F461961

General Info

Members Datasets Scaffolds Average Seq Length
546 269 1092 168

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100181587|Ga0070706_1001815873
Length 190
Sequence MRRSPVALPPVREYVAHNAMEGSMRRTPAPGPRGVLEVDWPFFGEICRALALRVARDYQPEIVLGVAKAGVIPGVVVASILQSEFSSMTVTRMAEGAAPVLVTGPPPTIRGRRVLVVDETCDTGSTMKLALNEVRALQPAEVRTAVSFKTGDYAPDYHAFETESFIVLPWDREIVQGGELVIRPEYAGRL

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
155 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
156 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
220 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
247 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.42
Rhizosphere 91.58
Stem 0
Stem Tuber 0
Unclassified 27.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100181587 3300005467 Bacteria 1965
2 MBSR1b_contig_1301407 2162886012 Bacteria 1014
3 Ga0065715_10017721 3300005293 Bacteria 2803
4 Ga0070676_10050758 3300005328 Unclassified 2433
5 Ga0070676_10085967 3300005328 Unclassified 1917
6 Ga0070683_100115232 3300005329 Bacteria 2537
7 Ga0070690_100010669 3300005330 Bacteria 5353
8 Ga0068869_100014102 3300005334 Bacteria 5333
9 Ga0070680_100023141 3300005336 Bacteria 4953
10 Ga0070680_100056178 3300005336 Bacteria 3217
11 Ga0070660_100731881 3300005339 Bacteria 830
12 Ga0070689_100305058 3300005340 Bacteria 1326
13 Ga0070691_10057157 3300005341 Unclassified 1871
14 Ga0070691_10648951 3300005341 Bacteria 628
15 Ga0070687_100897839 3300005343 Bacteria 635
16 Ga0070661_100236824 3300005344 Bacteria 1404
17 Ga0070668_100019922 3300005347 Bacteria 5055
18 Ga0070669_100065091 3300005353 Bacteria 2685
19 Ga0070675_100367389 3300005354 Unclassified 1279
20 Ga0070671_100019874 3300005355 Bacteria 5472
21 Ga0070671_100895366 3300005355 Unclassified 775
22 Ga0070674_100001196 3300005356 Bacteria 13631
23 Ga0070673_100256821 3300005364 Bacteria 1525
24 Ga0070659_100226071 3300005366 Unclassified 1546
25 Ga0070659_100308447 3300005366 Bacteria 1321
26 Ga0070705_100015030 3300005440 Bacteria 3994
27 Ga0070705_100335243 3300005440 Bacteria 1097
28 Ga0070705_100599984 3300005440 Bacteria 851
29 Ga0070705_100902216 3300005440 Bacteria 711
30 Ga0070694_100003314 3300005444 Bacteria 9633
31 Ga0070694_100025413 3300005444 Bacteria 3831
32 Ga0070694_100031879 3300005444 Bacteria 3457
33 Ga0070708_100037071 3300005445 Bacteria 4252
34 Ga0070708_100335002 3300005445 Unclassified 1426
35 Ga0070663_100625120 3300005455 Unclassified 908
36 Ga0070663_101282628 3300005455 Bacteria 646
37 Ga0070678_100021994 3300005456 Bacteria 4216
38 Ga0070662_100000040 3300005457 Bacteria 73497
39 Ga0070681_10033829 3300005458 Bacteria 5131
40 Ga0068867_100001196 3300005459 Bacteria 17801
41 Ga0068867_100485461 3300005459 Bacteria 1059
42 Ga0070685_10245647 3300005466 Unclassified 1183
43 Ga0070706_100027602 3300005467 Bacteria 5224
44 Ga0070706_100508113 3300005467 Bacteria 1121
45 Ga0070707_100009970 3300005468 Bacteria 8842
46 Ga0070707_100014297 3300005468 Bacteria 7442
47 Ga0070707_100077352 3300005468 Bacteria 3210
48 Ga0070707_100228348 3300005468 Bacteria 1812
49 Ga0070707_100354715 3300005468 Unclassified 1424
50 Ga0070698_100005635 3300005471 Bacteria 13706
51 Ga0070698_100283560 3300005471 Unclassified 1588
52 Ga0070699_100002654 3300005518 Bacteria 15974
53 Ga0070699_100008984 3300005518 Bacteria 8654
54 Ga0070699_100056985 3300005518 Unclassified 3384
55 Ga0070699_100099708 3300005518 Unclassified 2545
56 Ga0070699_100164982 3300005518 Unclassified 1962
57 Ga0070699_100188644 3300005518 Bacteria 1831
58 Ga0070699_100952712 3300005518 Bacteria 787
59 Ga0070679_100026841 3300005530 Bacteria 5663
60 Ga0070684_100070821 3300005535 Unclassified 3069
61 Ga0070684_101111702 3300005535 Unclassified 743
62 Ga0070684_101161261 3300005535 Bacteria 726
63 Ga0070697_100003157 3300005536 Bacteria 12659
64 Ga0070697_100015953 3300005536 Bacteria 5905
65 Ga0070697_100040262 3300005536 Bacteria 3779
66 Ga0070697_100104216 3300005536 Unclassified 2358
67 Ga0070697_100179418 3300005536 Bacteria 1795
68 Ga0070697_100267641 3300005536 Unclassified 1464
69 Ga0070697_100469761 3300005536 Unclassified 1097
70 Ga0070697_100484254 3300005536 Unclassified 1081
71 Ga0068853_100128000 3300005539 Bacteria 2270
72 Ga0070672_100009353 3300005543 Bacteria 6752
73 Ga0070672_100087163 3300005543 Bacteria 2512
74 Ga0070686_100137332 3300005544 Bacteria 1698
75 Ga0070695_100010656 3300005545 Bacteria 5495
76 Ga0070695_100062441 3300005545 Bacteria 2419
77 Ga0070696_100001378 3300005546 Bacteria 15884
78 Ga0070696_100005872 3300005546 Bacteria 8197
79 Ga0070696_100009138 3300005546 Bacteria 6636
80 Ga0070696_100037636 3300005546 Bacteria 3338
81 Ga0070696_100071859 3300005546 Unclassified 2435
82 Ga0070696_100177383 3300005546 Bacteria 1579
83 Ga0070696_100261096 3300005546 Bacteria 1313
84 Ga0070693_100340025 3300005547 Unclassified 1024
85 Ga0070704_100020312 3300005549 Bacteria 4281
86 Ga0070704_100023864 3300005549 Bacteria 4003
87 Ga0070704_100027890 3300005549 Unclassified 3750
88 Ga0070704_100057916 3300005549 Bacteria 2758
89 Ga0070704_100098043 3300005549 Bacteria 2201
90 Ga0068855_100173841 3300005563 Unclassified 2438
91 Ga0070664_100036367 3300005564 Bacteria 4137
92 Ga0070664_100040037 3300005564 Bacteria 3951
