F461962

General Info

Members Datasets Scaffolds Average Seq Length
546 249 546 226

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100014868|Ga0070698_1000148684
Length 267
Sequence LNQLIIFPQIESGRGLTVNQRVVGSSPTGGANPDHSGFLFFMPSTFANSLINFYSSLRPPRNLPKGFEILFPQKDKQVIELVKEFFEKYFNDNKPRHLMLGINPGRFGAGITGVNFTAPKQLKECCGINHHLKLSSELSAEFIYDMIGEYGGVNKFYEDWCIGAVCPLGFIKNGKNINYYDDKKLLDAVTPFIVDCISKQLTIGFTTEKCLCIGGEKNFKFLSALNNEHKWFDEIIPLPHPRFILQYRRKQKDKYIHQYLSAMRFVG

Samples

Sample ID Description Type Environment
1 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
164 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
171 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
172 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
173 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
174 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
202 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
219 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
220 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
221 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
222 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
223 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
224 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
225 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
226 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
227 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
228 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
229 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
230 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
231 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
232 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
233 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
238 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
239 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0.92
Rhizosphere 96.89
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1016325 3300002155 Bacteria 922
2 JGI24751J29686_10005036 3300002459 Bacteria 2694
3 rootH1_10029625 3300003316 Bacteria 18840
4 rootH1_10013586 3300003323 Bacteria 56239
5 rootH1_10190106 3300003323 Unclassified 2731
6 Ga0065704_10142136 3300005289 Bacteria 1507
7 Ga0065712_10069343 3300005290 Bacteria 7454
8 Ga0065712_10089384 3300005290 Bacteria 2468
9 Ga0065712_10098111 3300005290 Bacteria 2129
10 Ga0065707_10443612 3300005295 Bacteria 807
11 Ga0070658_10076310 3300005327 Bacteria 2749
12 Ga0070658_10331531 3300005327 Bacteria 1300
13 Ga0070658_10616322 3300005327 Bacteria 941
14 Ga0070676_10033029 3300005328 Bacteria 2967
15 Ga0070676_10259949 3300005328 Bacteria 1162
16 Ga0070683_100016639 3300005329 Bacteria 6489
17 Ga0070683_100176368 3300005329 Bacteria 2029
18 Ga0070690_100007818 3300005330 Bacteria 6130
19 Ga0070690_100018610 3300005330 Bacteria 4198
20 Ga0070670_100031914 3300005331 Bacteria 4535
21 Ga0070670_100039643 3300005331 Bacteria 4050
22 Ga0070670_100063592 3300005331 Unclassified 3167
23 Ga0070670_100205433 3300005331 Unclassified 1712
24 Ga0070670_100413387 3300005331 Bacteria 1192
25 Ga0070670_100418592 3300005331 Bacteria 1184
26 Ga0070670_100575085 3300005331 Bacteria 1007
27 Ga0070677_10114268 3300005333 Unclassified 1210
28 Ga0068869_100024930 3300005334 Unclassified 4147
29 Ga0068869_100038203 3300005334 Bacteria 3419
30 Ga0068869_100039372 3300005334 Bacteria 3374
31 Ga0068869_100170635 3300005334 Bacteria 1699
32 Ga0068869_100253435 3300005334 Bacteria 1406
33 Ga0068869_100294960 3300005334 Bacteria 1307
34 Ga0070680_100039245 3300005336 Bacteria 3832
35 Ga0070680_100048526 3300005336 Bacteria 3460
36 Ga0070682_100389964 3300005337 Bacteria 1050
37 Ga0068868_100152462 3300005338 Bacteria 1904
38 Ga0070660_100241808 3300005339 Bacteria 1470
39 Ga0070689_100010320 3300005340 Bacteria 6658
40 Ga0070689_100072606 3300005340 Bacteria 2690
41 Ga0070689_100181709 3300005340 Bacteria 1708
42 Ga0070689_100248050 3300005340 Bacteria 1468
43 Ga0070689_100276570 3300005340 Bacteria 1392
44 Ga0070687_100008441 3300005343 Bacteria 4365
45 Ga0070687_100059265 3300005343 Bacteria 2015
46 Ga0070661_100002300 3300005344 Bacteria 13107
47 Ga0070661_100124842 3300005344 Bacteria 1930
48 Ga0070661_100402190 3300005344 Unclassified 1083
49 Ga0070661_100596050 3300005344 Bacteria 893
50 Ga0070668_100016452 3300005347 Bacteria 5529
51 Ga0070668_100051654 3300005347 Unclassified 3168
52 Ga0070669_100009392 3300005353 Bacteria 6964
53 Ga0070669_100435245 3300005353 Bacteria 1079
54 Ga0070675_100031496 3300005354 Bacteria 4287
55 Ga0070675_100039452 3300005354 Bacteria 3853
56 Ga0070675_100081769 3300005354 Bacteria 2694
57 Ga0070671_100076099 3300005355 Bacteria 2804
58 Ga0070674_100001648 3300005356 Bacteria 12038
59 Ga0070674_100080775 3300005356 Bacteria 2322
60 Ga0070673_100004691 3300005364 Bacteria 8676
61 Ga0070673_100008798 3300005364 Bacteria 6740
62 Ga0070673_100256683 3300005364 Bacteria 1526
63 Ga0070673_100454072 3300005364 Unclassified 1153
64 Ga0070688_100039255 3300005365 Bacteria 2896
65 Ga0070688_100067247 3300005365 Bacteria 2282
66 Ga0070659_100004312 3300005366 Bacteria 10156
67 Ga0070659_100013751 3300005366 Bacteria 6034
68 Ga0070659_100274152 3300005366 Bacteria 1402
69 Ga0070667_100022489 3300005367 Bacteria 5229
70 Ga0070667_100025252 3300005367 Bacteria 4939
71 Ga0070667_100049450 3300005367 Bacteria 3541
72 Ga0070667_100063955 3300005367 Bacteria 3120
73 Ga0070667_100157078 3300005367 Bacteria 2001
74 Ga0070667_100207073 3300005367 Bacteria 1742
75 Ga0070667_100229258 3300005367 Bacteria 1656
76 Ga0070700_100130561 3300005441 Unclassified 1695
77 Ga0070663_100468387 3300005455 Bacteria 1041
78 Ga0070678_100005819 3300005456 Bacteria 7174
79 Ga0070678_100318273 3300005456 Bacteria 1328
80 Ga0070662_100085592 3300005457 Bacteria 2356
81 Ga0070662_100201697 3300005457 Bacteria 1579
82 Ga0070681_10078765 3300005458 Bacteria 3252
83 Ga0068867_100020556 3300005459 Bacteria 4704
84 Ga0068867_100094772 3300005459 Bacteria 2270
85 Ga0068867_100232600 3300005459 Unclassified 1491
86 Ga0070685_10009887 3300005466 Bacteria 4947
87 Ga0070685_10013262 3300005466 Bacteria 4344
88 Ga0070685_10162543 3300005466 Bacteria 1424
89 Ga0070685_10181736 3300005466 Bacteria 1354
90 Ga0070685_10331560 3300005466 Bacteria 1035
91 Ga0070698_100000850 3300005471 Bacteria 33482
92 Ga0070698_100004109 3300005471 Bacteria 15995
93 Ga0070698_100014868 3300005471 Bacteria 8228
94 Ga0070679_100415187 3300005530 Bacteria 1291
95 Ga0070684_100022182 3300005535 Bacteria 5292
96 Ga0070684_100022308 3300005535 Bacteria 5278
97 Ga0070684_100120385 3300005535 Bacteria 2361
98 Ga0068853_100150588 3300005539 Unclassified 2094
99 Ga0068853_100415622 3300005539 Bacteria 1261
100 Ga0070672_100066443 3300005543 Unclassified 2856
101 Ga0070672_100080044 3300005543 Bacteria 2617
102 Ga0070672_100649454 3300005543 Bacteria 921
103 Ga0070686_100250154 3300005544 Bacteria 1294
104 Ga0070696_100452002 3300005546 Bacteria 1014
105 Ga0070693_100157355 3300005547 Bacteria 1444
106 Ga0070693_100189238 3300005547 Bacteria 1330
107 Ga0070665_100024173 3300005548 Bacteria 6119
108 Ga0068855_100000360 3300005563 Bacteria 56448
109 Ga0068855_100003314 3300005563 Bacteria 19707
110 Ga0068855_100036791 3300005563 Bacteria 5824
111 Ga0068855_101496619 3300005563 Bacteria 693
112 Ga0070664_100004401 3300005564 Bacteria 11316
113 Ga0070664_100016177 3300005564 Bacteria 6113
114 Ga0070664_100071188 3300005564 Bacteria 2979
115 Ga0070664_100159350 3300005564 Bacteria 1996
116 Ga0068857_100116218 3300005577 Bacteria 2406
117 Ga0068857_100318665 3300005577 Bacteria 1435
118 Ga0068857_100344234 3300005577 Bacteria 1380
119 Ga0068857_100449667 3300005577 Bacteria 1204
120 Ga0068854_100396618 3300005578 Bacteria 1141
121 Ga0068856_100011354 3300005614 Bacteria 8640
