268265_10015134 3300028380 Bacteria 5272
417 Ga0268265_10110169 3300028380 Bacteria 2246
418 Ga0268265_10244112 3300028380 Unclassified 1587
419 Ga0268265_10336471 3300028380 Bacteria 1373
420 Ga0268264_10115105 3300028381 Unclassified 2362
421 Ga0268264_10122206 3300028381 Bacteria 2296
422 Ga0268264_10252304 3300028381 Unclassified 1639
423 Ga0268264_10299984 3300028381 Bacteria 1512
424 Ga0268264_10383307 3300028381 Unclassified 1347
425 Ga0268264_10463666 3300028381 Bacteria 1229
426 Ga0268264_11080908 3300028381 Unclassified 810
427 Ga0268264_12136542 3300028381 Unclassified 568
428 Ga0307408_100087743 3300031548 Bacteria 2341
429 Ga0307408_100525204 3300031548 Bacteria 1040
430 Ga0307408_100672330 3300031548 Bacteria 928
431 Ga0307408_100677257 3300031548 Unclassified 925
432 Ga0307413_10097147 3300031824 Bacteria 1936
433 Ga0307410_10113104 3300031852 Bacteria 1967
434 Ga0307406_10002322 3300031901 Bacteria 10334
435 Ga0307406_10335216 3300031901 Bacteria 1176
436 Ga0307406_11195500 3300031901 Unclassified 660
437 Ga0307407_10145301 3300031903 Bacteria 1535
438 Ga0307407_10437271 3300031903 Unclassified 946
439 Ga0307412_10087589 3300031911 Bacteria 2170
440 Ga0307412_10136102 3300031911 Unclassified 1792
441 Ga0307412_11148624 3300031911 Bacteria 693
442 Ga0307409_100326031 3300031995 Bacteria 1439
443 Ga0307416_100027875 3300032002 Bacteria 4191
444 Ga0307416_100098085 3300032002 Bacteria 2540
445 Ga0307416_100180975 3300032002 Bacteria 1976
446 Ga0307414_10001349 3300032004 Bacteria 12695
447 Ga0307411_10353126 3300032005 Bacteria 1199
448 Ga0307411_10932788 3300032005 Unclassified 773
449 Ga0307415_100044077 3300032126 Bacteria 2980
450 Ga0373959_0031221 3300034820 Bacteria 1077
451 Ga0373949_0010963 3300035090 Bacteria 1992
452 Ga0373951_0004416 3300035091 Bacteria 3343
453 Ga0373932_0087272 3300035112 Bacteria 996
454 Ga0373941_0152096 3300035115 Bacteria 850
455 Ga0373931_0460381 3300035691 Unclassified 815
456 Ga0395899_0535576 3300037312 Bacteria 755
457 Ga0395900_0407178 3300037418 Bacteria 1323
458 Ga0395900_0485201 3300037418 Bacteria 1188
459 Ga0395898_0248625 3300037466 Unclassified 1696
460 Ga0395901_0169384 3300038443 Bacteria 2292
461 Ga0395901_0422472 3300038443 Unclassified 1367
462 Ga0242422_00657 3300038699 Bacteria 2262
463 Ga0242420_000257 3300038996 Bacteria 5714
464 Ga0439458_0035132 3300042157 Bacteria 1204
465 Ga0453683_0208738 3300044673 Bacteria 1240
466 Ga0451576_1006859 3300045051 Unclassified 873
467 Ga0496102_1308668 3300048905 Unclassified 644
468 Ga0496106_0016526 3300048909 Bacteria 5462
469 Ga0496106_0479530 3300048909 Bacteria 999
470 Ga0496107_0423834 3300048910 Unclassified 989
471 Ga0496109_0416272 3300048912 Bacteria 1270
472 Ga0496112_0180761 3300048915 Bacteria 2073
473 Ga0496112_0201191 3300048915 Bacteria 1951
474 Ga0496112_0427051 3300048915 Bacteria 1264
475 Ga0496112_0720100 3300048915 Unclassified 925
476 Ga0496112_0786582 3300048915 Unclassified 877