93 Ga0070664_100052465 3300005564 Bacteria 3454
94 Ga0070664_100684310 3300005564 Unclassified 955
95 Ga0068857_100020916 3300005577 Bacteria 5756
96 Ga0068857_100291498 3300005577 Unclassified 1503
97 Ga0068857_100746946 3300005577 Bacteria 932
98 Ga0068854_100001567 3300005578 Bacteria 13885
99 Ga0068854_100141552 3300005578 Unclassified 1846
100 Ga0068854_100192451 3300005578 Unclassified 1599
101 Ga0070702_100005934 3300005615 Bacteria 5739
102 Ga0068852_100821656 3300005616 Bacteria 944
103 Ga0068859_100141222 3300005617 Bacteria 2482
104 Ga0068864_100001195 3300005618 Bacteria 21554
105 Ga0068866_10000826 3300005718 Bacteria 13768
106 Ga0068861_100004158 3300005719 Bacteria 9707
107 Ga0068861_101305359 3300005719 Bacteria 706
108 Ga0068870_10004652 3300005840 Bacteria 5920
109 Ga0068863_100168928 3300005841 Bacteria 2097
110 Ga0068863_101156362 3300005841 Bacteria 779
111 Ga0068860_100049218 3300005843 Bacteria 4015
112 Ga0068862_100611335 3300005844 Bacteria 1048
113 Ga0070715_10310377 3300006163 Bacteria 847
114 Ga0070716_100201575 3300006173 Bacteria 1323
115 Ga0070712_100536237 3300006175 Bacteria 985
116 Ga0097621_100186424 3300006237 Unclassified 1795
117 Ga0068871_100092875 3300006358 Bacteria 2517
118 Ga0075428_100024428 3300006844 Bacteria 6688
119 Ga0075428_100782819 3300006844 Bacteria 1014
120 Ga0075430_100263617 3300006846 Bacteria 1427
121 Ga0075431_100103824 3300006847 Bacteria 2933
122 Ga0075433_10003424 3300006852 Bacteria 12232
123 Ga0075433_10018281 3300006852 Bacteria 5823
124 Ga0075433_10137344 3300006852 Bacteria 2173
125 Ga0075433_10145824 3300006852 Bacteria 2104
126 Ga0075433_10731736 3300006852 Bacteria 866
127 Ga0075434_100034515 3300006871 Bacteria 4995
128 Ga0075434_100108649 3300006871 Unclassified 2784
129 Ga0075434_100237243 3300006871 Bacteria 1843
130 Ga0075429_100063071 3300006880 Bacteria 3229
131 Ga0068865_100005870 3300006881 Bacteria 7469
132 Ga0075436_100005375 3300006914 Bacteria 8816
133 Ga0075436_100140105 3300006914 Bacteria 1699
134 Ga0075436_100386561 3300006914 Bacteria 1012
135 Ga0097620_100141223 3300006931 Bacteria 2482
136 Ga0075435_100077321 3300007076 Bacteria 2728
137 Ga0075435_100082903 3300007076 Bacteria 2636
138 Ga0075435_100267676 3300007076 Unclassified 1457
139 Ga0105240_10191293 3300009093 Bacteria 2406
140 Ga0111539_10109515 3300009094 Bacteria 3242
141 Ga0111539_10358273 3300009094 Bacteria 1698
142 Ga0105245_10800118 3300009098 Unclassified 981
143 Ga0114129_10000088 3300009147 Bacteria 86607
144 Ga0114129_10027235 3300009147 Bacteria 8092
145 Ga0114129_10031632 3300009147 Bacteria 7480
146 Ga0114129_10317089 3300009147 Bacteria 2073
147 Ga0114129_10391686 3300009147 Bacteria 1832
148 Ga0114129_10433944 3300009147 Bacteria 1726
149 Ga0114129_10478847 3300009147 Unclassified 1629
150 Ga0114129_11079366 3300009147 Unclassified 1006
151 Ga0114129_11093956 3300009147 Unclassified 998
152 Ga0105243_10003605 3300009148 Bacteria 12472
153 Ga0105241_10028229 3300009174 Bacteria 4181
154 Ga0105242_10000522 3300009176 Bacteria 30175
155 Ga0105242_10359273 3300009176 Unclassified 1348
156 Ga0105248_10001785 3300009177 Bacteria 23904
157 Ga0105248_12263636 3300009177 Bacteria 619
158 Ga0105237_10231721 3300009545 Unclassified 1848
159 Ga0105238_10477835 3300009551 Bacteria 1245
160 Ga0105249_10136442 3300009553 Bacteria 2348
161 Ga0105249_10581348 3300009553 Unclassified 1173
162 Ga0105249_10867685 3300009553 Unclassified 969
163 Ga0105239_10029426 3300010375 Bacteria 6039
164 Ga0105239_10213427 3300010375 Bacteria 2164
165 Ga0105246_10072991 3300011119 Bacteria 2421
166 Ga0105246_10202514 3300011119 Unclassified 1544
167 Ga0157371_10032015 3300013102 Bacteria 3786
168 Ga0157378_10001653 3300013297 Bacteria 20161
169 Ga0163162_10062010 3300013306 Bacteria 3778
170 Ga0163162_10683416 3300013306 Unclassified 1149
171 Ga0157372_10015592 3300013307 Bacteria 8148
172 Ga0157372_11329353 3300013307 Bacteria 829
173 Ga0157372_12504624 3300013307 Unclassified 592
174 Ga0157380_10048319 3300014326 Bacteria 3351
175 Ga0157379_10013742 3300014968 Bacteria 7096
176 Ga0157376_10036485 3300014969 Bacteria 3983
177 Ga0163161_10560618 3300017792 Unclassified 937
178 Ga0207642_10000216 3300025899 Bacteria 16971
179 Ga0207642_10066598 3300025899 Unclassified 1697
180 Ga0207642_10164178 3300025899 Bacteria 1195
181 Ga0207645_10004978 3300025907 Bacteria 9736
182 Ga0207643_10026520 3300025908 Bacteria 3208
183 Ga0207684_10027883 3300025910 Bacteria 4810
184 Ga0207684_10154928 3300025910 Bacteria 1972
185 Ga0207684_10796829 3300025910 Bacteria 799
186 Ga0207654_10005356 3300025911 Bacteria 6481
187 Ga0207707_10024081 3300025912 Bacteria 5324
188 Ga0207695_10210104 3300025913 Bacteria 1857
189 Ga0207693_10069492 3300025915 Bacteria 2756
190 Ga0207663_10076172 3300025916 Unclassified 2179
191 Ga0207660_10036652 3300025917 Bacteria 3411
192 Ga0207660_10060698 3300025917 Bacteria 2719
193 Ga0207660_10418487 3300025917 Bacteria 1081
194 Ga0207657_11265519 3300025919 Unclassified 559
195 Ga0207649_10136555 3300025920 Bacteria 1673
196 Ga0207649_10220212 3300025920 Unclassified 1351
197 Ga0207652_10049326 3300025921 Unclassified 3603
198 Ga0207646_10000535 3300025922 Bacteria 50679
199 Ga0207646_10000629 3300025922 Bacteria 45840