122 Ga0068856_100116075 3300005614 Bacteria 2677
123 Ga0070702_100083162 3300005615 Bacteria 1922
124 Ga0070702_100111290 3300005615 Unclassified 1698
125 Ga0068852_100028801 3300005616 Unclassified 4551
126 Ga0068852_100103626 3300005616 Unclassified 2573
127 Ga0068852_100208147 3300005616 Bacteria 1854
128 Ga0068852_100214438 3300005616 Bacteria 1828
129 Ga0068852_100439721 3300005616 Bacteria 1289
130 Ga0068859_100024316 3300005617 Bacteria 6079
131 Ga0068859_100029692 3300005617 Bacteria 5486
132 Ga0068859_100057873 3300005617 Bacteria 3904
133 Ga0068859_100223852 3300005617 Bacteria 1969
134 Ga0068859_100456859 3300005617 Bacteria 1373
135 Ga0068864_100094589 3300005618 Bacteria 2641
136 Ga0068864_100314582 3300005618 Bacteria 1469
137 Ga0068866_10160148 3300005718 Bacteria 1312
138 Ga0068866_10501291 3300005718 Bacteria 803
139 Ga0068861_100005859 3300005719 Bacteria 8350
140 Ga0068861_100019717 3300005719 Unclassified 4819
141 Ga0068861_100263676 3300005719 Bacteria 1476
142 Ga0068851_10165613 3300005834 Unclassified 1217
143 Ga0068870_10006480 3300005840 Bacteria 5162
144 Ga0068870_10027277 3300005840 Unclassified 2855
145 Ga0068870_10059538 3300005840 Bacteria 2047
146 Ga0068863_100002626 3300005841 Bacteria 17790
147 Ga0068863_100043354 3300005841 Bacteria 4272
148 Ga0068863_100305052 3300005841 Bacteria 1545
149 Ga0068863_100356466 3300005841 Bacteria 1425
150 Ga0068858_100021178 3300005842 Bacteria 6070
151 Ga0068860_100019681 3300005843 Bacteria 6544
152 Ga0068860_100317241 3300005843 Bacteria 1529
153 Ga0068860_100488699 3300005843 Bacteria 1228
154 Ga0068860_100637769 3300005843 Bacteria 1073
155 Ga0068860_100905070 3300005843 Bacteria 898
156 Ga0068862_100003351 3300005844 Bacteria 13826
157 Ga0068862_100704406 3300005844 Bacteria 978
158 Ga0081539_10006924 3300005985 Bacteria 10558
159 Ga0075366_10035432 3300006195 Bacteria 2942
160 Ga0097621_100006264 3300006237 Bacteria 8441
161 Ga0097621_100074380 3300006237 Bacteria 2814
162 Ga0097621_100087404 3300006237 Bacteria 2603
163 Ga0097621_100178070 3300006237 Bacteria 1836
164 Ga0075370_10077126 3300006353 Bacteria 1912
165 Ga0068871_100037989 3300006358 Bacteria 3842
166 Ga0068871_100163860 3300006358 Bacteria 1902
167 Ga0068871_100675599 3300006358 Unclassified 944
168 Ga0075428_100006044 3300006844 Bacteria 13447
169 Ga0075430_100050574 3300006846 Bacteria 3503
170 Ga0075430_100295852 3300006846 Bacteria 1339
171 Ga0075431_100042982 3300006847 Bacteria 4662
172 Ga0075429_100009389 3300006880 Bacteria 8493
173 Ga0075429_100134247 3300006880 Bacteria 2165
174 Ga0068865_100238101 3300006881 Unclassified 1431
175 Ga0068865_100286117 3300006881 Bacteria 1314
176 Ga0097620_100024315 3300006931 Bacteria 6079
177 Ga0097620_100029695 3300006931 Bacteria 5486
178 Ga0097620_100057874 3300006931 Bacteria 3904
179 Ga0097620_100223851 3300006931 Bacteria 1969
180 Ga0097620_100456911 3300006931 Bacteria 1373
181 Ga0111539_10005967 3300009094 Bacteria 15729
182 Ga0111539_10218242 3300009094 Unclassified 2221
183 Ga0111539_10808873 3300009094 Unclassified 1091
184 Ga0114129_10278991 3300009147 Bacteria 2233
185 Ga0114129_10500799 3300009147 Unclassified 1587
186 Ga0105241_10029199 3300009174 Bacteria 4112
187 Ga0105241_10076128 3300009174 Bacteria 2616
188 Ga0105242_10057927 3300009176 Bacteria 3174
189 Ga0105242_10086766 3300009176 Bacteria 2627
190 Ga0105242_10263140 3300009176 Bacteria 1559
191 Ga0105237_10034271 3300009545 Bacteria 5142
192 Ga0105237_10639202 3300009545 Bacteria 1071
193 Ga0105249_10017149 3300009553 Bacteria 6428
194 Ga0105249_10041401 3300009553 Bacteria 4188
195 Ga0105249_10052075 3300009553 Bacteria 3737
196 Ga0105249_10102058 3300009553 Bacteria 2699
197 Ga0105249_10126174 3300009553 Bacteria 2437
198 Ga0105249_11525250 3300009553 Bacteria 741
199 Ga0105239_10100826 3300010375 Bacteria 3194
200 Ga0105239_10546743 3300010375 Bacteria 1319
201 Ga0105246_10006224 3300011119 Bacteria 7283
202 Ga0157373_10002878 3300013100 Bacteria 13024
203 Ga0157373_10071982 3300013100 Bacteria 2441
204 Ga0157373_10202362 3300013100 Bacteria 1400
205 Ga0157371_10000759 3300013102 Bacteria 37290
206 Ga0157371_10002453 3300013102 Bacteria 17674
207 Ga0157371_10004775 3300013102 Bacteria 11681
208 Ga0157371_10139803 3300013102 Unclassified 1725
209 Ga0157371_10200353 3300013102 Bacteria 1431
210 Ga0157371_10227350 3300013102 Unclassified 1340
211 Ga0157371_10327683 3300013102 Bacteria 1112
212 Ga0157371_10401641 3300013102 Viruses 1003
213 Ga0157371_10455733 3300013102 Bacteria 941
214 Ga0157370_10031483 3300013104 Bacteria 5187
215 Ga0157370_10042608 3300013104 Bacteria 4373
216 Ga0157369_10000649 3300013105 Bacteria 44919
217 Ga0157369_10009819 3300013105 Bacteria 10946
218 Ga0157369_10482214 3300013105 Bacteria 1283
219 Ga0157374_10003515 3300013296 Bacteria 13176
220 Ga0157374_10330767 3300013296 Bacteria 1511
221 Ga0157378_10007504 3300013297 Bacteria 9523
222 Ga0157378_10014376 3300013297 Bacteria 6930
223 Ga0157378_10237249 3300013297 Bacteria 1741
224 Ga0163162_10483953 3300013306 Bacteria 1369
225 Ga0157372_10000286 3300013307 Bacteria 56140
226 Ga0157372_10012542 3300013307 Bacteria 9026
227 Ga0157372_10015567 3300013307 Bacteria 8152
228 Ga0157372_10018135 3300013307 Bacteria 7567
229 Ga0157372_10188620 3300013307 Bacteria 2388
230 Ga0157372_10248830 3300013307 Bacteria 2063
231 Ga0157372_10254617 3300013307 Bacteria 2038
232 Ga0157372_10278784 3300013307 Bacteria 1943
233 Ga0157372_10343305 3300013307 Bacteria 1739
234 Ga0157372_10394889 3300013307 Bacteria 1612
235 Ga0157372_10491736 3300013307 Bacteria 1430
236 Ga0157372_10656591 3300013307 Bacteria 1221
237 Ga0157372_10778513 3300013307 Bacteria 1112
238 Ga0157372_10782177 3300013307 Bacteria 1109
239 Ga0157372_11157462 3300013307 Bacteria 894
240 Ga0157375_10032149 3300013308 Bacteria 4973
241 Ga0157375_10060558 3300013308 Bacteria 3755
242 Ga0157375_10128375 3300013308 Bacteria 2653
243 Ga0157375_10215427 3300013308 Bacteria 2078
244 Ga0157375_10290815 3300013308 Bacteria 1797
245 Ga0157375_10542787 3300013308 Unclassified 1325
246 Ga0163163_10004186 3300014325 Bacteria 12293
247 Ga0163163_10218352 3300014325 Bacteria 1955
248 Ga0163163_10390362 3300014325 Bacteria 1450
249 Ga0163163_10741523 3300014325 Bacteria 1046
250 Ga0157380_10001482 3300014326 Bacteria 15353
251 Ga0157380_10016574 3300014326 Bacteria 5437
252 Ga0157380_10050516 3300014326 Bacteria 3285
253 Ga0157380_10066077 3300014326 Bacteria 2908
254 Ga0157377_10001624 3300014745 Bacteria 9808
255 Ga0157377_10024652 3300014745 Unclassified 3199
256 Ga0157377_10125742 3300014745 Bacteria 1560
257 Ga0157377_10152879 3300014745 Bacteria 1428
258 Ga0157377_10231692 3300014745 Bacteria 1188
259 Ga0157379_10168189 3300014968 Bacteria 1979
260 Ga0157379_10433249 3300014968 Bacteria 1212
261 Ga0157376_10004113 3300014969 Bacteria 10077
262 Ga0157376_10038982 3300014969 Bacteria 3870
263 Ga0163161_10106863 3300017792 Bacteria 2088
264 Ga0163161_10127035 3300017792 Bacteria 1921
265 Ga0163161_10137494 3300017792 Bacteria 1848
266 Ga0163161_10224343 3300017792 Bacteria 1456
267 Ga0207697_10046159 3300025315 Bacteria 1794
268 Ga0207697_10140954 3300025315 Bacteria 1046
269 Ga0207682_10015737 3300025893 Unclassified 2948
270 Ga0207682_10064999 3300025893 Bacteria 1535
271 Ga0207642_10029934 3300025899 Bacteria 2262
272 Ga0207688_10202682 3300025901 Bacteria 1190
273 Ga0207680_10078162 3300025903 Bacteria 2071
274 Ga0207647_10000222 3300025904 Bacteria 46878
275 Ga0207645_10000193 3300025907 Bacteria 49552
276 Ga0207645_10101841 3300025907 Bacteria 1853
277 Ga0207645_10311153 3300025907 Bacteria 1050
278 Ga0207643_10001613 3300025908 Bacteria 12724
279 Ga0207643_10025474 3300025908 Unclassified 3269
280 Ga0207643_10027656 3300025908 Bacteria 3145
281 Ga0207705_10073555 3300025909 Bacteria 2479