477 Ga0501290_007653 3300049513 Bacteria 1356
478 Ga0501291_011369 3300049514 Bacteria 1282
479 Ga0501292_025421 3300049515 Bacteria 975
480 Ga0501294_006223 3300049517 Bacteria 1140
481 Ga0501298_010341 3300049521 Bacteria 1605
482 Ga0501298_021530 3300049521 Unclassified 1208
483 Ga0501299_009065 3300049522 Unclassified 1632
484 Ga0501300_004258 3300049523 Bacteria 2122
485 Ga0501302_013323 3300049525 Bacteria 629
486 Ga0501303_009221 3300049526 Bacteria 907
487 Ga0501202_015340 3300049652 Bacteria 1475
488 Ga0501206_002645 3300049653 Bacteria 2254
489 Ga0501206_012971 3300049653 Bacteria 1136
490 Ga0501207_008877 3300049654 Bacteria 1459
491 Ga0501208_022376 3300049655 Bacteria 1047
492 Ga0501216_016528 3300049660 Unclassified 1253
493 Ga0501217_000049 3300049661 Bacteria 13643
494 Ga0501223_006368 3300049663 Bacteria 2443
495 Ga0501223_020931 3300049663 Bacteria 1281
496 Ga0501224_010069 3300049664 Bacteria 1385
497 Ga0501227_028932 3300049665 Bacteria 1319
498 Ga0501233_003996 3300049668 Bacteria 2677
499 Ga0501235_012391 3300049669 Bacteria 1875
500 Ga0501235_024733 3300049669 Bacteria 1342
501 Ga0501236_077316 3300049670 Unclassified 618
502 Ga0501240_023413 3300049673 Bacteria 947
503 Ga0501243_002848 3300049675 Bacteria 2549
504 Ga0501250_087893 3300049680 Unclassified 538
505 Ga0501251_025528 3300049681 Unclassified 812
506 Ga0501257_014757 3300049686 Unclassified 1801
507 Ga0501257_014804 3300049686 Bacteria 1799
508 Ga0501221_018399 3300049704 Unclassified 1345
509 Ga0501221_023282 3300049704 Bacteria 1234
510 Ga0501225_0013120 3300049705 Unclassified 2320
511 Ga0501225_0024324 3300049705 Bacteria 1667
512 Ga0501225_0053825 3300049705 Bacteria 1124
513 Ga0501229_004890 3300049706 Bacteria 1635
514 Ga0501234_002077 3300049707 Bacteria 3162
515 Ga0501245_113573 3300049708 Bacteria 563
516 Ga0501264_058442 3300049761 Bacteria 514
517 Ga0501268_110394 3300049765 Bacteria 599
518 Ga0501272_004303 3300049769 Bacteria 1475
519 Ga0501273_007678 3300049770 Bacteria 1274
520 Ga0501283_000693 3300049779 Bacteria 4446
521 Ga0501283_015597 3300049779 Bacteria 1171
522 Ga0501283_016846 3300049779 Bacteria 1138
523 Ga0501212_003007 3300049851 Bacteria 2081
524 Ga0501212_003171 3300049851 Unclassified 2043
525 Ga0501212_053732 3300049851 Bacteria 686
526 Ga0501226_009028 3300049853 Bacteria 1111
527 nmdc:mga05p37_124792_c1 3300050507 Bacteria 3162
528 nmdc:mga05p37_254790_c1 3300050507 Bacteria 2103
529 nmdc:mga05p37_450663_c1 3300050507 Bacteria 1489
530 nmdc:mga05p37_504107_c1 3300050507 Bacteria 1388
531 nmdc:mga09592_439457_c1 3300050508 Unclassified 1126
532 nmdc:mga09592_584950_c1 3300050508 Unclassified 957
533 nmdc:mga09592_881820_c1 3300050508 Bacteria 753
534 nmdc:mga0qj67_219151_c1 3300050509 Unclassified 1545
535 nmdc:mga0qj67_221833_c1 3300050509 Bacteria 1534
536 nmdc:mga0qj67_398559_c1 3300050509 Unclassified 1110
537 nmdc:mga0qj67_88470_c1 3300050509 Bacteria 2487