200 Ga0207646_10000661 3300025922 Bacteria 44720
201 Ga0207646_10001364 3300025922 Bacteria 30242
202 Ga0207646_10016722 3300025922 Bacteria 6881
203 Ga0207646_10026228 3300025922 Bacteria 5320
204 Ga0207646_10225898 3300025922 Bacteria 1691
205 Ga0207681_10177280 3300025923 Unclassified 1620
206 Ga0207694_10231496 3300025924 Bacteria 1509
207 Ga0207659_10144082 3300025926 Bacteria 1853
208 Ga0207687_10024971 3300025927 Bacteria 3997
209 Ga0207687_10238083 3300025927 Bacteria 1441
210 Ga0207700_10075552 3300025928 Bacteria 2611
211 Ga0207644_10051552 3300025931 Unclassified 2954
212 Ga0207690_10062287 3300025932 Bacteria 2539
213 Ga0207690_10183251 3300025932 Unclassified 1578
214 Ga0207706_10000220 3300025933 Bacteria 62430
215 Ga0207706_10252104 3300025933 Unclassified 1541
216 Ga0207686_10000138 3300025934 Bacteria 57684
217 Ga0207709_10004232 3300025935 Bacteria 8320
218 Ga0207670_10476504 3300025936 Bacteria 1010
219 Ga0207669_10005012 3300025937 Bacteria 5889
220 Ga0207669_10957563 3300025937 Bacteria 718
221 Ga0207704_10002472 3300025938 Bacteria 8321
222 Ga0207704_10223684 3300025938 Bacteria 1394
223 Ga0207704_10228259 3300025938 Bacteria 1383
224 Ga0207691_10045696 3300025940 Bacteria 4025
225 Ga0207691_10200946 3300025940 Unclassified 1735
226 Ga0207711_10001584 3300025941 Bacteria 21001
227 Ga0207689_10078072 3300025942 Bacteria 2721
228 Ga0207679_10069952 3300025945 Bacteria 2643
229 Ga0207679_10083408 3300025945 Bacteria 2450
230 Ga0207679_10110259 3300025945 Bacteria 2170
231 Ga0207679_10150269 3300025945 Unclassified 1894
232 Ga0207651_10047914 3300025960 Bacteria 2885
233 Ga0207651_10556112 3300025960 Bacteria 998
234 Ga0207712_10002939 3300025961 Bacteria 10883
235 Ga0207712_10455599 3300025961 Unclassified 1086
236 Ga0207668_10070256 3300025972 Bacteria 2496
237 Ga0207640_10004418 3300025981 Bacteria 7627
238 Ga0207640_10240168 3300025981 Unclassified 1399
239 Ga0207640_10895859 3300025981 Bacteria 775
240 Ga0207703_10032730 3300026035 Unclassified 4116
241 Ga0207639_10113392 3300026041 Bacteria 2214
242 Ga0207639_10698282 3300026041 Unclassified 941
243 Ga0207678_10737521 3300026067 Unclassified 868
244 Ga0207678_10774415 3300026067 Bacteria 846
245 Ga0207641_10916616 3300026088 Bacteria 871
246 Ga0207648_10000021 3300026089 Bacteria 139257
247 Ga0207648_10459480 3300026089 Bacteria 1160
248 Ga0207648_10648101 3300026089 Bacteria 976
249 Ga0207676_10005231 3300026095 Bacteria 9182
250 Ga0207676_10052613 3300026095 Bacteria 3184
251 Ga0207674_10002007 3300026116 Bacteria 25837
252 Ga0207674_10428675 3300026116 Bacteria 1278
253 Ga0207675_100011842 3300026118 Bacteria 8152
254 Ga0207675_100380034 3300026118 Unclassified 1389
255 Ga0207683_10006642 3300026121 Bacteria 9896
256 Ga0207698_10591728 3300026142 Unclassified 1093
257 Ga0209588_1061613 3300027671 Bacteria 1213
258 Ga0207428_10143977 3300027907 Bacteria 1817
259 Ga0268265_10578006 3300028380 Bacteria 1070
260 Ga0268264_10037596 3300028381 Bacteria 3991
261 Ga0307408_100023603 3300031548 Bacteria 4192
262 Ga0307408_100029926 3300031548 Bacteria 3777
263 Ga0307408_100332879 3300031548 Unclassified 1283
264 Ga0307405_10013757 3300031731 Bacteria 4325
265 Ga0307405_10159030 3300031731 Unclassified 1598
266 Ga0307405_10262756 3300031731 Bacteria 1290
267 Ga0307405_10885690 3300031731 Unclassified 754
268 Ga0307413_10036588 3300031824 Unclassified 2827
269 Ga0307413_10080896 3300031824 Bacteria 2081
270 Ga0307413_10104207 3300031824 Bacteria 1883
271 Ga0307413_10183783 3300031824 Bacteria 1493
272 Ga0307413_11166492 3300031824 Bacteria 668
273 Ga0307413_11186837 3300031824 Unclassified 663
274 Ga0307410_10012787 3300031852 Bacteria 4870
275 Ga0307410_10017335 3300031852 Bacteria 4323
276 Ga0307410_10024416 3300031852 Bacteria 3776
277 Ga0307410_10035685 3300031852 Unclassified 3232
278 Ga0307410_10072369 3300031852 Unclassified 2394
279 Ga0307406_10007563 3300031901 Bacteria 6031
280 Ga0307406_10026989 3300031901 Bacteria 3455
281 Ga0307406_10316587 3300031901 Unclassified 1205
282 Ga0307406_11282747 3300031901 Unclassified 639
283 Ga0307407_10001620 3300031903 Bacteria 8318
284 Ga0307407_10007528 3300031903 Bacteria 4937
285 Ga0307407_10037184 3300031903 Bacteria 2688
286 Ga0307407_10201470 3300031903 Unclassified 1334
287 Ga0307407_10307977 3300031903 Unclassified 1107
288 Ga0307407_10669635 3300031903 Bacteria 779
289 Ga0307412_11686073 3300031911 Unclassified 581
290 Ga0307409_100000491 3300031995 Bacteria 17000
291 Ga0307409_100015096 3300031995 Bacteria 5053
292 Ga0307409_100221393 3300031995 Bacteria 1709
293 Ga0307409_100264436 3300031995 Unclassified 1580
294 Ga0307409_100285302 3300031995 Viruses 1528
295 Ga0307416_100026983 3300032002 Bacteria 4244
296 Ga0307416_100029514 3300032002 Unclassified 4098
297 Ga0307416_100073281 3300032002 Unclassified 2854
298 Ga0307416_100143549 3300032002 Unclassified 2175
299 Ga0307416_100213488 3300032002 Bacteria 1843
300 Ga0307416_100475694 3300032002 Unclassified 1308
301 Ga0307416_100607237 3300032002 Unclassified 1174
302 Ga0307416_100741179 3300032002 Bacteria 1074
303 Ga0307416_100818894 3300032002 Bacteria 1028
304 Ga0307414_10027104 3300032004 Unclassified 3698
305 Ga0307414_10038648 3300032004 Unclassified 3207