282 Ga0207705_10110156 3300025909 Bacteria 2034
283 Ga0207654_10171215 3300025911 Bacteria 1410
284 Ga0207671_10389647 3300025914 Bacteria 1107
285 Ga0207660_10292502 3300025917 Bacteria 1295
286 Ga0207662_10002565 3300025918 Bacteria 9154
287 Ga0207662_10003058 3300025918 Bacteria 8539
288 Ga0207662_10072128 3300025918 Bacteria 2092
289 Ga0207657_10063488 3300025919 Bacteria 3157
290 Ga0207649_10000692 3300025920 Bacteria 22205
291 Ga0207649_10020465 3300025920 Bacteria 3796
292 Ga0207649_10090615 3300025920 Bacteria 2001
293 Ga0207649_10429241 3300025920 Unclassified 994
294 Ga0207649_10454822 3300025920 Bacteria 967
295 Ga0207652_10146147 3300025921 Bacteria 2116
296 Ga0207681_10001299 3300025923 Bacteria 16119
297 Ga0207681_10041750 3300025923 Bacteria 3060
298 Ga0207681_10253365 3300025923 Bacteria 1375
299 Ga0207650_10003475 3300025925 Bacteria 10822
300 Ga0207650_10065927 3300025925 Bacteria 2715
301 Ga0207650_10091268 3300025925 Bacteria 2327
302 Ga0207650_10323265 3300025925 Unclassified 1264
303 Ga0207650_10360452 3300025925 Bacteria 1198
304 Ga0207650_10484220 3300025925 Bacteria 1033
305 Ga0207650_10519698 3300025925 Bacteria 996
306 Ga0207659_10023782 3300025926 Bacteria 4095
307 Ga0207659_10095141 3300025926 Bacteria 2233
308 Ga0207659_10115311 3300025926 Unclassified 2049
309 Ga0207659_10196463 3300025926 Bacteria 1608
310 Ga0207644_10035387 3300025931 Bacteria 3499
311 Ga0207644_10082902 3300025931 Bacteria 2373
312 Ga0207644_10200300 3300025931 Unclassified 1575
313 Ga0207690_10013541 3300025932 Unclassified 4902
314 Ga0207690_10050668 3300025932 Unclassified 2772
315 Ga0207706_10018203 3300025933 Bacteria 6321
316 Ga0207706_10025836 3300025933 Bacteria 5260
317 Ga0207706_10025956 3300025933 Bacteria 5246
318 Ga0207706_10113298 3300025933 Bacteria 2386
319 Ga0207686_10016170 3300025934 Bacteria 4183
320 Ga0207686_10144459 3300025934 Bacteria 1648
321 Ga0207686_10235610 3300025934 Bacteria 1329
322 Ga0207686_10251609 3300025934 Unclassified 1291
323 Ga0207670_10112991 3300025936 Bacteria 1961
324 Ga0207670_10672738 3300025936 Bacteria 855
325 Ga0207669_10125163 3300025937 Bacteria 1754
326 Ga0207669_10345595 3300025937 Bacteria 1147
327 Ga0207704_10008895 3300025938 Bacteria 4824
328 Ga0207691_10032197 3300025940 Bacteria 4890
329 Ga0207691_10038430 3300025940 Unclassified 4429
330 Ga0207691_10064987 3300025940 Unclassified 3304
331 Ga0207691_10078042 3300025940 Bacteria 2981
332 Ga0207691_10220675 3300025940 Bacteria 1644
333 Ga0207689_10001011 3300025942 Bacteria 27034
334 Ga0207689_10023267 3300025942 Bacteria 5202
335 Ga0207689_10037207 3300025942 Bacteria 4038
336 Ga0207689_10174858 3300025942 Bacteria 1770
337 Ga0207689_10258128 3300025942 Bacteria 1442
338 Ga0207661_10001026 3300025944 Bacteria 18511
339 Ga0207661_10064928 3300025944 Unclassified 2961
340 Ga0207661_10327764 3300025944 Bacteria 1378
341 Ga0207661_10501389 3300025944 Unclassified 1109
342 Ga0207679_10000899 3300025945 Bacteria 18985
343 Ga0207679_10011358 3300025945 Bacteria 5763
344 Ga0207667_10022688 3300025949 Bacteria 6924
345 Ga0207651_10009038 3300025960 Bacteria 5422
346 Ga0207651_10119137 3300025960 Unclassified 1998
347 Ga0207651_10210676 3300025960 Bacteria 1564
348 Ga0207712_10028723 3300025961 Bacteria 3722
349 Ga0207712_10037488 3300025961 Unclassified 3308
350 Ga0207712_10110680 3300025961 Bacteria 2060
351 Ga0207712_10112593 3300025961 Bacteria 2044
352 Ga0207712_10390927 3300025961 Bacteria 1166
353 Ga0207668_10147110 3300025972 Unclassified 1819
354 Ga0207640_10427981 3300025981 Unclassified 1085
355 Ga0207658_10052938 3300025986 Bacteria 2997
356 Ga0207658_10093864 3300025986 Bacteria 2334
357 Ga0207658_10197532 3300025986 Bacteria 1677
358 Ga0207658_10788484 3300025986 Bacteria 862
359 Ga0207677_10502199 3300026023 Bacteria 1049
360 Ga0207703_10033056 3300026035 Bacteria 4098
361 Ga0207703_10040684 3300026035 Bacteria 3721
362 Ga0207703_10107916 3300026035 Bacteria 2370
363 Ga0207639_10131772 3300026041 Bacteria 2070
364 Ga0207639_10260176 3300026041 Bacteria 1517
365 Ga0207639_10593778 3300026041 Bacteria 1020
366 Ga0207708_10063604 3300026075 Bacteria 2819
367 Ga0207708_10197584 3300026075 Bacteria 1603
368 Ga0207708_10217130 3300026075 Bacteria 1531
369 Ga0207708_10698245 3300026075 Bacteria 867
370 Ga0207702_10174568 3300026078 Unclassified 1973
371 Ga0207641_10000391 3300026088 Bacteria 51728
372 Ga0207641_10068745 3300026088 Bacteria 3038
373 Ga0207641_10079633 3300026088 Bacteria 2840
374 Ga0207641_10334028 3300026088 Bacteria 1440
375 Ga0207641_10346539 3300026088 Bacteria 1415
376 Ga0207641_10628679 3300026088 Bacteria 1053
377 Ga0207648_10000914 3300026089 Bacteria 33242
378 Ga0207648_10040883 3300026089 Bacteria 4073
379 Ga0207648_10076243 3300026089 Bacteria 2923
380 Ga0207648_10109797 3300026089 Bacteria 2421
381 Ga0207648_10193148 3300026089 Bacteria 1805
382 Ga0207648_10442505 3300026089 Bacteria 1182
383 Ga0207676_10018134 3300026095 Bacteria 5112
384 Ga0207676_10357639 3300026095 Bacteria 1352
385 Ga0207676_10461892 3300026095 Bacteria 1199
386 Ga0207674_10002085 3300026116 Bacteria 25310
387 Ga0207674_10031469 3300026116 Bacteria 5574
388 Ga0207674_10048098 3300026116 Bacteria 4368
389 Ga0207674_10180819 3300026116 Unclassified 2060
390 Ga0207674_10252643 3300026116 Bacteria 1710
391 Ga0207675_100000609 3300026118 Bacteria 34912
392 Ga0207675_100006617 3300026118 Bacteria 10961
393 Ga0207683_10010010 3300026121 Bacteria 8092
394 Ga0207683_10524700 3300026121 Bacteria 1094
395 Ga0207698_10019672 3300026142 Unclassified 4628
396 Ga0207698_10051333 3300026142 Bacteria 3153
397 Ga0207698_10108076 3300026142 Bacteria 2324
398 Ga0207698_10184020 3300026142 Bacteria 1854
399 Ga0207698_10658984 3300026142 Unclassified 1038
400 Ga0209984_1006248 3300027424 Unclassified 1457
401 Ga0268266_10026495 3300028379 Bacteria 4933
402 Ga0268265_10031279 3300028380 Unclassified 3842
403 Ga0268265_10617893 3300028380 Unclassified 1038
404 Ga0268264_10015799 3300028381 Bacteria 6181
405 Ga0268264_10287090 3300028381 Bacteria 1544
406 Ga0268264_10332113 3300028381 Bacteria 1441
407 Ga0268264_10393787 3300028381 Bacteria 1329
408 Ga0268264_10795751 3300028381 Bacteria 944
409 Ga0307509_10358094 3300031507 Bacteria 1180
410 Ga0307405_10191499 3300031731 Bacteria 1478
411 Ga0307414_10154074 3300032004 Bacteria 1817
412 Ga0307415_100962965 3300032126 Bacteria 791
413 Ga0373943_0144650 3300035170 Bacteria 1284
414 Ga0373947_0315056 3300035725 Unclassified 1045
415 Ga0373937_0055269 3300036401 Bacteria 3644
416 Ga0373937_0194953 3300036401 Bacteria 1904
417 Ga0373925_0124941 3300037068 Bacteria 2001
418 Ga0395899_0000434 3300037312 Bacteria 48146
419 Ga0395899_0002489 3300037312 Bacteria 14953
420 Ga0395900_0011518 3300037418 Bacteria 9053
421 Ga0395900_0203322 3300037418 Bacteria 2003
422 Ga0395898_0001675 3300037466 Bacteria 29715
423 Ga0395905_0001879 3300037471 Bacteria 24200
424 Ga0395905_0018021 3300037471 Bacteria 6704
425 Ga0395901_0051567 3300038443 Bacteria 4278
426 Ga0400488_61630 3300038741 Bacteria 1218
427 Ga0400483_009164 3300039062 Bacteria 12795
428 Ga0400483_228548 3300039062 Bacteria 24426
429 Ga0436365_1633088 3300039437 Bacteria 4136
430 Ga0439439_0005494 3300041406 Bacteria 2896
431 Ga0451807_1521263 3300041486 Unclassified 1277
432 Ga0451853_2687340 3300041512 Unclassified 809
433 Ga0439431_0016082 3300041997 Bacteria 1748
434 Ga0439441_014989 3300042001 Bacteria 1366
435 Ga0439442_041015 3300042002 Unclassified 972
436 Ga0439457_007513 3300042014 Bacteria 2611
437 Ga0450897_001649 3300042128 Bacteria 1551
438 Ga0450898_015402 3300042134 Bacteria 1295
439 Ga0439446_0089765 3300042156 Bacteria 961
440 Ga0439434_0032651 3300042435 Bacteria 1585
441 Ga0451577_0376999 3300042876 Unclassified 1287
442 Ga0451577_0484082 3300042876 Unclassified 1123
443 Ga0451577_0519378 3300042876 Bacteria 1081