538 nmdc:mga08y16_156918_c1 3300050511 Bacteria 2365
539 nmdc:mga08y16_77929_c1 3300050511 Bacteria 3455
540 nmdc:mga08y16_86299_c1 3300050511 Bacteria 3271
541 nmdc:mga0n895_211773_c1 3300050512 Bacteria 1968
542 nmdc:mga0rr50_1216088_c1 3300050513 Bacteria 640
543 nmdc:mga0rr50_45255_c1 3300050513 Unclassified 3233
544 nmdc:mga0a205_327172_c1 3300050515 Bacteria 1403
545 nmdc:mga0a205_37449_c1 3300050515 Bacteria 4664
546 nmdc:mga0a205_697439_c1 3300050515 Bacteria 865
547 Ga0207708_11535690
548 JGI24749J21850_1007611
549 JGI24751J29686_10000007
550 JGI25406J46586_10097565
551 rootH2_10199793
552 Ga0065714_10064426
553 Ga0065704_10101841
554 Ga0065704_10130515
555 Ga0065704_10196595
556 Ga0065712_10067732
557 Ga0065712_10074443
558 Ga0065712_10099867
559 Ga0065715_10034673
560 Ga0065715_10037974
561 Ga0065715_10089198
562 Ga0065715_10096539
563 Ga0065715_10353412
564 Ga0065715_10436535
565 Ga0065715_10508052
566 Ga0065707_10110399
567 Ga0065707_10161826
568 Ga0070676_10922826
569 Ga0070676_11338199
570 Ga0070690_100232901
571 Ga0070690_100645564
572 Ga0070690_100935055
573 Ga0070670_100000043
574 Ga0070670_100137451
575 Ga0070670_100240664
576 Ga0070670_101220215
577 Ga0070677_10166865
578 Ga0068869_100029073
579 Ga0068869_100280187
580 Ga0068869_100351866
581 Ga0068869_100724002
582 Ga0068869_100821377
583 Ga0070666_10124014
584 Ga0070682_100248198
585 Ga0070682_101794870
586 Ga0070660_100833656
587 Ga0070660_100914592
588 Ga0070660_100944078
589 Ga0070689_100001432
590 Ga0070689_100248012
591 Ga0070691_10476510
592 Ga0070687_100155391
593 Ga0070692_10888294
594 Ga0070669_100002916
595 Ga0070669_100285192
596 Ga0070669_100292481
597 Ga0070671_100892645
598 Ga0070671_101165183
599 Ga0070674_100789093
600 Ga0070674_102193672
601 Ga0070673_100003740
602 Ga0070673_100068070
603 Ga0070673_100220945
604 Ga0070673_101311830
605 Ga0070673_101533258
606 Ga0070688_101154219
607 Ga0070659_100251402
608 Ga0070701_10071625
609 Ga0070701_10309204
610 Ga0070705_100222882
611 Ga0070705_100259970
612 Ga0070705_100900149
613 Ga0070700_100000080
614 Ga0070700_100001193
615 Ga0070700_100085273
616 Ga0070700_100135098
617 Ga0070700_100393873
618 Ga0070700_100488412
619 Ga0070700_101224608
620 Ga0070700_101632089
621 Ga0070694_100094718
622 Ga0070694_100487516
623 Ga0070694_100778797
624 Ga0070694_101691934
625 Ga0070678_101223906
626 Ga0070662_100076845
627 Ga0070662_100077826
628 Ga0068867_100079259
629 Ga0068867_100506261
630 Ga0068867_100535986
631 Ga0068867_101229616
632 Ga0070685_10158772
633 Ga0070706_100000031
634 Ga0070707_100831658
635 Ga0070707_101490791
636 Ga0070698_100089128
637 Ga0070699_100046230
638 Ga0070679_100394921
639 Ga0070697_100011145
640 Ga0070697_100074495
641 Ga0070697_101139929
642 Ga0070697_101253325
643 Ga0068853_100101991
644 Ga0068853_100733366
645 Ga0068853_100933598
646 Ga0068853_101141636
647 Ga0070672_101179936
648 Ga0070695_100101529
649 Ga0070695_100145280
650 Ga0070695_100929157