306 Ga0307414_10095245 3300032004 Unclassified 2224
307 Ga0307414_10150790 3300032004 Unclassified 1834
308 Ga0307414_10629454 3300032004 Bacteria 965
309 Ga0307411_10011530 3300032005 Bacteria 4777
310 Ga0307411_10088260 3300032005 Unclassified 2156
311 Ga0307411_10763201 3300032005 Bacteria 848
312 Ga0307415_100002400 3300032126 Bacteria 9340
313 Ga0307415_100030330 3300032126 Bacteria 3469
314 Ga0307415_100038869 3300032126 Unclassified 3140
315 Ga0307415_100265479 3300032126 Unclassified 1403
316 Ga0373948_0082829 3300034817 Unclassified 734
317 Ga0373959_0147042 3300034820 Unclassified 594
318 Ga0373938_0086298 3300034957 Bacteria 771
319 Ga0373929_0027464 3300035085 Bacteria 1196
320 Ga0373940_0023442 3300035088 Bacteria 1593
321 Ga0373940_0029085 3300035088 Bacteria 1462
322 Ga0373940_0030976 3300035088 Bacteria 1426
323 Ga0373939_0240267 3300035114 Bacteria 701
324 Ga0373955_0364763 3300035172 Unclassified 876
325 Ga0373962_0074767 3300035242 Bacteria 1019
326 Ga0373931_0153041 3300035691 Bacteria 1346
327 Ga0373931_0194691 3300035691 Unclassified 1208
328 Ga0373931_0237538 3300035691 Bacteria 1103
329 Ga0373937_0081840 3300036401 Unclassified 2987
330 Ga0373937_0286768 3300036401 Bacteria 1555
331 Ga0373925_0473474 3300037068 Bacteria 1027
332 Ga0395898_1818541 3300037466 Unclassified 530
333 Ga0395905_0144551 3300037471 Bacteria 2238
334 Ga0395905_0623926 3300037471 Unclassified 980
335 Ga0395905_1436460 3300037471 Bacteria 594
336 Ga0395901_0196395 3300038443 Bacteria 2116
337 Ga0242420_003051 3300038996 Bacteria 2451
338 Ga0439436_0131391 3300041404 Bacteria 702
339 Ga0439439_0000457 3300041406 Bacteria 6935
340 Ga0439433_0054223 3300041999 Unclassified 948
341 Ga0439448_0016349 3300042005 Unclassified 2257
342 Ga0439457_018429 3300042014 Bacteria 1551
343 Ga0439462_0004052 3300042015 Bacteria 3554
344 Ga0439446_0031334 3300042156 Bacteria 1539
345 Ga0439434_0125342 3300042435 Bacteria 840
346 Ga0439459_0085512 3300042438 Bacteria 751
347 Ga0451577_0005814 3300042876 Bacteria 12490
348 Ga0451577_0015455 3300042876 Bacteria 7103
349 Ga0451577_0343536 3300042876 Unclassified 1354
350 Ga0453683_0038537 3300044673 Bacteria 3004
351 Ga0453683_0511305 3300044673 Unclassified 780
352 Ga0453683_0593337 3300044673 Bacteria 722
353 Ga0495603_0016212 3300046455 Bacteria 4508
354 Ga0495603_0115787 3300046455 Bacteria 1563
355 Ga0495641_0112200 3300046461 Bacteria 1216
356 Ga0495580_0029387 3300046472 Bacteria 3990
357 Ga0495580_0092425 3300046472 Unclassified 2106
358 Ga0495582_0021362 3300046473 Bacteria 3543
359 Ga0495639_0003804 3300046475 Bacteria 6480
360 Ga0495662_0121849 3300046476 Unclassified 1280
361 Ga0495664_0008815 3300046477 Bacteria 5635
362 Ga0495594_0001701 3300046499 Bacteria 11417
363 Ga0495618_0028073 3300046514 Bacteria 3506
364 Ga0495628_0375231 3300046516 Bacteria 1042
365 Ga0495630_0089347 3300046517 Bacteria 2327
366 Ga0495666_0011507 3300046526 Bacteria 4412
367 Ga0495642_0224577 3300046528 Unclassified 820
368 Ga0495640_0013998 3300046533 Bacteria 6087
369 Ga0495586_0002060 3300046535 Bacteria 10919
370 Ga0495667_0059116 3300046559 Bacteria 2516
371 Ga0495634_0006788 3300046642 Bacteria 8669
372 Ga0495659_0049463 3300046664 Unclassified 1527
373 Ga0495588_0144743 3300046674 Bacteria 1256
374 Ga0495658_0005355 3300046683 Bacteria 6309
375 Ga0495613_0107692 3300046689 Unclassified 2010
376 Ga0495624_0072209 3300046690 Bacteria 2147
377 Ga0495674_0038601 3300047319 Bacteria 4285
378 Ga0495680_0016637 3300047322 Bacteria 6311
379 Ga0495684_0266268 3300047471 Bacteria 1241
380 Ga0496101_0116723 3300048904 Bacteria 2014
381 Ga0496101_0123742 3300048904 Unclassified 1958
382 Ga0496101_0148297 3300048904 Bacteria 1793
383 Ga0496102_0008051 3300048905 Bacteria 9015
384 Ga0496102_0018480 3300048905 Bacteria 6127
385 Ga0496102_0341369 3300048905 Bacteria 1410
386 Ga0496102_0704826 3300048905 Bacteria 932
387 Ga0496102_1224435 3300048905 Bacteria 670
388 Ga0496103_0002515 3300048906 Bacteria 11492
389 Ga0496103_0020583 3300048906 Bacteria 3964
390 Ga0496103_0254436 3300048906 Unclassified 1130
391 Ga0496103_0552763 3300048906 Bacteria 735
392 Ga0496104_0001720 3300048907 Bacteria 18897
393 Ga0496104_0007058 3300048907 Bacteria 9908
394 Ga0496106_0105261 3300048909 Unclassified 2192
395 Ga0496106_0237692 3300048909 Bacteria 1455
396 Ga0496106_0435246 3300048909 Unclassified 1054
397 Ga0496107_0112283 3300048910 Bacteria 2004
398 Ga0496107_0175828 3300048910 Bacteria 1589
399 Ga0496107_0470729 3300048910 Unclassified 933
400 Ga0496107_0762157 3300048910 Unclassified 710
401 Ga0496108_0000829 3300048911 Bacteria 24045
402 Ga0496108_0039125 3300048911 Bacteria 3953
403 Ga0496108_0209142 3300048911 Bacteria 1693
404 Ga0496108_0437199 3300048911 Unclassified 1143
405 Ga0496109_0001833 3300048912 Bacteria 17628
406 Ga0496109_0002817 3300048912 Bacteria 14563
407 Ga0496109_0013328 3300048912 Bacteria 7125
408 Ga0496110_0248164 3300048913 Bacteria 1620
409 Ga0496110_0309366 3300048913 Bacteria 1439
410 Ga0496110_0999316 3300048913 Bacteria 744
411 Ga0496111_0011597 3300048914 Bacteria 5943
412 Ga0496111_0030847 3300048914 Bacteria 3814
413 Ga0496111_0200553 3300048914 Unclassified 1483
414 Ga0496112_0001659 3300048915 Bacteria 17307
415 Ga0496112_0013013 3300048915 Bacteria 7672