444 Ga0466969_0037723 3300044656 Bacteria 2436
445 Ga0466966_0003138 3300044684 Bacteria 10876
446 Ga0453684_0009134 3300044712 Bacteria 17454
447 Ga0453684_0029600 3300044712 Bacteria 7766
448 Ga0453684_0084867 3300044712 Bacteria 3937
449 Ga0453684_0086565 3300044712 Bacteria 3888
450 Ga0453684_0116434 3300044712 Bacteria 3236
451 Ga0453684_0162759 3300044712 Bacteria 2637
452 Ga0453684_0691542 3300044712 Bacteria 1109
453 Ga0466959_0038477 3300045049 Bacteria 3535
454 Ga0451576_0255989 3300045051 Bacteria 1829
455 Ga0451576_0490092 3300045051 Bacteria 1291
456 Ga0495653_0179418 3300046463 Bacteria 1455
457 Ga0495650_0026898 3300046471 Bacteria 2667
458 Ga0495662_0219150 3300046476 Bacteria 938
459 Ga0495628_0285039 3300046516 Bacteria 1226
460 Ga0495643_0169722 3300046522 Bacteria 1067
461 Ga0495640_0281301 3300046533 Bacteria 1036
462 Ga0495621_0049399 3300046539 Bacteria 1501
463 Ga0495667_0089691 3300046559 Unclassified 1993
464 Ga0495634_0019294 3300046642 Bacteria 4846
465 Ga0495657_0048683 3300046675 Bacteria 2858
466 Ga0495613_0417957 3300046689 Unclassified 913
467 Ga0495672_0016483 3300047320 Unclassified 4977
468 Ga0495684_0262833 3300047471 Bacteria 1251
469 Ga0495686_0000039 3300047472 Bacteria 304821
470 Ga0495686_0034441 3300047472 Bacteria 3261
471 Ga0495686_0332055 3300047472 Bacteria 831
472 Ga0496104_0172632 3300048907 Bacteria 2073
473 Ga0496108_0278345 3300048911 Bacteria 1457
474 Ga0496110_0027697 3300048913 Bacteria 4860
475 Ga0496114_0676748 3300048917 Bacteria 906
476 Ga0501298_000315 3300049521 Bacteria 6430
477 Ga0501299_004872 3300049522 Bacteria 2033
478 Ga0501032_0005723 3300049569 Bacteria 9199
479 Ga0501032_0063002 3300049569 Unclassified 2483
480 Ga0501034_0036190 3300049571 Bacteria 5002
481 Ga0501034_0047456 3300049571 Bacteria 4336
482 Ga0501034_0111351 3300049571 Bacteria 2728
483 Ga0501036_0006818 3300049572 Bacteria 9280
484 Ga0501036_0022058 3300049572 Bacteria 5355
485 Ga0501037_0021763 3300049573 Bacteria 4744
486 Ga0501037_0035509 3300049573 Bacteria 3676
487 Ga0501038_0015268 3300049574 Bacteria 6982
488 Ga0501038_0016448 3300049574 Bacteria 6704
489 Ga0501039_0090434 3300049575 Bacteria 2385
490 Ga0501040_0162168 3300049576 Unclassified 1581
491 Ga0501043_0029040 3300049579 Bacteria 4342
492 Ga0501043_0052530 3300049579 Unclassified 3200
493 Ga0501046_0012454 3300049580 Bacteria 7240
494 Ga0501047_0014038 3300049581 Bacteria 7611
495 Ga0501048_0001472 3300049582 Bacteria 17846
496 Ga0501070_0047065 3300049586 Bacteria 3586
497 Ga0501072_0242084 3300049588 Bacteria 1437
498 Ga0501072_0473873 3300049588 Unclassified 991
499 Ga0501073_0017199 3300049589 Bacteria 5237
500 Ga0501073_0499652 3300049589 Unclassified 841
501 Ga0501074_0034338 3300049590 Bacteria 3676
502 Ga0501201_000124 3300049651 Bacteria 6329
503 Ga0501202_000757 3300049652 Bacteria 4846
504 Ga0501202_001153 3300049652 Bacteria 4140
505 Ga0501202_036375 3300049652 Bacteria 1048
506 Ga0501202_040372 3300049652 Bacteria 1006
507 Ga0501207_027297 3300049654 Bacteria 944
508 Ga0501222_000645 3300049662 Bacteria 5106
509 Ga0501224_000915 3300049664 Bacteria 3799
510 Ga0501230_007123 3300049667 Bacteria 1650
511 Ga0501240_001141 3300049673 Bacteria 2496
512 Ga0501240_027579 3300049673 Bacteria 892
513 Ga0501242_000299 3300049674 Bacteria 4058
514 Ga0501243_002663 3300049675 Bacteria 2629
515 Ga0501243_012489 3300049675 Bacteria 1341
516 Ga0501249_013635 3300049679 Bacteria 1729
517 Ga0501249_018294 3300049679 Unclassified 1515
518 Ga0501250_000129 3300049680 Bacteria 4127
519 Ga0501251_001855 3300049681 Bacteria 1996
520 Ga0501257_005639 3300049686 Bacteria 2763
521 Ga0501259_000341 3300049688 Bacteria 7344
522 Ga0501259_000667 3300049688 Bacteria 5507
523 Ga0501225_0000609 3300049705 Bacteria 11156
524 Ga0501245_000544 3300049708 Bacteria 4590
525 Ga0501079_0765736 3300049741 Unclassified 760
526 Ga0501080_0045439 3300049742 Bacteria 4088
527 Ga0501080_0134464 3300049742 Bacteria 2289
528 Ga0501083_0011211 3300049744 Bacteria 6291
529 Ga0501083_0525254 3300049744 Unclassified 770
530 Ga0501232_000284 3300049757 Bacteria 3186
531 Ga0501266_000148 3300049763 Bacteria 8914
532 Ga0501279_002312 3300049775 Bacteria 2504
533 Ga0501035_0008172 3300049822 Bacteria 9750
534 Ga0501035_0099692 3300049822 Bacteria 2550
535 Ga0501044_0010112 3300049823 Bacteria 10251
536 Ga0501044_0214464 3300049823 Bacteria 1878
537 Ga0501044_0529153 3300049823 Bacteria 1078
538 Ga0501212_004244 3300049851 Bacteria 1840
539 nmdc:mga05p37_762035_c1 3300050507 Unclassified 1065
540 nmdc:mga0qj67_230011_c1 3300050509 Bacteria 1505
541 nmdc:mga06r32_259135_c1 3300050510 Bacteria 1727
542 nmdc:mga08y16_29263_c1 3300050511 Bacteria 5804
543 nmdc:mga08y16_405784_c1 3300050511 Bacteria 1394
544 nmdc:mga0n895_24732_c1 3300050512 Bacteria 5662
545 Ga0500611_000038 3300053727 Bacteria 71407
546 Ga0501082_0493812 3300060353 Unclassified 1070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049522 Ga0501299_004872 Ga0501299_004872_530_1072 179
2 3300049576 Ga0501040_0162168 Ga0501040_0162168_12_587 186
3 3300042876 Ga0451577_0484082 Ga0451577_0484082_213_893 198
4 3300044712 Ga0453684_0116434 Ga0453684_0116434_1974_2654 198
5 3300005336 Ga0070680_100039245 Ga0070680_1000392453 200
6 3300005458 Ga0070681_10078765 Ga0070681_100787652 200
7 3300013102 Ga0157371_10327683 Ga0157371_103276832 200
8 3300013105 Ga0157369_10009819 Ga0157369_1000981913 200
9 3300013307 Ga0157372_10778513 Ga0157372_107785131 200
10 3300013307 Ga0157372_11157462 Ga0157372_111574622 200
11 3300025921 Ga0207652_10146147 Ga0207652_101461473 200
12 3300005614 Ga0068856_100116075 Ga0068856_1001160753 211
13 3300005616 Ga0068852_100208147 Ga0068852_1002081472 211
14 3300026142 Ga0207698_10184020 Ga0207698_101840202 211
15 3300049571 Ga0501034_0111351 Ga0501034_0111351_1647_2360 213
16 3300026041 Ga0207639_10593778 Ga0207639_105937781 214
17 3300037312 Ga0395899_0002489 Ga0395899_0002489_11305_12000 214
18 3300037418 Ga0395900_0011518 Ga0395900_0011518_2608_3303 214
19 3300037466 Ga0395898_0001675 Ga0395898_0001675_24166_24861 214
20 3300038443 Ga0395901_0051567 Ga0395901_0051567_189_884 214
21 3300026088 Ga0207641_10628679 Ga0207641_106286791 215
22 3300045051 Ga0451576_0255989 Ga0451576_0255989_468_1127 218
23 3300047472 Ga0495686_0332055 Ga0495686_0332055_18_695 218
24 3300005367 Ga0070667_100022489 Ga0070667_1000224892 219
25 3300005718 Ga0068866_10501291 Ga0068866_105012911 219
26 3300014325 Ga0163163_10741523 Ga0163163_107415232 219
27 3300014326 Ga0157380_10016574 Ga0157380_100165742 219
28 3300014326 Ga0157380_10066077 Ga0157380_100660772 219
29 3300026095 Ga0207676_10461892 Ga0207676_104618921 219
30 3300044712 Ga0453684_0009134 Ga0453684_0009134_11263_11952 219
31 3300005290 Ga0065712_10069343 Ga0065712_100693436 220
32 3300005290 Ga0065712_10089384 Ga0065712_100893842 220
33 3300005295 Ga0065707_10443612 Ga0065707_104436121 220
34 3300005328 Ga0070676_10259949 Ga0070676_102599492 220
35 3300005330 Ga0070690_100007818 Ga0070690_1000078183 220
36 3300005331 Ga0070670_100031914 Ga0070670_1000319144 220
37 3300005331 Ga0070670_100063592 Ga0070670_1000635922 220
38 3300005333 Ga0070677_10114268 Ga0070677_101142681 220
39 3300005334 Ga0068869_100024930 Ga0068869_1000249304 220
40 3300005334 Ga0068869_100253435 Ga0068869_1002534351 220
41 3300005334 Ga0068869_100294960 Ga0068869_1002949601 220
42 3300005337 Ga0070682_100389964 Ga0070682_1003899642 220
43 3300005338 Ga0068868_100152462 Ga0068868_1001524621 220
44 3300005340 Ga0070689_100010320 Ga0070689_1000103203 220
45 3300005340 Ga0070689_100072606 Ga0070689_1000726063 220
46 3300005340 Ga0070689_100181709 Ga0070689_1001817091 220
47 3300005343 Ga0070687_100059265 Ga0070687_1000592652 220
48 3300005344 Ga0070661_100002300 Ga0070661_1000023003 220