651 Ga0070695_100966152
652 Ga0070696_100068239
653 Ga0070696_100465363
654 Ga0070696_101258674
655 Ga0070693_100251427
656 Ga0070693_100521279
657 Ga0070693_100970307
658 Ga0070704_100188158
659 Ga0070704_100245092
660 Ga0070704_100417842
661 Ga0070704_100479412
662 Ga0070664_100277880
663 Ga0070664_100634986
664 Ga0070664_100671569
665 Ga0070664_102132176
666 Ga0068857_100062898
667 Ga0068857_100113534
668 Ga0068857_100304938
669 Ga0068857_100350185
670 Ga0068857_101465645
671 Ga0068854_100195737
672 Ga0068854_100559676
673 Ga0068854_101013247
674 Ga0070702_100009689
675 Ga0070702_100028841
676 Ga0070702_100083445
677 Ga0070702_100215451
678 Ga0070702_100426719
679 Ga0070702_100435062
680 Ga0068859_100001336
681 Ga0068859_100014105
682 Ga0068859_100116411
683 Ga0068859_100140947
684 Ga0068859_100155304
685 Ga0068859_100183509
686 Ga0068859_100207806
687 Ga0068859_100221550
688 Ga0068859_100308794
689 Ga0068859_100314638
690 Ga0068859_100367079
691 Ga0068859_100591771
692 Ga0068859_100735450
693 Ga0068864_100010487
694 Ga0068864_100143258
695 Ga0068866_10007749
696 Ga0068861_100028882
697 Ga0068861_100031559
698 Ga0068861_100375604
699 Ga0068861_100563377
700 Ga0068861_101311895
701 Ga0068861_101375376
702 Ga0068851_10718577
703 Ga0068870_10043569
704 Ga0068870_10177765
705 Ga0068863_100021022
706 Ga0068863_100048175
707 Ga0068863_100587141
708 Ga0068863_102236219
709 Ga0068858_100115758
710 Ga0068858_100160801
711 Ga0068858_100161961
712 Ga0068858_100777069
713 Ga0068858_101066907
714 Ga0068858_101848416
715 Ga0068860_100024515
716 Ga0068860_100086733
717 Ga0068860_100421034
718 Ga0068860_100648997
719 Ga0068860_100709079
720 Ga0068860_100812527
721 Ga0068860_100873095
722 Ga0068860_101557638
723 Ga0068862_100025377
724 Ga0068862_100092956
725 Ga0068862_101788225
726 Ga0081539_10000605
727 Ga0081539_10335100
728 Ga0097621_100053776
729 Ga0097621_101894110
730 Ga0068871_102064042
731 Ga0075428_100116448
732 Ga0075428_100819414
733 Ga0075428_101569955
734 Ga0075428_102292737
735 Ga0075430_100016057
736 Ga0075430_100064812
737 Ga0075430_100410653
738 Ga0075431_100113133
739 Ga0075431_100344519
740 Ga0075431_100568905
741 Ga0075431_100711768
742 Ga0075433_10005965
743 Ga0075433_10049668
744 Ga0075433_10562564
745 Ga0075433_10814740
746 Ga0075433_10832643
747 Ga0075434_100269374
748 Ga0075429_100135098
749 Ga0097620_100001336
750 Ga0097620_100014106
751 Ga0097620_100116409
752 Ga0097620_100140947
753 Ga0097620_100155289
754 Ga0097620_100183516
755 Ga0097620_100207800
756 Ga0097620_100221559
757 Ga0097620_100308801
758 Ga0097620_100314636
759 Ga0097620_100367068
760 Ga0097620_100591787
761 Ga0097620_100735474
762 Ga0075435_100004311
763 Ga0075435_101493558
764 Ga0105251_10411017
765 Ga0105244_10216061
766 Ga0105240_10133663
767 Ga0105240_10218586
768 Ga0105240_11157511
769 Ga0105240_12326507
770 Ga0111539_10073801
771 Ga0111539_10139456
772 Ga0111539_10304735
773 Ga0111539_10380734