416 Ga0496112_0074322 3300048915 Bacteria 3360
417 Ga0496112_0351954 3300048915 Bacteria 1415
418 Ga0496113_0001022 3300048916 Bacteria 15042
419 Ga0496113_0002126 3300048916 Bacteria 11424
420 Ga0496113_0122118 3300048916 Unclassified 2037
421 Ga0496113_0271109 3300048916 Unclassified 1356
422 Ga0496114_0412080 3300048917 Bacteria 1197
423 Ga0496114_1008589 3300048917 Unclassified 716
424 Ga0496114_1295916 3300048917 Unclassified 615
425 Ga0496115_0163276 3300048918 Bacteria 1841
426 Ga0501291_019211 3300049514 Bacteria 1071
427 Ga0501292_012700 3300049515 Bacteria 1288
428 Ga0501031_0053375 3300049568 Bacteria 2634
429 Ga0501031_0100510 3300049568 Bacteria 1887
430 Ga0501033_0095412 3300049570 Bacteria 2174
431 Ga0501034_0253771 3300049571 Bacteria 1703
432 Ga0501036_0073295 3300049572 Bacteria 2895
433 Ga0501036_0094720 3300049572 Bacteria 2524
434 Ga0501036_0220023 3300049572 Bacteria 1594
435 Ga0501036_0626530 3300049572 Unclassified 891
436 Ga0501037_0204495 3300049573 Bacteria 1394
437 Ga0501038_0024340 3300049574 Bacteria 5403
438 Ga0501039_0302042 3300049575 Bacteria 1258
439 Ga0501040_0021560 3300049576 Bacteria 4305
440 Ga0501040_0186452 3300049576 Bacteria 1471
441 Ga0501040_0217334 3300049576 Unclassified 1359
442 Ga0501041_0023708 3300049577 Bacteria 3679
443 Ga0501041_0170417 3300049577 Bacteria 1362
444 Ga0501041_0238607 3300049577 Bacteria 1142
445 Ga0501042_0028266 3300049578 Bacteria 3949
446 Ga0501042_0151569 3300049578 Unclassified 1672
447 Ga0501042_0173623 3300049578 Unclassified 1555
448 Ga0501043_0210794 3300049579 Bacteria 1506
449 Ga0501046_0036095 3300049580 Bacteria 3980
450 Ga0501048_0119295 3300049582 Unclassified 1864
451 Ga0501048_0153838 3300049582 Bacteria 1627
452 Ga0501048_0417697 3300049582 Bacteria 959
453 Ga0501067_0072943 3300049583 Bacteria 1902
454 Ga0501067_0131229 3300049583 Bacteria 1394
455 Ga0501068_0073013 3300049584 Bacteria 2096
456 Ga0501068_0265986 3300049584 Bacteria 1094
457 Ga0501069_0143442 3300049585 Bacteria 1370
458 Ga0501069_0217341 3300049585 Unclassified 1110
459 Ga0501069_0464185 3300049585 Bacteria 753
460 Ga0501069_0624238 3300049585 Bacteria 648
461 Ga0501070_0141582 3300049586 Bacteria 1986
462 Ga0501070_0235391 3300049586 Bacteria 1500
463 Ga0501071_0066864 3300049587 Bacteria 2613
464 Ga0501071_0447777 3300049587 Unclassified 988
465 Ga0501071_0898856 3300049587 Unclassified 683
466 Ga0501072_0056972 3300049588 Bacteria 3079
467 Ga0501072_0207904 3300049588 Unclassified 1560
468 Ga0501074_0032511 3300049590 Bacteria 3780
469 Ga0501074_0051583 3300049590 Unclassified 2969
470 Ga0501075_0144755 3300049591 Bacteria 1811
471 Ga0501075_0221301 3300049591 Unclassified 1444
472 Ga0501076_0014945 3300049592 Bacteria 5859
473 Ga0501076_0048385 3300049592 Bacteria 3361
474 Ga0501076_0292134 3300049592 Unclassified 1335
475 Ga0501077_0001223 3300049593 Bacteria 15504
476 Ga0501077_0010252 3300049593 Bacteria 5833
477 Ga0501077_0030715 3300049593 Bacteria 3419
478 Ga0501216_082297 3300049660 Unclassified 683
479 Ga0501217_070366 3300049661 Bacteria 951
480 Ga0501217_142928 3300049661 Unclassified 710
481 Ga0501251_033555 3300049681 Bacteria 744
482 Ga0501245_028691 3300049708 Unclassified 909
483 Ga0501079_0011207 3300049741 Bacteria 6839
484 Ga0501079_0026876 3300049741 Bacteria 4413
485 Ga0501079_0067072 3300049741 Unclassified 2769
486 Ga0501079_0081632 3300049741 Unclassified 2500
487 Ga0501080_0034116 3300049742 Bacteria 4750
488 Ga0501080_0085271 3300049742 Bacteria 2935
489 Ga0501080_0130721 3300049742 Unclassified 2325
490 Ga0501081_0007074 3300049743 Bacteria 7294
491 Ga0501081_0009385 3300049743 Bacteria 6375
492 Ga0501081_0098525 3300049743 Unclassified 2064
493 Ga0501081_0576962 3300049743 Unclassified 841
494 Ga0501083_0076953 3300049744 Bacteria 2214
495 Ga0501083_0270795 3300049744 Bacteria 1105
496 Ga0501083_0378214 3300049744 Unclassified 921
497 Ga0501273_003261 3300049770 Bacteria 1711
498 Ga0501045_0032959 3300049824 Bacteria 3755
499 Ga0501045_0048009 3300049824 Unclassified 3111
500 Ga0501045_0095655 3300049824 Unclassified 2197
501 Ga0501045_0519308 3300049824 Unclassified 884
502 nmdc:mga05p37_120016_c1 3300050507 Bacteria 3230
503 nmdc:mga05p37_1524510_c1 3300050507 Unclassified 664
504 nmdc:mga05p37_43633_c1 3300050507 Bacteria 5517
505 nmdc:mga05p37_512668_c1 3300050507 Unclassified 1374
506 nmdc:mga05p37_77066_c1 3300050507 Bacteria 4104
507 nmdc:mga05p37_996847_c1 3300050507 Unclassified 890
508 nmdc:mga09592_13907_c1 3300050508 Bacteria 6575
509 nmdc:mga0qj67_181127_c1 3300050509 Bacteria 1711
510 nmdc:mga06r32_595727_c1 3300050510 Bacteria 1076
511 nmdc:mga06r32_84518_c1 3300050510 Bacteria 3093
512 nmdc:mga08y16_179498_c1 3300050511 Bacteria 2198
513 nmdc:mga08y16_86045_c1 3300050511 Bacteria 3276
514 nmdc:mga0n895_1029465_c1 3300050512 Unclassified 803
515 nmdc:mga0n895_27057_c1 3300050512 Bacteria 5443
516 nmdc:mga0n895_31906_c1 3300050512 Bacteria 5050
517 nmdc:mga0n895_427763_c1 3300050512 Bacteria 1338
518 nmdc:mga0n895_68063_c1 3300050512 Unclassified 3527
519 nmdc:mga0rr50_19339_c2 3300050513 Bacteria 2583
520 nmdc:mga0rr50_215982_c1 3300050513 Unclassified 1582
521 nmdc:mga0rr50_355163_c1 3300050513 Unclassified 1233
522 nmdc:mga0rr50_72031_c1 3300050513 Unclassified 2638