49 3300005344 Ga0070661_100402190 Ga0070661_1004021901 220
50 3300005347 Ga0070668_100051654 Ga0070668_1000516542 220
51 3300005353 Ga0070669_100009392 Ga0070669_1000093924 220
52 3300005353 Ga0070669_100435245 Ga0070669_1004352451 220
53 3300005354 Ga0070675_100081769 Ga0070675_1000817692 220
54 3300005364 Ga0070673_100008798 Ga0070673_1000087981 220
55 3300005364 Ga0070673_100256683 Ga0070673_1002566832 220
56 3300005365 Ga0070688_100039255 Ga0070688_1000392553 220
57 3300005365 Ga0070688_100067247 Ga0070688_1000672472 220
58 3300005366 Ga0070659_100013751 Ga0070659_1000137512 220
59 3300005367 Ga0070667_100049450 Ga0070667_1000494503 220
60 3300005367 Ga0070667_100229258 Ga0070667_1002292582 220
61 3300005455 Ga0070663_100468387 Ga0070663_1004683872 220
62 3300005456 Ga0070678_100318273 Ga0070678_1003182731 220
63 3300005457 Ga0070662_100085592 Ga0070662_1000855922 220
64 3300005459 Ga0068867_100094772 Ga0068867_1000947722 220
65 3300005459 Ga0068867_100232600 Ga0068867_1002326002 220
66 3300005466 Ga0070685_10009887 Ga0070685_100098872 220
67 3300005466 Ga0070685_10013262 Ga0070685_100132622 220
68 3300005466 Ga0070685_10181736 Ga0070685_101817362 220
69 3300005466 Ga0070685_10331560 Ga0070685_103315601 220
70 3300005471 Ga0070698_100000850 Ga0070698_1000008503 220
71 3300005535 Ga0070684_100022308 Ga0070684_1000223084 220
72 3300005535 Ga0070684_100120385 Ga0070684_1001203851 220
73 3300005539 Ga0068853_100415622 Ga0068853_1004156221 220
74 3300005547 Ga0070693_100157355 Ga0070693_1001573552 220
75 3300005563 Ga0068855_101496619 Ga0068855_1014966191 220
76 3300005564 Ga0070664_100004401 Ga0070664_1000044013 220
77 3300005564 Ga0070664_100159350 Ga0070664_1001593502 220
78 3300005577 Ga0068857_100116218 Ga0068857_1001162182 220
79 3300005578 Ga0068854_100396618 Ga0068854_1003966181 220
80 3300005615 Ga0070702_100111290 Ga0070702_1001112902 220
81 3300005616 Ga0068852_100214438 Ga0068852_1002144382 220
82 3300005617 Ga0068859_100024316 Ga0068859_1000243163 220
83 3300005617 Ga0068859_100057873 Ga0068859_1000578732 220
84 3300005617 Ga0068859_100223852 Ga0068859_1002238522 220
85 3300005618 Ga0068864_100094589 Ga0068864_1000945891 220
86 3300005618 Ga0068864_100314582 Ga0068864_1003145822 220
87 3300005719 Ga0068861_100005859 Ga0068861_1000058597 220
88 3300005719 Ga0068861_100019717 Ga0068861_1000197174 220
89 3300005834 Ga0068851_10165613 Ga0068851_101656132 220
90 3300005840 Ga0068870_10027277 Ga0068870_100272772 220
91 3300005840 Ga0068870_10059538 Ga0068870_100595382 220
92 3300005841 Ga0068863_100002626 Ga0068863_1000026263 220
93 3300005841 Ga0068863_100043354 Ga0068863_1000433541 220
94 3300005841 Ga0068863_100305052 Ga0068863_1003050522 220
95 3300005842 Ga0068858_100021178 Ga0068858_1000211781 220
96 3300005843 Ga0068860_100488699 Ga0068860_1004886992 220
97 3300005843 Ga0068860_100905070 Ga0068860_1009050702 220
98 3300005844 Ga0068862_100003351 Ga0068862_1000033515 220
99 3300005844 Ga0068862_100704406 Ga0068862_1007044061 220
100 3300006237 Ga0097621_100074380 Ga0097621_1000743802 220
101 3300006237 Ga0097621_100087404 Ga0097621_1000874043 220
102 3300006358 Ga0068871_100037989 Ga0068871_1000379892 220
103 3300006358 Ga0068871_100163860 Ga0068871_1001638602 220
104 3300006844 Ga0075428_100006044 Ga0075428_10000604413 220
105 3300006846 Ga0075430_100295852 Ga0075430_1002958522 220
106 3300006880 Ga0075429_100009389 Ga0075429_1000093897 220
107 3300006881 Ga0068865_100238101 Ga0068865_1002381012 220
108 3300006931 Ga0097620_100024315 Ga0097620_1000243153 220
109 3300006931 Ga0097620_100057874 Ga0097620_1000578742 220
110 3300006931 Ga0097620_100223851 Ga0097620_1002238512 220
111 3300009094 Ga0111539_10005967 Ga0111539_100059674 220
112 3300009094 Ga0111539_10218242 Ga0111539_102182422 220
113 3300009094 Ga0111539_10808873 Ga0111539_108088731 220
114 3300009147 Ga0114129_10500799 Ga0114129_105007993 220
115 3300009174 Ga0105241_10076128 Ga0105241_100761282 220
116 3300009176 Ga0105242_10057927 Ga0105242_100579273 220
117 3300009176 Ga0105242_10263140 Ga0105242_102631402 220
118 3300009553 Ga0105249_10041401 Ga0105249_100414012 220
119 3300009553 Ga0105249_10052075 Ga0105249_100520753 220
120 3300009553 Ga0105249_11525250 Ga0105249_115252501 220
121 3300010375 Ga0105239_10100826 Ga0105239_101008263 220
122 3300013100 Ga0157373_10071982 Ga0157373_100719822 220
123 3300013296 Ga0157374_10003515 Ga0157374_100035155 220
124 3300013297 Ga0157378_10237249 Ga0157378_102372492 220
125 3300013306 Ga0163162_10483953 Ga0163162_104839531 220
126 3300013308 Ga0157375_10032149 Ga0157375_100321494 220
127 3300013308 Ga0157375_10128375 Ga0157375_101283752 220
128 3300013308 Ga0157375_10215427 Ga0157375_102154272 220
129 3300013308 Ga0157375_10542787 Ga0157375_105427872 220
130 3300014325 Ga0163163_10218352 Ga0163163_102183522 220
131 3300014325 Ga0163163_10390362 Ga0163163_103903622 220
132 3300014326 Ga0157380_10001482 Ga0157380_1000148214 220
133 3300014745 Ga0157377_10001624 Ga0157377_100016244 220
134 3300014745 Ga0157377_10152879 Ga0157377_101528792 220
135 3300014968 Ga0157379_10168189 Ga0157379_101681892 220
136 3300014969 Ga0157376_10004113 Ga0157376_1000411311 220
137 3300017792 Ga0163161_10106863 Ga0163161_101068631 220
138 3300017792 Ga0163161_10127035 Ga0163161_101270352 220
139 3300017792 Ga0163161_10224343 Ga0163161_102243432 220
140 3300025315 Ga0207697_10046159 Ga0207697_100461592 220
141 3300025893 Ga0207682_10015737 Ga0207682_100157373 220
142 3300025908 Ga0207643_10025474 Ga0207643_100254742 220
143 3300025908 Ga0207643_10027656 Ga0207643_100276563 220
144 3300025911 Ga0207654_10171215 Ga0207654_101712151 220
145 3300025918 Ga0207662_10002565 Ga0207662_100025653 220
146 3300025918 Ga0207662_10072128 Ga0207662_100721282 220
147 3300025920 Ga0207649_10000692 Ga0207649_1000069222 220
148 3300025920 Ga0207649_10429241 Ga0207649_104292411 220
149 3300025920 Ga0207649_10454822 Ga0207649_104548222 220
150 3300025923 Ga0207681_10001299 Ga0207681_1000129913 220
151 3300025923 Ga0207681_10253365 Ga0207681_102533651 220
152 3300025925 Ga0207650_10065927 Ga0207650_100659272 220
153 3300025926 Ga0207659_10115311 Ga0207659_101153112 220
154 3300025926 Ga0207659_10196463 Ga0207659_101964631 220
155 3300025931 Ga0207644_10035387 Ga0207644_100353873 220
156 3300025932 Ga0207690_10013541 Ga0207690_100135412 220
157 3300025933 Ga0207706_10018203 Ga0207706_100182033 220
158 3300025933 Ga0207706_10025836 Ga0207706_100258362 220
159 3300025933 Ga0207706_10113298 Ga0207706_101132982 220
160 3300025934 Ga0207686_10016170 Ga0207686_100161703 220
161 3300025934 Ga0207686_10144459 Ga0207686_101444592 220
162 3300025934 Ga0207686_10251609 Ga0207686_102516092 220
163 3300025936 Ga0207670_10112991 Ga0207670_101129912 220
164 3300025940 Ga0207691_10064987 Ga0207691_100649873 220
165 3300025942 Ga0207689_10023267 Ga0207689_100232672 220
166 3300025944 Ga0207661_10001026 Ga0207661_1000102616 220
167 3300025944 Ga0207661_10501389 Ga0207661_105013891 220
168 3300025945 Ga0207679_10000899 Ga0207679_1000089923 220
169 3300025960 Ga0207651_10119137 Ga0207651_101191371 220
170 3300025960 Ga0207651_10210676 Ga0207651_102106762 220
171 3300025961 Ga0207712_10110680 Ga0207712_101106802 220
172 3300025961 Ga0207712_10112593 Ga0207712_101125932 220
173 3300025961 Ga0207712_10390927 Ga0207712_103909272 220
174 3300025972 Ga0207668_10147110 Ga0207668_101471102 220
175 3300025981 Ga0207640_10427981 Ga0207640_104279812 220
176 3300025986 Ga0207658_10093864 Ga0207658_100938642 220
177 3300025986 Ga0207658_10197532 Ga0207658_101975322 220
178 3300026023 Ga0207677_10502199 Ga0207677_105021991 220
179 3300026035 Ga0207703_10033056 Ga0207703_100330564 220
180 3300026035 Ga0207703_10040684 Ga0207703_100406843 220
181 3300026035 Ga0207703_10107916 Ga0207703_101079162 220
182 3300026041 Ga0207639_10260176 Ga0207639_102601762 220