774 Ga0105247_10003721
775 Ga0105247_10198191
776 Ga0105247_10575164
777 Ga0105247_10789486
778 Ga0105247_10989391
779 Ga0105247_11041761
780 Ga0114129_10144230
781 Ga0114129_10166725
782 Ga0114129_10454060
783 Ga0114129_10619037
784 Ga0114129_13329413
785 Ga0105243_10036772
786 Ga0105243_10182158
787 Ga0105243_10285184
788 Ga0105243_10311604
789 Ga0105243_10721422
790 Ga0105243_11061604
791 Ga0105243_11134065
792 Ga0105243_11818870
793 Ga0105241_10101275
794 Ga0105241_10139588
795 Ga0105241_10200694
796 Ga0105241_10240830
797 Ga0105241_10706803
798 Ga0105241_12024526
799 Ga0105242_10024542
800 Ga0105242_10306813
801 Ga0105242_10742363
802 Ga0105242_11226285
803 Ga0105242_12196945
804 Ga0105248_10054441
805 Ga0105248_10605634
806 Ga0105248_10686578
807 Ga0105248_10883546
808 Ga0105237_10434226
809 Ga0105237_10537164
810 Ga0105237_10900758
811 Ga0105238_10002831
812 Ga0105238_10028664
813 Ga0105249_10064455
814 Ga0105249_10193669
815 Ga0105249_10792289
816 Ga0105249_12626189
817 Ga0105239_10100956
818 Ga0105239_12601724
819 Ga0105246_10459462
820 Ga0105246_10860159
821 Ga0105246_11442307
822 Ga0157373_10014840
823 Ga0157373_10622148
824 Ga0157373_10800031
825 Ga0157371_10410291
826 Ga0157378_10061900
827 Ga0157378_10353419
828 Ga0157378_10432921
829 Ga0157378_10504222
830 Ga0157378_12813222
831 Ga0163162_10287663
832 Ga0163162_10305728
833 Ga0163162_10617351
834 Ga0163162_10727666
835 Ga0163162_10838899
836 Ga0157372_10007416
837 Ga0157372_13385662
838 Ga0157375_10016654
839 Ga0157375_10176185
840 Ga0157375_10274946
841 Ga0157375_10405494
842 Ga0157375_10851810
843 Ga0157375_11202764
844 Ga0157375_11515756
845 Ga0157375_12012404
846 Ga0157375_12247962
847 Ga0157375_12776769
848 Ga0163163_10000559
849 Ga0163163_10267173
850 Ga0163163_10935067
851 Ga0157380_10008300
852 Ga0157380_10112730
853 Ga0157380_10496294
854 Ga0157380_12107457
855 Ga0157377_10429600
856 Ga0157377_11133389
857 Ga0157379_10310573
858 Ga0157376_10457910
859 Ga0207642_10022471
860 Ga0207710_10006954
861 Ga0207710_10097009
862 Ga0207647_10026027
863 Ga0207647_10071877
864 Ga0207645_10835075
865 Ga0207643_10023573
866 Ga0207643_10023615
867 Ga0207684_10000110
868 Ga0207654_10342602
869 Ga0207654_10419906
870 Ga0207654_10464187
871 Ga0207654_11239536
872 Ga0207695_10056413
873 Ga0207671_10126748
874 Ga0207671_10510676
875 Ga0207662_10396251
876 Ga0207657_10581961
877 Ga0207657_11024829
878 Ga0207652_10336796
879 Ga0207681_10361746
880 Ga0207681_10405982
881 Ga0207694_10008912
882 Ga0207694_10054843
883 Ga0207650_10000009
884 Ga0207650_10110864
885 Ga0207650_10152500
886 Ga0207650_10740417
887 Ga0207659_10454570
888 Ga0207687_10426104
889 Ga0207690_10224837
890 Ga0207706_10072728
891 Ga0207706_10115518
892 Ga0207686_10401485
893 Ga0207709_10005477
894 Ga0207709_10156255
895 Ga0207709_10212769
896 Ga0207670_10000752
897 Ga0207670_10418117
898 Ga0207670_11409298
899 Ga0207704_10110184
900 Ga0207704_11251689
901 Ga0207691_11012667