523 nmdc:mga08x19_110095_c1 3300050514 Unclassified 1836
524 nmdc:mga08x19_20706_c1 3300050514 Unclassified 4052
525 nmdc:mga08x19_254846_c2 3300050514 Bacteria 834
526 nmdc:mga08x19_319896_c1 3300050514 Unclassified 1080
527 nmdc:mga08x19_650935_c1 3300050514 Unclassified 747
528 nmdc:mga08x19_659450_c1 3300050514 Bacteria 742
529 nmdc:mga0a205_138362_c1 3300050515 Unclassified 2335
530 nmdc:mga0a205_156127_c1 3300050515 Bacteria 2180
531 nmdc:mga0a205_91751_c1 3300050515 Bacteria 2935
532 Ga0501084_0005088 3300054114 Bacteria 10764
533 Ga0501084_0013437 3300054114 Bacteria 6775
534 Ga0501084_0492271 3300054114 Bacteria 1036
535 Ga0590071_002815 3300059421 Bacteria 4357
536 Ga0590074_012861 3300059423 Bacteria 1410
537 Ga0590074_050413 3300059423 Bacteria 761
538 Ga0590075_037113 3300059424 Bacteria 1242
539 Ga0590077_005183 3300059426 Bacteria 2667
540 Ga0590077_005398 3300059426 Bacteria 2618
541 Ga0501082_0060572 3300060353 Bacteria 3259
542 Ga0501082_0111132 3300060353 Bacteria 2372
543 Ga0501082_0290617 3300060353 Unclassified 1423
544 Ga0501082_0450313 3300060353 Bacteria 1125
545 Ga0530510_0070786 3300061734 Bacteria 2531
546 Ga0530510_0179811 3300061734 Bacteria 1568
547 Ga0070706_100181587
548 MBSR1b_contig_1301407
549 Ga0065715_10017721
550 Ga0070676_10050758
551 Ga0070676_10085967
552 Ga0070683_100115232
553 Ga0070690_100010669
554 Ga0068869_100014102
555 Ga0070680_100023141
556 Ga0070680_100056178
557 Ga0070660_100731881
558 Ga0070689_100305058
559 Ga0070691_10057157
560 Ga0070691_10648951
561 Ga0070687_100897839
562 Ga0070661_100236824
563 Ga0070668_100019922
564 Ga0070669_100065091
565 Ga0070675_100367389
566 Ga0070671_100019874
567 Ga0070671_100895366
568 Ga0070674_100001196
569 Ga0070673_100256821
570 Ga0070659_100226071
571 Ga0070659_100308447
572 Ga0070705_100015030
573 Ga0070705_100335243
574 Ga0070705_100599984
575 Ga0070705_100902216
576 Ga0070694_100003314
577 Ga0070694_100025413
578 Ga0070694_100031879
579 Ga0070708_100037071
580 Ga0070708_100335002
581 Ga0070663_100625120
582 Ga0070663_101282628
583 Ga0070678_100021994
584 Ga0070662_100000040
585 Ga0070681_10033829
586 Ga0068867_100001196
587 Ga0068867_100485461
588 Ga0070685_10245647
589 Ga0070706_100027602
590 Ga0070706_100508113
591 Ga0070707_100009970
592 Ga0070707_100014297
593 Ga0070707_100077352
594 Ga0070707_100228348
595 Ga0070707_100354715
596 Ga0070698_100005635
597 Ga0070698_100283560
598 Ga0070699_100002654
599 Ga0070699_100008984
600 Ga0070699_100056985
601 Ga0070699_100099708
602 Ga0070699_100164982
603 Ga0070699_100188644
604 Ga0070699_100952712
605 Ga0070679_100026841
606 Ga0070684_100070821
607 Ga0070684_101111702
608 Ga0070684_101161261
609 Ga0070697_100003157
610 Ga0070697_100015953
611 Ga0070697_100040262
612 Ga0070697_100104216
613 Ga0070697_100179418
614 Ga0070697_100267641
615 Ga0070697_100469761
616 Ga0070697_100484254
617 Ga0068853_100128000
618 Ga0070672_100009353
619 Ga0070672_100087163
620 Ga0070686_100137332
621 Ga0070695_100010656
622 Ga0070695_100062441
623 Ga0070696_100001378
624 Ga0070696_100005872
625 Ga0070696_100009138
626 Ga0070696_100037636
627 Ga0070696_100071859
628 Ga0070696_100177383
629 Ga0070696_100261096
630 Ga0070693_100340025
631 Ga0070704_100020312
632 Ga0070704_100023864
633 Ga0070704_100027890
634 Ga0070704_100057916
635 Ga0070704_100098043
636 Ga0068855_100173841
637 Ga0070664_100036367
638 Ga0070664_100040037
639 Ga0070664_100052465
640 Ga0070664_100684310
641 Ga0068857_100020916
642 Ga0068857_100291498
643 Ga0068857_100746946
644 Ga0068854_100001567
645 Ga0068854_100141552
646 Ga0068854_100192451
647 Ga0070702_100005934
648 Ga0068852_100821656
649 Ga0068859_100141222
650 Ga0068864_100001195
651 Ga0068866_10000826
652 Ga0068861_100004158
653 Ga0068861_101305359
654 Ga0068870_10004652
655 Ga0068863_100168928
656 Ga0068863_101156362
657 Ga0068860_100049218
658 Ga0068862_100611335
659 Ga0070715_10310377
660 Ga0070716_100201575
661 Ga0070712_100536237
662 Ga0097621_100186424
663 Ga0068871_100092875
664 Ga0075428_100024428
665 Ga0075428_100782819
666 Ga0075430_100263617
667 Ga0075431_100103824
668 Ga0075433_10003424
669 Ga0075433_10018281
670 Ga0075433_10137344
671 Ga0075433_10145824
672 Ga0075433_10731736
673 Ga0075434_100034515
674 Ga0075434_100108649
675 Ga0075434_100237243
676 Ga0075429_100063071
677 Ga0068865_100005870
678 Ga0075436_100005375
679 Ga0075436_100140105
680 Ga0075436_100386561
681 Ga0097620_100141223
682 Ga0075435_100077321
683 Ga0075435_100082903
684 Ga0075435_100267676
685 Ga0105240_10191293
686 Ga0111539_10109515
687 Ga0111539_10358273
688 Ga0105245_10800118
689 Ga0114129_10000088
690 Ga0114129_10027235
691 Ga0114129_10031632
692 Ga0114129_10317089
693 Ga0114129_10391686
694 Ga0114129_10433944
695 Ga0114129_10478847
696 Ga0114129_11079366
697 Ga0114129_11093956
698 Ga0105243_10003605
699 Ga0105241_10028229
700 Ga0105242_10000522
701 Ga0105242_10359273
702 Ga0105248_10001785
703 Ga0105248_12263636
704 Ga0105237_10231721
705 Ga0105238_10477835
706 Ga0105249_10136442
707 Ga0105249_10581348
708 Ga0105249_10867685
709 Ga0105239_10029426
710 Ga0105239_10213427
711 Ga0105246_10072991
712 Ga0105246_10202514
713 Ga0157371_10032015
714 Ga0157378_10001653
715 Ga0163162_10062010
716 Ga0163162_10683416
717 Ga0157372_10015592