183 3300026075 Ga0207708_10197584 Ga0207708_101975842 220
184 3300026075 Ga0207708_10217130 Ga0207708_102171302 220
185 3300026088 Ga0207641_10000391 Ga0207641_100003913 220
186 3300026088 Ga0207641_10068745 Ga0207641_100687453 220
187 3300026088 Ga0207641_10079633 Ga0207641_100796332 220
188 3300026088 Ga0207641_10334028 Ga0207641_103340282 220
189 3300026089 Ga0207648_10076243 Ga0207648_100762433 220
190 3300026089 Ga0207648_10109797 Ga0207648_101097972 220
191 3300026089 Ga0207648_10193148 Ga0207648_101931481 220
192 3300026089 Ga0207648_10442505 Ga0207648_104425052 220
193 3300026095 Ga0207676_10357639 Ga0207676_103576392 220
194 3300026116 Ga0207674_10002085 Ga0207674_100020854 220
195 3300026116 Ga0207674_10048098 Ga0207674_100480981 220
196 3300026118 Ga0207675_100000609 Ga0207675_10000060927 220
197 3300026118 Ga0207675_100006617 Ga0207675_1000066175 220
198 3300026121 Ga0207683_10010010 Ga0207683_100100103 220
199 3300026121 Ga0207683_10524700 Ga0207683_105247001 220
200 3300026142 Ga0207698_10051333 Ga0207698_100513333 220
201 3300026142 Ga0207698_10658984 Ga0207698_106589841 220
202 3300028380 Ga0268265_10031279 Ga0268265_100312793 220
203 3300028381 Ga0268264_10393787 Ga0268264_103937872 220
204 3300031731 Ga0307405_10191499 Ga0307405_101914992 220
205 3300035170 Ga0373943_0144650 Ga0373943_0144650_213_884 220
206 3300035725 Ga0373947_0315056 Ga0373947_0315056_192_869 220
207 3300036401 Ga0373937_0055269 Ga0373937_0055269_75_749 220
208 3300036401 Ga0373937_0194953 Ga0373937_0194953_149_820 220
209 3300037068 Ga0373925_0124941 Ga0373925_0124941_972_1646 220
210 3300041406 Ga0439439_0005494 Ga0439439_0005494_1737_2405 220
211 3300041486 Ga0451807_1521263 Ga0451807_1521263_495_1169 220
212 3300041512 Ga0451853_2687340 Ga0451853_2687340_38_703 220
213 3300041997 Ga0439431_0016082 Ga0439431_0016082_583_1251 220
214 3300042002 Ga0439442_041015 Ga0439442_041015_110_778 220
215 3300042014 Ga0439457_007513 Ga0439457_007513_1014_1682 220
216 3300042128 Ga0450897_001649 Ga0450897_001649_585_1253 220
217 3300042134 Ga0450898_015402 Ga0450898_015402_160_828 220
218 3300042156 Ga0439446_0089765 Ga0439446_0089765_281_949 220
219 3300042435 Ga0439434_0032651 Ga0439434_0032651_786_1454 220
220 3300044712 Ga0453684_0084867 Ga0453684_0084867_1625_2308 220
221 3300045051 Ga0451576_0490092 Ga0451576_0490092_489_1172 220
222 3300046463 Ga0495653_0179418 Ga0495653_0179418_216_890 220
223 3300046522 Ga0495643_0169722 Ga0495643_0169722_59_727 220
224 3300046533 Ga0495640_0281301 Ga0495640_0281301_346_1020 220
225 3300046539 Ga0495621_0049399 Ga0495621_0049399_626_1297 220
226 3300046559 Ga0495667_0089691 Ga0495667_0089691_1278_1952 220
227 3300046675 Ga0495657_0048683 Ga0495657_0048683_333_1007 220
228 3300046689 Ga0495613_0417957 Ga0495613_0417957_208_882 220
229 3300049652 Ga0501202_040372 Ga0501202_040372_217_882 220
230 3300049744 Ga0501083_0525254 Ga0501083_0525254_72_740 220
231 3300049823 Ga0501044_0214464 Ga0501044_0214464_825_1514 220
232 3300050507 nmdc:mga05p37_762035_c1 nmdc:mga05p37_762035_c1_51_806 220
233 3300050511 nmdc:mga08y16_29263_c1 nmdc:mga08y16_29263_c1_4277_4948 220
234 3300050511 nmdc:mga08y16_405784_c1 nmdc:mga08y16_405784_c1_187_885 220
235 3300002459 JGI24751J29686_10005036 JGI24751J29686_100050362 221
236 3300003323 rootH1_10013586 rootH1_1001358612 221
237 3300003323 rootH1_10190106 rootH1_101901063 221
238 3300005331 Ga0070670_100205433 Ga0070670_1002054332 221
239 3300005331 Ga0070670_100413387 Ga0070670_1004133872 221
240 3300005334 Ga0068869_100038203 Ga0068869_1000382032 221
241 3300005334 Ga0068869_100039372 Ga0068869_1000393723 221
242 3300005334 Ga0068869_100170635 Ga0068869_1001706352 221
243 3300005340 Ga0070689_100248050 Ga0070689_1002480502 221
244 3300005347 Ga0070668_100016452 Ga0070668_1000164523 221
245 3300005354 Ga0070675_100031496 Ga0070675_1000314963 221
246 3300005356 Ga0070674_100080775 Ga0070674_1000807753 221
247 3300005364 Ga0070673_100004691 Ga0070673_1000046915 221
248 3300005364 Ga0070673_100454072 Ga0070673_1004540722 221
249 3300005366 Ga0070659_100004312 Ga0070659_1000043125 221
250 3300005367 Ga0070667_100025252 Ga0070667_1000252522 221
251 3300005367 Ga0070667_100063955 Ga0070667_1000639553 221
252 3300005456 Ga0070678_100005819 Ga0070678_1000058193 221
253 3300005457 Ga0070662_100201697 Ga0070662_1002016971 221
254 3300005539 Ga0068853_100150588 Ga0068853_1001505881 221
255 3300005543 Ga0070672_100080044 Ga0070672_1000800441 221
256 3300005546 Ga0070696_100452002 Ga0070696_1004520021 221
257 3300005548 Ga0070665_100024173 Ga0070665_1000241733 221
258 3300005577 Ga0068857_100344234 Ga0068857_1003442342 221
259 3300005614 Ga0068856_100011354 Ga0068856_1000113542 221
260 3300005616 Ga0068852_100028801 Ga0068852_1000288012 221
261 3300005616 Ga0068852_100439721 Ga0068852_1004397212 221
262 3300005617 Ga0068859_100029692 Ga0068859_1000296925 221
263 3300005617 Ga0068859_100456859 Ga0068859_1004568592 221
264 3300005718 Ga0068866_10160148 Ga0068866_101601481 221
265 3300005840 Ga0068870_10006480 Ga0068870_100064804 221
266 3300005841 Ga0068863_100356466 Ga0068863_1003564661 221
267 3300005843 Ga0068860_100019681 Ga0068860_1000196812 221
268 3300005843 Ga0068860_100317241 Ga0068860_1003172412 221
269 3300005985 Ga0081539_10006924 Ga0081539_100069245 221
270 3300006195 Ga0075366_10035432 Ga0075366_100354323 221
271 3300006237 Ga0097621_100006264 Ga0097621_1000062641 221
272 3300006358 Ga0068871_100675599 Ga0068871_1006755992 221
273 3300006846 Ga0075430_100050574 Ga0075430_1000505743 221
274 3300006847 Ga0075431_100042982 Ga0075431_1000429824 221
275 3300006880 Ga0075429_100134247 Ga0075429_1001342471 221
276 3300006931 Ga0097620_100029695 Ga0097620_1000296955 221
277 3300006931 Ga0097620_100456911 Ga0097620_1004569112 221
278 3300009147 Ga0114129_10278991 Ga0114129_102789912 221
279 3300009174 Ga0105241_10029199 Ga0105241_100291994 221
280 3300009176 Ga0105242_10086766 Ga0105242_100867661 221
281 3300009553 Ga0105249_10017149 Ga0105249_100171492 221
282 3300009553 Ga0105249_10102058 Ga0105249_101020582 221
283 3300009553 Ga0105249_10126174 Ga0105249_101261742 221
284 3300010375 Ga0105239_10546743 Ga0105239_105467432 221
285 3300011119 Ga0105246_10006224 Ga0105246_100062245 221
286 3300013102 Ga0157371_10455733 Ga0157371_104557331 221
287 3300013296 Ga0157374_10330767 Ga0157374_103307671 221
288 3300013297 Ga0157378_10014376 Ga0157378_100143763 221
289 3300013307 Ga0157372_10018135 Ga0157372_100181359 221
290 3300013308 Ga0157375_10060558 Ga0157375_100605583 221
291 3300014745 Ga0157377_10125742 Ga0157377_101257422 221
292 3300014968 Ga0157379_10433249 Ga0157379_104332492 221
293 3300014969 Ga0157376_10038982 Ga0157376_100389823 221
294 3300025315 Ga0207697_10140954 Ga0207697_101409541 221
295 3300025899 Ga0207642_10029934 Ga0207642_100299343 221
296 3300025903 Ga0207680_10078162 Ga0207680_100781623 221
297 3300025904 Ga0207647_10000222 Ga0207647_1000022241 221
298 3300025907 Ga0207645_10000193 Ga0207645_1000019327 221
299 3300025907 Ga0207645_10311153 Ga0207645_103111532 221
300 3300025908 Ga0207643_10001613 Ga0207643_100016133 221
301 3300025923 Ga0207681_10041750 Ga0207681_100417503 221
302 3300025925 Ga0207650_10091268 Ga0207650_100912682 221
303 3300025925 Ga0207650_10323265 Ga0207650_103232652 221
304 3300025925 Ga0207650_10484220 Ga0207650_104842202 221
305 3300025926 Ga0207659_10095141 Ga0207659_100951413 221
306 3300025932 Ga0207690_10050668 Ga0207690_100506681 221
307 3300025933 Ga0207706_10025956 Ga0207706_100259563 221
308 3300025934 Ga0207686_10235610 Ga0207686_102356102 221
309 3300025938 Ga0207704_10008895 Ga0207704_100088955 221
310 3300025940 Ga0207691_10078042 Ga0207691_100780423 221
311 3300025942 Ga0207689_10001011 Ga0207689_1000101113 221
312 3300025942 Ga0207689_10037207 Ga0207689_100372074 221