902 Ga0207711_10092070
903 Ga0207711_10393590
904 Ga0207711_10553465
905 Ga0207689_10028238
906 Ga0207689_10217306
907 Ga0207689_10361548
908 Ga0207689_11100368
909 Ga0207679_10076082
910 Ga0207679_10116629
911 Ga0207651_10003359
912 Ga0207651_10112944
913 Ga0207651_10784449
914 Ga0207651_11620333
915 Ga0207712_10221599
916 Ga0207712_10521524
917 Ga0207712_10584336
918 Ga0207712_10793830
919 Ga0207712_11239443
920 Ga0207640_10691958
921 Ga0207703_10045805
922 Ga0207703_10097291
923 Ga0207703_10160677
924 Ga0207703_10233127
925 Ga0207703_10245745
926 Ga0207703_10898265
927 Ga0207703_11517347
928 Ga0207639_10472562
929 Ga0207708_10001953
930 Ga0207708_10016422
931 Ga0207708_10031732
932 Ga0207708_10121657
933 Ga0207708_10129591
934 Ga0207708_10678915
935 Ga0207641_10035855
936 Ga0207641_10121040
937 Ga0207641_10521087
938 Ga0207648_10131397
939 Ga0207648_10226590
940 Ga0207648_10232603
941 Ga0207648_10988487
942 Ga0207676_10072806
943 Ga0207676_10609835
944 Ga0207674_10030260
945 Ga0207674_10037693
946 Ga0207674_10080118
947 Ga0207674_10171250
948 Ga0207674_10397996
949 Ga0207674_10441908
950 Ga0207674_10475740
951 Ga0207674_10689585
952 Ga0207675_100021636
953 Ga0207675_100127884
954 Ga0207675_100241104
955 Ga0207675_100321601
956 Ga0207675_100328428
957 Ga0207675_100617689
958 Ga0207675_102001748
959 Ga0209983_1044194
960 Ga0207428_10062860
961 Ga0207428_10288671
962 Ga0268265_10015134
963 Ga0268265_10110169
964 Ga0268265_10244112
965 Ga0268265_10336471
966 Ga0268264_10115105
967 Ga0268264_10122206
968 Ga0268264_10252304
969 Ga0268264_10299984
970 Ga0268264_10383307
971 Ga0268264_10463666
972 Ga0268264_11080908
973 Ga0268264_12136542
974 Ga0307408_100087743
975 Ga0307408_100525204
976 Ga0307408_100672330
977 Ga0307408_100677257
978 Ga0307413_10097147
979 Ga0307410_10113104
980 Ga0307406_10002322
981 Ga0307406_10335216
982 Ga0307406_11195500
983 Ga0307407_10145301
984 Ga0307407_10437271
985 Ga0307412_10087589
986 Ga0307412_10136102
987 Ga0307412_11148624
988 Ga0307409_100326031
989 Ga0307416_100027875
990 Ga0307416_100098085
991 Ga0307416_100180975
992 Ga0307414_10001349
993 Ga0307411_10353126
994 Ga0307411_10932788
995 Ga0307415_100044077
996 Ga0373959_0031221
997 Ga0373949_0010963
998 Ga0373951_0004416
999 Ga0373932_0087272
1000 Ga0373941_0152096
1001 Ga0373931_0460381
1002 Ga0395899_0535576
1003 Ga0395900_0407178
1004 Ga0395900_0485201
1005 Ga0395898_0248625
1006 Ga0395901_0169384
1007 Ga0395901_0422472
1008 Ga0242422_00657
1009 Ga0242420_000257
1010 Ga0439458_0035132
1011 Ga0453683_0208738
1012 Ga0451576_1006859
1013 Ga0496102_1308668
1014 Ga0496106_0016526
1015 Ga0496106_0479530
1016 Ga0496107_0423834
1017 Ga0496109_0416272
1018 Ga0496112_0180761
1019 Ga0496112_0201191
1020 Ga0496112_0427051
1021 Ga0496112_0720100
1022 Ga0496112_0786582
1023 Ga0501290_007653
1024 Ga0501291_011369
1025 Ga0501292_025421
1026 Ga0501294_006223
1027 Ga0501298_010341
1028 Ga0501298_021530
1029 Ga0501299_009065