718 Ga0157372_11329353
719 Ga0157372_12504624
720 Ga0157380_10048319
721 Ga0157379_10013742
722 Ga0157376_10036485
723 Ga0163161_10560618
724 Ga0207642_10000216
725 Ga0207642_10066598
726 Ga0207642_10164178
727 Ga0207645_10004978
728 Ga0207643_10026520
729 Ga0207684_10027883
730 Ga0207684_10154928
731 Ga0207684_10796829
732 Ga0207654_10005356
733 Ga0207707_10024081
734 Ga0207695_10210104
735 Ga0207693_10069492
736 Ga0207663_10076172
737 Ga0207660_10036652
738 Ga0207660_10060698
739 Ga0207660_10418487
740 Ga0207657_11265519
741 Ga0207649_10136555
742 Ga0207649_10220212
743 Ga0207652_10049326
744 Ga0207646_10000535
745 Ga0207646_10000629
746 Ga0207646_10000661
747 Ga0207646_10001364
748 Ga0207646_10016722
749 Ga0207646_10026228
750 Ga0207646_10225898
751 Ga0207681_10177280
752 Ga0207694_10231496
753 Ga0207659_10144082
754 Ga0207687_10024971
755 Ga0207687_10238083
756 Ga0207700_10075552
757 Ga0207644_10051552
758 Ga0207690_10062287
759 Ga0207690_10183251
760 Ga0207706_10000220
761 Ga0207706_10252104
762 Ga0207686_10000138
763 Ga0207709_10004232
764 Ga0207670_10476504
765 Ga0207669_10005012
766 Ga0207669_10957563
767 Ga0207704_10002472
768 Ga0207704_10223684
769 Ga0207704_10228259
770 Ga0207691_10045696
771 Ga0207691_10200946
772 Ga0207711_10001584
773 Ga0207689_10078072
774 Ga0207679_10069952
775 Ga0207679_10083408
776 Ga0207679_10110259
777 Ga0207679_10150269
778 Ga0207651_10047914
779 Ga0207651_10556112
780 Ga0207712_10002939
781 Ga0207712_10455599
782 Ga0207668_10070256
783 Ga0207640_10004418
784 Ga0207640_10240168
785 Ga0207640_10895859
786 Ga0207703_10032730
787 Ga0207639_10113392
788 Ga0207639_10698282
789 Ga0207678_10737521
790 Ga0207678_10774415
791 Ga0207641_10916616
792 Ga0207648_10000021
793 Ga0207648_10459480
794 Ga0207648_10648101
795 Ga0207676_10005231
796 Ga0207676_10052613
797 Ga0207674_10002007
798 Ga0207674_10428675
799 Ga0207675_100011842
800 Ga0207675_100380034
801 Ga0207683_10006642
802 Ga0207698_10591728
803 Ga0209588_1061613
804 Ga0207428_10143977
805 Ga0268265_10578006
806 Ga0268264_10037596
807 Ga0307408_100023603
808 Ga0307408_100029926
809 Ga0307408_100332879
810 Ga0307405_10013757
811 Ga0307405_10159030
812 Ga0307405_10262756
813 Ga0307405_10885690
814 Ga0307413_10036588
815 Ga0307413_10080896
816 Ga0307413_10104207
817 Ga0307413_10183783
818 Ga0307413_11166492
819 Ga0307413_11186837
820 Ga0307410_10012787
821 Ga0307410_10017335
822 Ga0307410_10024416
823 Ga0307410_10035685
824 Ga0307410_10072369
825 Ga0307406_10007563
826 Ga0307406_10026989
827 Ga0307406_10316587
828 Ga0307406_11282747
829 Ga0307407_10001620
830 Ga0307407_10007528
831 Ga0307407_10037184
832 Ga0307407_10201470
833 Ga0307407_10307977
834 Ga0307407_10669635
835 Ga0307412_11686073
836 Ga0307409_100000491
837 Ga0307409_100015096
838 Ga0307409_100221393
839 Ga0307409_100264436
840 Ga0307409_100285302
841 Ga0307416_100026983
842 Ga0307416_100029514
843 Ga0307416_100073281
844 Ga0307416_100143549
845 Ga0307416_100213488
846 Ga0307416_100475694
847 Ga0307416_100607237
848 Ga0307416_100741179
849 Ga0307416_100818894
850 Ga0307414_10027104
851 Ga0307414_10038648
852 Ga0307414_10095245
853 Ga0307414_10150790
854 Ga0307414_10629454
855 Ga0307411_10011530
856 Ga0307411_10088260
857 Ga0307411_10763201
858 Ga0307415_100002400
859 Ga0307415_100030330
860 Ga0307415_100038869
861 Ga0307415_100265479
862 Ga0373948_0082829
863 Ga0373959_0147042
864 Ga0373938_0086298
865 Ga0373929_0027464
866 Ga0373940_0023442
867 Ga0373940_0029085
868 Ga0373940_0030976
869 Ga0373939_0240267
870 Ga0373955_0364763
871 Ga0373962_0074767
872 Ga0373931_0153041
873 Ga0373931_0194691
874 Ga0373931_0237538
875 Ga0373937_0081840
876 Ga0373937_0286768
877 Ga0373925_0473474
878 Ga0395898_1818541
879 Ga0395905_0144551
880 Ga0395905_0623926
881 Ga0395905_1436460
882 Ga0395901_0196395
883 Ga0242420_003051
884 Ga0439436_0131391
885 Ga0439439_0000457
886 Ga0439433_0054223
887 Ga0439448_0016349
888 Ga0439457_018429
889 Ga0439462_0004052
890 Ga0439446_0031334
891 Ga0439434_0125342
892 Ga0439459_0085512
893 Ga0451577_0005814
894 Ga0451577_0015455
895 Ga0451577_0343536
896 Ga0453683_0038537
897 Ga0453683_0511305
898 Ga0453683_0593337
899 Ga0495603_0016212
900 Ga0495603_0115787
901 Ga0495641_0112200
902 Ga0495580_0029387
903 Ga0495580_0092425
904 Ga0495582_0021362
905 Ga0495639_0003804
906 Ga0495662_0121849
907 Ga0495664_0008815
908 Ga0495594_0001701
909 Ga0495618_0028073
910 Ga0495628_0375231
911 Ga0495630_0089347
912 Ga0495666_0011507
913 Ga0495642_0224577
914 Ga0495640_0013998
915 Ga0495586_0002060
916 Ga0495667_0059116
917 Ga0495634_0006788
918 Ga0495659_0049463
919 Ga0495588_0144743
920 Ga0495658_0005355
921 Ga0495613_0107692
922 Ga0495624_0072209
923 Ga0495674_0038601
924 Ga0495680_0016637
925 Ga0495684_0266268
926 Ga0496101_0116723
927 Ga0496101_0123742
928 Ga0496101_0148297
929 Ga0496102_0008051
930 Ga0496102_0018480
931 Ga0496102_0341369
932 Ga0496102_0704826
933 Ga0496102_1224435
934 Ga0496103_0002515
935 Ga0496103_0020583
936 Ga0496103_0254436
937 Ga0496103_0552763
938 Ga0496104_0001720
939 Ga0496104_0007058
940 Ga0496106_0105261
941 Ga0496106_0237692
942 Ga0496106_0435246
943 Ga0496107_0112283
944 Ga0496107_0175828
945 Ga0496107_0470729
946 Ga0496107_0762157
947 Ga0496108_0000829
948 Ga0496108_0039125