313 3300025942 Ga0207689_10258128 Ga0207689_102581282 221
314 3300025960 Ga0207651_10009038 Ga0207651_100090382 221
315 3300025961 Ga0207712_10028723 Ga0207712_100287231 221
316 3300025961 Ga0207712_10037488 Ga0207712_100374882 221
317 3300025986 Ga0207658_10052938 Ga0207658_100529382 221
318 3300026075 Ga0207708_10698245 Ga0207708_106982451 221
319 3300026078 Ga0207702_10174568 Ga0207702_101745682 221
320 3300026088 Ga0207641_10346539 Ga0207641_103465393 221
321 3300026089 Ga0207648_10000914 Ga0207648_100009149 221
322 3300026095 Ga0207676_10018134 Ga0207676_100181342 221
323 3300026116 Ga0207674_10180819 Ga0207674_101808192 221
324 3300026142 Ga0207698_10019672 Ga0207698_100196724 221
325 3300026142 Ga0207698_10108076 Ga0207698_101080761 221
326 3300028379 Ga0268266_10026495 Ga0268266_100264955 221
327 3300028380 Ga0268265_10617893 Ga0268265_106178931 221
328 3300028381 Ga0268264_10015799 Ga0268264_100157992 221
329 3300028381 Ga0268264_10287090 Ga0268264_102870902 221
330 3300028381 Ga0268264_10332113 Ga0268264_103321131 221
331 3300031507 Ga0307509_10358094 Ga0307509_103580942 221
332 3300042001 Ga0439441_014989 Ga0439441_014989_531_1229 221
333 3300042876 Ga0451577_0519378 Ga0451577_0519378_323_1003 221
334 3300044712 Ga0453684_0029600 Ga0453684_0029600_3564_4250 221
335 3300044712 Ga0453684_0162759 Ga0453684_0162759_867_1547 221
336 3300044712 Ga0453684_0691542 Ga0453684_0691542_35_721 221
337 3300046471 Ga0495650_0026898 Ga0495650_0026898_30_698 221
338 3300047320 Ga0495672_0016483 Ga0495672_0016483_3711_4388 221
339 3300048907 Ga0496104_0172632 Ga0496104_0172632_1167_1862 221
340 3300048913 Ga0496110_0027697 Ga0496110_0027697_1934_2629 221
341 3300049589 Ga0501073_0499652 Ga0501073_0499652_81_764 221
342 3300050509 nmdc:mga0qj67_230011_c1 nmdc:mga0qj67_230011_c1_63_740 221
343 3300050510 nmdc:mga06r32_259135_c1 nmdc:mga06r32_259135_c1_122_799 221
344 3300050512 nmdc:mga0n895_24732_c1 nmdc:mga0n895_24732_c1_2792_3469 221
345 3300060353 Ga0501082_0493812 Ga0501082_0493812_58_741 221
346 3300003316 rootH1_10029625 rootH1_100296257 222
347 3300005327 Ga0070658_10616322 Ga0070658_106163221 222
348 3300005328 Ga0070676_10033029 Ga0070676_100330294 222
349 3300005329 Ga0070683_100016639 Ga0070683_1000166392 222
350 3300005331 Ga0070670_100039643 Ga0070670_1000396432 222
351 3300005331 Ga0070670_100418592 Ga0070670_1004185922 222
352 3300005344 Ga0070661_100124842 Ga0070661_1001248422 222
353 3300005355 Ga0070671_100076099 Ga0070671_1000760993 222
354 3300005356 Ga0070674_100001648 Ga0070674_1000016489 222
355 3300005367 Ga0070667_100207073 Ga0070667_1002070732 222
356 3300005471 Ga0070698_100004109 Ga0070698_10000410912 222
357 3300005471 Ga0070698_100014868 Ga0070698_1000148684 222
358 3300005535 Ga0070684_100022182 Ga0070684_1000221822 222
359 3300005543 Ga0070672_100649454 Ga0070672_1006494541 222
360 3300005544 Ga0070686_100250154 Ga0070686_1002501542 222
361 3300005547 Ga0070693_100189238 Ga0070693_1001892382 222
362 3300005563 Ga0068855_100000360 Ga0068855_10000036042 222
363 3300005564 Ga0070664_100016177 Ga0070664_1000161772 222
364 3300005564 Ga0070664_100071188 Ga0070664_1000711883 222
365 3300005616 Ga0068852_100103626 Ga0068852_1001036263 222
366 3300006353 Ga0075370_10077126 Ga0075370_100771262 222
367 3300013102 Ga0157371_10004775 Ga0157371_1000477513 222
368 3300013102 Ga0157371_10139803 Ga0157371_101398032 222
369 3300013102 Ga0157371_10401641 Ga0157371_104016411 222
370 3300013104 Ga0157370_10042608 Ga0157370_100426082 222
371 3300013105 Ga0157369_10000649 Ga0157369_100006494 222
372 3300013105 Ga0157369_10482214 Ga0157369_104822142 222
373 3300013297 Ga0157378_10007504 Ga0157378_100075046 222
374 3300013307 Ga0157372_10000286 Ga0157372_1000028630 222
375 3300013307 Ga0157372_10015567 Ga0157372_100155674 222
376 3300013307 Ga0157372_10278784 Ga0157372_102787842 222
377 3300013307 Ga0157372_10343305 Ga0157372_103433052 222
378 3300013307 Ga0157372_10394889 Ga0157372_103948892 222
379 3300013307 Ga0157372_10491736 Ga0157372_104917362 222
380 3300013307 Ga0157372_10782177 Ga0157372_107821772 222
381 3300013308 Ga0157375_10290815 Ga0157375_102908152 222
382 3300014325 Ga0163163_10004186 Ga0163163_100041866 222
383 3300014745 Ga0157377_10024652 Ga0157377_100246522 222
384 3300017792 Ga0163161_10137494 Ga0163161_101374942 222
385 3300025907 Ga0207645_10101841 Ga0207645_101018412 222
386 3300025909 Ga0207705_10110156 Ga0207705_101101562 222
387 3300025920 Ga0207649_10020465 Ga0207649_100204652 222
388 3300025920 Ga0207649_10090615 Ga0207649_100906152 222
389 3300025925 Ga0207650_10003475 Ga0207650_100034756 222
390 3300025925 Ga0207650_10360452 Ga0207650_103604521 222
391 3300025931 Ga0207644_10082902 Ga0207644_100829022 222
392 3300025931 Ga0207644_10200300 Ga0207644_102003002 222
393 3300025937 Ga0207669_10125163 Ga0207669_101251631 222
394 3300025940 Ga0207691_10038430 Ga0207691_100384302 222
395 3300025940 Ga0207691_10220675 Ga0207691_102206753 222
396 3300025944 Ga0207661_10064928 Ga0207661_100649282 222
397 3300025945 Ga0207679_10011358 Ga0207679_100113582 222
398 3300032126 Ga0307415_100962965 Ga0307415_1009629651 222
399 3300037312 Ga0395899_0000434 Ga0395899_0000434_4571_5257 222
400 3300037418 Ga0395900_0203322 Ga0395900_0203322_715_1389 222
401 3300037471 Ga0395905_0001879 Ga0395905_0001879_6432_7106 222
402 3300037471 Ga0395905_0018021 Ga0395905_0018021_2920_3621 222
403 3300038741 Ga0400488_61630 Ga0400488_61630_171_842 222
404 3300039437 Ga0436365_1633088 Ga0436365_1633088_442_1149 222
405 3300042876 Ga0451577_0376999 Ga0451577_0376999_107_805 222
406 3300044656 Ga0466969_0037723 Ga0466969_0037723_757_1443 222
407 3300044684 Ga0466966_0003138 Ga0466966_0003138_150_836 222
408 3300044712 Ga0453684_0086565 Ga0453684_0086565_261_959 222
409 3300045049 Ga0466959_0038477 Ga0466959_0038477_564_1250 222
410 3300047472 Ga0495686_0034441 Ga0495686_0034441_1458_2150 222
411 3300048911 Ga0496108_0278345 Ga0496108_0278345_164_844 222
412 3300049569 Ga0501032_0005723 Ga0501032_0005723_3188_3865 222
413 3300049569 Ga0501032_0063002 Ga0501032_0063002_318_1088 222
414 3300049571 Ga0501034_0047456 Ga0501034_0047456_1049_1726 222
415 3300049572 Ga0501036_0006818 Ga0501036_0006818_3036_3713 222
416 3300049572 Ga0501036_0022058 Ga0501036_0022058_844_1614 222
417 3300049573 Ga0501037_0021763 Ga0501037_0021763_203_973 222
418 3300049573 Ga0501037_0035509 Ga0501037_0035509_1473_2150 222
419 3300049574 Ga0501038_0015268 Ga0501038_0015268_556_1233 222
420 3300049574 Ga0501038_0016448 Ga0501038_0016448_4431_5201 222
421 3300049575 Ga0501039_0090434 Ga0501039_0090434_1548_2225 222
422 3300049579 Ga0501043_0029040 Ga0501043_0029040_2223_2900 222
423 3300049579 Ga0501043_0052530 Ga0501043_0052530_2125_2895 222
424 3300049580 Ga0501046_0012454 Ga0501046_0012454_5061_5738 222
425 3300049581 Ga0501047_0014038 Ga0501047_0014038_6314_6991 222
426 3300049582 Ga0501048_0001472 Ga0501048_0001472_5024_5701 222
427 3300049586 Ga0501070_0047065 Ga0501070_0047065_567_1244 222
428 3300049588 Ga0501072_0242084 Ga0501072_0242084_534_1211 222
429 3300049588 Ga0501072_0473873 Ga0501072_0473873_195_965 222
430 3300049589 Ga0501073_0017199 Ga0501073_0017199_1669_2346 222
431 3300049590 Ga0501074_0034338 Ga0501074_0034338_2472_3149 222
432 3300049652 Ga0501202_000757 Ga0501202_000757_840_1511 222
433 3300049654 Ga0501207_027297 Ga0501207_027297_75_746 222
434 3300049673 Ga0501240_027579 Ga0501240_027579_122_793 222
435 3300049674 Ga0501242_000299 Ga0501242_000299_1850_2521 222
436 3300049675 Ga0501243_012489 Ga0501243_012489_66_737 222
437 3300049679 Ga0501249_018294 Ga0501249_018294_125_796 222
438 3300049680 Ga0501250_000129 Ga0501250_000129_2393_3064 222
439 3300049686 Ga0501257_005639 Ga0501257_005639_1037_1708 222
440 3300049688 Ga0501259_000667 Ga0501259_000667_1175_1846 222