1030 Ga0501300_004258
1031 Ga0501302_013323
1032 Ga0501303_009221
1033 Ga0501202_015340
1034 Ga0501206_002645
1035 Ga0501206_012971
1036 Ga0501207_008877
1037 Ga0501208_022376
1038 Ga0501216_016528
1039 Ga0501217_000049
1040 Ga0501223_006368
1041 Ga0501223_020931
1042 Ga0501224_010069
1043 Ga0501227_028932
1044 Ga0501233_003996
1045 Ga0501235_012391
1046 Ga0501235_024733
1047 Ga0501236_077316
1048 Ga0501240_023413
1049 Ga0501243_002848
1050 Ga0501250_087893
1051 Ga0501251_025528
1052 Ga0501257_014757
1053 Ga0501257_014804
1054 Ga0501221_018399
1055 Ga0501221_023282
1056 Ga0501225_0013120
1057 Ga0501225_0024324
1058 Ga0501225_0053825
1059 Ga0501229_004890
1060 Ga0501234_002077
1061 Ga0501245_113573
1062 Ga0501264_058442
1063 Ga0501268_110394
1064 Ga0501272_004303
1065 Ga0501273_007678
1066 Ga0501283_000693
1067 Ga0501283_015597
1068 Ga0501283_016846
1069 Ga0501212_003007
1070 Ga0501212_003171
1071 Ga0501212_053732
1072 Ga0501226_009028
1073 nmdc:mga05p37_124792_c1
1074 nmdc:mga05p37_254790_c1
1075 nmdc:mga05p37_450663_c1
1076 nmdc:mga05p37_504107_c1
1077 nmdc:mga09592_439457_c1
1078 nmdc:mga09592_584950_c1
1079 nmdc:mga09592_881820_c1
1080 nmdc:mga0qj67_219151_c1
1081 nmdc:mga0qj67_221833_c1
1082 nmdc:mga0qj67_398559_c1
1083 nmdc:mga0qj67_88470_c1
1084 nmdc:mga08y16_156918_c1
1085 nmdc:mga08y16_77929_c1
1086 nmdc:mga08y16_86299_c1
1087 nmdc:mga0n895_211773_c1
1088 nmdc:mga0rr50_1216088_c1
1089 nmdc:mga0rr50_45255_c1
1090 nmdc:mga0a205_327172_c1
1091 nmdc:mga0a205_37449_c1
1092 nmdc:mga0a205_697439_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

6

113

0.89

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

4

116

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.9686 2 132
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.963 5 132
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.9544 2 132
3k67-assembly1.cif.gz_A crystal structure of protein af1124 from archaeoglobus fulgidus 0.9316 1 132
3ir3-assembly1.cif.gz_B crystal structure of human 3-hydroxyacyl-thioester dehydratase 2 (htd2) 0.917 3 132
ID Description Score Start End Superfamily
af_A0A2R8QPM6_23_166_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9855 5 134 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9686 2 132 3.10.129.10
af_A4HT66_2_132_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9655 1 117 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.963 5 132 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9544 2 132 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3M1EN37-F1-model_v4 MaoC family dehydratase 0.9968 4 134 GO:0006633
GO:0019171
AF-A0A2U3KUN0-F1-model_v4 (R)-specific enoyl-CoA hydratase (EC 4.2.1.119) 0.9963 5 131 GO:0006633
GO:0019171
AF-A0A7Y9A069-F1-model_v4 deleted 0.9959 3 130
AF-K0NK11-F1-model_v4 MaoC domain protein dehydratase 0.9955 4 130 GO:0006633
GO:0019171
AF-A0A7V8QIX0-F1-model_v4 MaoC family dehydratase 0.995 5 132 GO:0004312
GO:0005835
GO:0006633
GO:0019171

Map