949 Ga0496108_0209142
950 Ga0496108_0437199
951 Ga0496109_0001833
952 Ga0496109_0002817
953 Ga0496109_0013328
954 Ga0496110_0248164
955 Ga0496110_0309366
956 Ga0496110_0999316
957 Ga0496111_0011597
958 Ga0496111_0030847
959 Ga0496111_0200553
960 Ga0496112_0001659
961 Ga0496112_0013013
962 Ga0496112_0074322
963 Ga0496112_0351954
964 Ga0496113_0001022
965 Ga0496113_0002126
966 Ga0496113_0122118
967 Ga0496113_0271109
968 Ga0496114_0412080
969 Ga0496114_1008589
970 Ga0496114_1295916
971 Ga0496115_0163276
972 Ga0501291_019211
973 Ga0501292_012700
974 Ga0501031_0053375
975 Ga0501031_0100510
976 Ga0501033_0095412
977 Ga0501034_0253771
978 Ga0501036_0073295
979 Ga0501036_0094720
980 Ga0501036_0220023
981 Ga0501036_0626530
982 Ga0501037_0204495
983 Ga0501038_0024340
984 Ga0501039_0302042
985 Ga0501040_0021560
986 Ga0501040_0186452
987 Ga0501040_0217334
988 Ga0501041_0023708
989 Ga0501041_0170417
990 Ga0501041_0238607
991 Ga0501042_0028266
992 Ga0501042_0151569
993 Ga0501042_0173623
994 Ga0501043_0210794
995 Ga0501046_0036095
996 Ga0501048_0119295
997 Ga0501048_0153838
998 Ga0501048_0417697
999 Ga0501067_0072943
1000 Ga0501067_0131229
1001 Ga0501068_0073013
1002 Ga0501068_0265986
1003 Ga0501069_0143442
1004 Ga0501069_0217341
1005 Ga0501069_0464185
1006 Ga0501069_0624238
1007 Ga0501070_0141582
1008 Ga0501070_0235391
1009 Ga0501071_0066864
1010 Ga0501071_0447777
1011 Ga0501071_0898856
1012 Ga0501072_0056972
1013 Ga0501072_0207904
1014 Ga0501074_0032511
1015 Ga0501074_0051583
1016 Ga0501075_0144755
1017 Ga0501075_0221301
1018 Ga0501076_0014945
1019 Ga0501076_0048385
1020 Ga0501076_0292134
1021 Ga0501077_0001223
1022 Ga0501077_0010252
1023 Ga0501077_0030715
1024 Ga0501216_082297
1025 Ga0501217_070366
1026 Ga0501217_142928
1027 Ga0501251_033555
1028 Ga0501245_028691
1029 Ga0501079_0011207
1030 Ga0501079_0026876
1031 Ga0501079_0067072
1032 Ga0501079_0081632
1033 Ga0501080_0034116
1034 Ga0501080_0085271
1035 Ga0501080_0130721
1036 Ga0501081_0007074
1037 Ga0501081_0009385
1038 Ga0501081_0098525
1039 Ga0501081_0576962
1040 Ga0501083_0076953
1041 Ga0501083_0270795
1042 Ga0501083_0378214
1043 Ga0501273_003261
1044 Ga0501045_0032959
1045 Ga0501045_0048009
1046 Ga0501045_0095655
1047 Ga0501045_0519308
1048 nmdc:mga05p37_120016_c1
1049 nmdc:mga05p37_1524510_c1
1050 nmdc:mga05p37_43633_c1
1051 nmdc:mga05p37_512668_c1
1052 nmdc:mga05p37_77066_c1
1053 nmdc:mga05p37_996847_c1
1054 nmdc:mga09592_13907_c1
1055 nmdc:mga0qj67_181127_c1
1056 nmdc:mga06r32_595727_c1
1057 nmdc:mga06r32_84518_c1
1058 nmdc:mga08y16_179498_c1
1059 nmdc:mga08y16_86045_c1
1060 nmdc:mga0n895_1029465_c1
1061 nmdc:mga0n895_27057_c1
1062 nmdc:mga0n895_31906_c1
1063 nmdc:mga0n895_427763_c1
1064 nmdc:mga0n895_68063_c1
1065 nmdc:mga0rr50_19339_c2
1066 nmdc:mga0rr50_215982_c1
1067 nmdc:mga0rr50_355163_c1
1068 nmdc:mga0rr50_72031_c1
1069 nmdc:mga08x19_110095_c1
1070 nmdc:mga08x19_20706_c1
1071 nmdc:mga08x19_254846_c2
1072 nmdc:mga08x19_319896_c1
1073 nmdc:mga08x19_650935_c1
1074 nmdc:mga08x19_659450_c1
1075 nmdc:mga0a205_138362_c1
1076 nmdc:mga0a205_156127_c1
1077 nmdc:mga0a205_91751_c1
1078 Ga0501084_0005088
1079 Ga0501084_0013437
1080 Ga0501084_0492271
1081 Ga0590071_002815
1082 Ga0590074_012861
1083 Ga0590074_050413
1084 Ga0590075_037113
1085 Ga0590077_005183
1086 Ga0590077_005398
1087 Ga0501082_0060572
1088 Ga0501082_0111132
1089 Ga0501082_0290617
1090 Ga0501082_0450313
1091 Ga0530510_0070786
1092 Ga0530510_0179811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

38

179

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zfn-assembly1.cif.gz_A-2 hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus containing gmp complexed in two different ways together with one or two mg2+ 0.9282 12 148
4ts7-assembly1.cif.gz_A sulfolobus solfataricus adenine phosphoribosyltransferase with adp 0.9028 11 149
4z1o-assembly1.cif.gz_A-2 hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus in complex with alpha-phosphoribosylpyrophosphoric acid (prpp) and magnesium 0.8923 14 148
5vog-assembly1.cif.gz_A-2 crystal structure of a hypothetical protein from neisseria gonorrhoeae with bound ppgpp 0.8866 10 148
5bqp-assembly1.cif.gz_C hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with xanthosine and phosphate bound in the nucleotide binding site and with sulfate bound in the pyrophosphate binding site 0.8826 11 148
ID Description Score Start End Superfamily
4zfnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8951 11 148 3.40.50.2020
1wd5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8927 20 126 3.40.50.2020
5vogA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8866 10 148 3.40.50.2020
1vdmG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8694 12 153 3.40.50.2020
4rv4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.849 18 126 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A7W0YQB1-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9816 53 165
AF-A0A2V7S911-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9783 41 168 GO:0016757
AF-A0A838QNK4-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.972 1 160 GO:0016757
AF-A0A1G0L9B7-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9713 13 168 GO:0016757
AF-A0A838NL40-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9699 1 166 GO:0016757

Map