441 3300049708 Ga0501245_000544 Ga0501245_000544_1996_2667 222
442 3300049741 Ga0501079_0765736 Ga0501079_0765736_71_748 222
443 3300049742 Ga0501080_0045439 Ga0501080_0045439_2097_2774 222
444 3300049742 Ga0501080_0134464 Ga0501080_0134464_911_1681 222
445 3300049744 Ga0501083_0011211 Ga0501083_0011211_5088_5765 222
446 3300049763 Ga0501266_000148 Ga0501266_000148_6741_7412 222
447 3300049822 Ga0501035_0008172 Ga0501035_0008172_5669_6346 222
448 3300049822 Ga0501035_0099692 Ga0501035_0099692_517_1287 222
449 3300049823 Ga0501044_0010112 Ga0501044_0010112_9210_9887 222
450 3300002155 JGI24033J26618_1016325 JGI24033J26618_10163251 223
451 3300005289 Ga0065704_10142136 Ga0065704_101421362 223
452 3300005290 Ga0065712_10098111 Ga0065712_100981112 223
453 3300005327 Ga0070658_10076310 Ga0070658_100763103 223
454 3300005327 Ga0070658_10331531 Ga0070658_103315311 223
455 3300005329 Ga0070683_100176368 Ga0070683_1001763682 223
456 3300005330 Ga0070690_100018610 Ga0070690_1000186101 223
457 3300005331 Ga0070670_100575085 Ga0070670_1005750851 223
458 3300005336 Ga0070680_100048526 Ga0070680_1000485264 223
459 3300005339 Ga0070660_100241808 Ga0070660_1002418082 223
460 3300005340 Ga0070689_100276570 Ga0070689_1002765702 223
461 3300005343 Ga0070687_100008441 Ga0070687_1000084412 223
462 3300005344 Ga0070661_100596050 Ga0070661_1005960501 223
463 3300005354 Ga0070675_100039452 Ga0070675_1000394522 223
464 3300005366 Ga0070659_100274152 Ga0070659_1002741521 223
465 3300005367 Ga0070667_100157078 Ga0070667_1001570781 223
466 3300005441 Ga0070700_100130561 Ga0070700_1001305612 223
467 3300005459 Ga0068867_100020556 Ga0068867_1000205562 223
468 3300005466 Ga0070685_10162543 Ga0070685_101625432 223
469 3300005530 Ga0070679_100415187 Ga0070679_1004151872 223
470 3300005543 Ga0070672_100066443 Ga0070672_1000664433 223
471 3300005563 Ga0068855_100003314 Ga0068855_10000331416 223
472 3300005563 Ga0068855_100036791 Ga0068855_1000367912 223
473 3300005577 Ga0068857_100318665 Ga0068857_1003186652 223
474 3300005577 Ga0068857_100449667 Ga0068857_1004496672 223
475 3300005615 Ga0070702_100083162 Ga0070702_1000831624 223
476 3300005719 Ga0068861_100263676 Ga0068861_1002636761 223
477 3300005843 Ga0068860_100637769 Ga0068860_1006377691 223
478 3300006237 Ga0097621_100178070 Ga0097621_1001780701 223
479 3300006881 Ga0068865_100286117 Ga0068865_1002861172 223
480 3300009545 Ga0105237_10034271 Ga0105237_100342712 223
481 3300009545 Ga0105237_10639202 Ga0105237_106392022 223
482 3300013100 Ga0157373_10002878 Ga0157373_100028783 223
483 3300013100 Ga0157373_10202362 Ga0157373_102023622 223
484 3300013102 Ga0157371_10000759 Ga0157371_1000075918 223
485 3300013102 Ga0157371_10002453 Ga0157371_1000245316 223
486 3300013102 Ga0157371_10200353 Ga0157371_102003532 223
487 3300013102 Ga0157371_10227350 Ga0157371_102273501 223
488 3300013104 Ga0157370_10031483 Ga0157370_100314832 223
489 3300013307 Ga0157372_10012542 Ga0157372_1001254211 223
490 3300013307 Ga0157372_10188620 Ga0157372_101886202 223
491 3300013307 Ga0157372_10248830 Ga0157372_102488302 223
492 3300013307 Ga0157372_10254617 Ga0157372_102546171 223
493 3300013307 Ga0157372_10656591 Ga0157372_106565912 223
494 3300014326 Ga0157380_10050516 Ga0157380_100505162 223
495 3300014745 Ga0157377_10231692 Ga0157377_102316921 223
496 3300025893 Ga0207682_10064999 Ga0207682_100649991 223
497 3300025901 Ga0207688_10202682 Ga0207688_102026821 223
498 3300025909 Ga0207705_10073555 Ga0207705_100735553 223
499 3300025914 Ga0207671_10389647 Ga0207671_103896472 223
500 3300025917 Ga0207660_10292502 Ga0207660_102925022 223
501 3300025918 Ga0207662_10003058 Ga0207662_100030584 223
502 3300025919 Ga0207657_10063488 Ga0207657_100634884 223
503 3300025925 Ga0207650_10519698 Ga0207650_105196981 223
504 3300025926 Ga0207659_10023782 Ga0207659_100237822 223
505 3300025936 Ga0207670_10672738 Ga0207670_106727381 223
506 3300025937 Ga0207669_10345595 Ga0207669_103455951 223
507 3300025940 Ga0207691_10032197 Ga0207691_100321971 223
508 3300025942 Ga0207689_10174858 Ga0207689_101748581 223
509 3300025944 Ga0207661_10327764 Ga0207661_103277642 223
510 3300025949 Ga0207667_10022688 Ga0207667_100226887 223
511 3300025986 Ga0207658_10788484 Ga0207658_107884841 223
512 3300026041 Ga0207639_10131772 Ga0207639_101317723 223
513 3300026075 Ga0207708_10063604 Ga0207708_100636041 223
514 3300026089 Ga0207648_10040883 Ga0207648_100408833 223
515 3300026116 Ga0207674_10031469 Ga0207674_100314693 223
516 3300026116 Ga0207674_10252643 Ga0207674_102526432 223
517 3300027424 Ga0209984_1006248 Ga0209984_10062482 223
518 3300028381 Ga0268264_10795751 Ga0268264_107957511 223
519 3300032004 Ga0307414_10154074 Ga0307414_101540742 223
520 3300039062 Ga0400483_009164 Ga0400483_009164_11316_11990 223
521 3300039062 Ga0400483_228548 Ga0400483_228548_11073_11747 223
522 3300046476 Ga0495662_0219150 Ga0495662_0219150_205_885 223
523 3300046516 Ga0495628_0285039 Ga0495628_0285039_475_1155 223
524 3300046642 Ga0495634_0019294 Ga0495634_0019294_462_1142 223
525 3300047471 Ga0495684_0262833 Ga0495684_0262833_273_953 223
526 3300047472 Ga0495686_0000039 Ga0495686_0000039_13008_13706 223
527 3300048917 Ga0496114_0676748 Ga0496114_0676748_151_879 223
528 3300049521 Ga0501298_000315 Ga0501298_000315_1597_2271 223
529 3300049571 Ga0501034_0036190 Ga0501034_0036190_627_1331 223
530 3300049651 Ga0501201_000124 Ga0501201_000124_3052_3726 223
531 3300049652 Ga0501202_001153 Ga0501202_001153_1891_2565 223
532 3300049652 Ga0501202_036375 Ga0501202_036375_114_785 223
533 3300049662 Ga0501222_000645 Ga0501222_000645_1760_2434 223
534 3300049664 Ga0501224_000915 Ga0501224_000915_770_1444 223
535 3300049667 Ga0501230_007123 Ga0501230_007123_467_1138 223
536 3300049673 Ga0501240_001141 Ga0501240_001141_1414_2088 223
537 3300049675 Ga0501243_002663 Ga0501243_002663_1725_2399 223
538 3300049679 Ga0501249_013635 Ga0501249_013635_557_1231 223
539 3300049681 Ga0501251_001855 Ga0501251_001855_84_758 223
540 3300049688 Ga0501259_000341 Ga0501259_000341_3978_4652 223
541 3300049705 Ga0501225_0000609 Ga0501225_0000609_7420_8094 223
542 3300049757 Ga0501232_000284 Ga0501232_000284_2239_2910 223
543 3300049775 Ga0501279_002312 Ga0501279_002312_1421_2095 223
544 3300049823 Ga0501044_0529153 Ga0501044_0529153_179_883 223
545 3300049851 Ga0501212_004244 Ga0501212_004244_694_1368 223
546 3300053727 Ga0500611_000038 Ga0500611_000038_17343_18056 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

87

264

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h0k-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9428 1 221
5h0j-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9428 1 221
5h0k-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9305 1 221
5h0j-assembly1.cif.gz_A the crystal structure of wt pedobacter heparinus smug2 0.9304 1 221
1oe6-assembly1.cif.gz_A xenopus smug1, an anti-mutator uracil-dna glycosylase 0.744 5 219
ID Description Score Start End Superfamily
af_Q9VEM1_36_278_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7545 4 219 3.40.470.10
1oe5B00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7472 5 220 3.40.470.10
af_Q9VEM1_36_278_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.73 4 219 3.40.470.10
1oe5B00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7233 5 220 3.40.470.10
5h98A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7017 5 220 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A385SDU8-F1-model_v4 DUF4918 family protein 0.9873 3 222
AF-A0A3M1BQ56-F1-model_v4 DUF4918 family protein 0.9871 163 221
AF-A0A7Y2FX85-F1-model_v4 DUF4918 family protein 0.9868 1 221
AF-A0A081SIB8-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9851 3 222
AF-A0A537JE72-F1-model_v4 DUF4918 family protein 0.985 152 223

Feature Viewer

pLDDT pTM Quality
94.16 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map