F461929
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 545 | 360 | 458 | 506 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2867475112|2867477636 |
| Length | 558 |
| Sequence | TTAPEASAVLAVSATKGVNGVALAVFIFFFLAVTVMGFLAARWRKAEESANLDEWGLGGRSFGTWVTWFLLGGDLYTAYTFVAVPAAIYAAGAAGFFAVPYTILVYPLIFTFLPRLWSVSHKHGYVTTSDFVRGRFGSKGLSLAVALTGILATMPYIALQLVGIQAVLDVLGIGGGEHTNWFVKDLPLLIAFAVLAAYTYSSGLRAPALIAFVKDGLIYLVIGVAIIYIPIKLGGFDAVFHSAGKALAQPGPVPGKPRGELTSGPNAQWAYATLALGSALALFMYPHSITATLSSRSRNVIRRNTTILPLYSLMLGLLALLGFMAIKAGTDIQGNPQLAIPQLFEDMFPSWFTGVAFAAIGIGALVPAAIMSIAAANLFTRNVYKDFLKPDATPAQEHKVAKLVSLLVKVGALVFVLTMDKTVAINFQLLGGIWILQTMPSLVGGLFTRWFHRWALLAGWAVGMLYGTLAAYGVASPTQAHFGGSSKEIPGIGEIGYIGLTAFVLNVVVSVVLTVVLKAVNAPEGTDETSPADYTADAGDEGVVVELPPATAGAPAGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 4 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 5 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 6 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 7 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 8 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 9 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 10 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 11 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 12 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 13 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 14 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 15 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 16 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 17 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 18 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 19 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 20 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 21 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 22 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 23 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 24 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 25 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 26 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 27 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 28 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 29 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 30 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 31 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 32 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 33 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 34 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 35 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 36 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 37 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 38 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 39 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 40 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 41 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 42 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 43 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 44 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 45 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 46 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 47 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 48 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 49 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 50 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 51 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 52 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 53 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 54 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 55 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 56 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 57 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 58 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 59 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 60 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 61 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 62 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 63 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 64 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 65 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 66 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 67 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 68 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 69 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 70 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 71 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 72 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 73 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 74 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 75 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 76 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 78 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 101 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 103 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 106 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 107 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 108 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 109 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 110 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 117 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 167 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 170 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 173 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 174 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 179 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 180 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 181 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 209 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 210 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 213 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 214 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 215 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 216 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 225 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 226 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 227 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 332 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 334 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 341 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 342 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 343 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 346 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 347 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 348 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 349 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 350 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 351 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 352 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 353 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 354 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 355 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 356 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 357 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 358 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 359 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 360 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.94 |
| Metatranscriptomes | 1.1 |
| Isolates | 15.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.57 |
| Nodule | 0.55 |
| Rhizoplane | 2.94 |
| Rhizosphere | 80.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10015630 | 3300002067 | Bacteria | 2365 |
| 2 | JGI25165J46597_1000016 | 3300003214 | Bacteria | 377866 |
| 3 | rootL2_10007767 | 3300003322 | Bacteria | 6531 |
| 4 | JGI25407J50210_10006427 | 3300003373 | Bacteria | 2927 |
| 5 | Ga0006562J51391_1188152 | 3300003578 | Bacteria | 3480 |
| 6 | Ga0058861_10082260 | 3300004800 | Bacteria | 2164 |
| 7 | Ga0070658_10030822 | 3300005327 | Bacteria | 4308 |
| 8 | Ga0070683_100048161 | 3300005329 | Bacteria | 3940 |
| 9 | Ga0070680_100035954 | 3300005336 | Bacteria | 4000 |
| 10 | Ga0070687_100016953 | 3300005343 | Bacteria | 3338 |
| 11 | Ga0070668_100159801 | 3300005347 | Bacteria | 1828 |
| 12 | Ga0070688_100063709 | 3300005365 | Bacteria | 2338 |
| 13 | Ga0070659_100053342 | 3300005366 | Bacteria | 3182 |
| 14 | Ga0070667_100168906 | 3300005367 | Bacteria | 1930 |
| 15 | Ga0070709_10039996 | 3300005434 | Bacteria | 2880 |
| 16 | Ga0070709_10065342 | 3300005434 | Bacteria | 2329 |
| 17 | Ga0070714_100002170 | 3300005435 | Bacteria | 14422 |
| 18 | Ga0070713_100003769 | 3300005436 | Bacteria | 10036 |
| 19 | Ga0070694_100066955 | 3300005444 | Bacteria | 2464 |
| 20 | Ga0070663_100022215 | 3300005455 | Bacteria | 4237 |
| 21 | Ga0070662_100082933 | 3300005457 | Bacteria | 2392 |
| 22 | Ga0070685_10055939 | 3300005466 | Bacteria | 2293 |
| 23 | Ga0070707_100069378 | 3300005468 | Bacteria | 3394 |
| 24 | Ga0070698_100005079 | 3300005471 | Bacteria | 14410 |
| 25 | Ga0070699_100002283 | 3300005518 | Bacteria | 17248 |
| 26 | Ga0070679_100116986 | 3300005530 | Bacteria | 2650 |
| 27 | Ga0070684_100040580 | 3300005535 | Bacteria | 4009 |
| 28 | Ga0070697_100003717 | 3300005536 | Bacteria | 11718 |
| 29 | Ga0068853_100019858 | 3300005539 | Bacteria | 5581 |
| 30 | Ga0068853_100100069 | 3300005539 | Bacteria | 2562 |
| 31 | Ga0070696_100035241 | 3300005546 | Bacteria | 3444 |
| 32 | Ga0068855_100169730 | 3300005563 | Bacteria | 2471 |
| 33 | Ga0070664_100016550 | 3300005564 | Bacteria | 6047 |
| 34 | Ga0070702_100034681 | 3300005615 | Bacteria | 2782 |
| 35 | Ga0068859_100048153 | 3300005617 | Bacteria | 4282 |
| 36 | Ga0068863_100044396 | 3300005841 | Bacteria | 4219 |
| 37 | Ga0081455_10012607 | 3300005937 | Bacteria | 8425 |
| 38 | Ga0081455_10035007 | 3300005937 | Bacteria | 4493 |
| 39 | Ga0081538_10000369 | 3300005981 | Bacteria | 51269 |
| 40 | Ga0081538_10013180 | 3300005981 | Bacteria | 6562 |
| 41 | Ga0081538_10035970 | 3300005981 | Bacteria | 3242 |
| 42 | Ga0081540_1000607 | 3300005983 | Bacteria | 34146 |
| 43 | Ga0081540_1000665 | 3300005983 | Bacteria | 32397 |
| 44 | Ga0081539_10015242 | 3300005985 | Bacteria | 5601 |
| 45 | Ga0081539_10018975 | 3300005985 | Bacteria | 4736 |
| 46 | Ga0070717_10017610 | 3300006028 | Bacteria | 5562 |
| 47 | Ga0070717_10070278 | 3300006028 | Bacteria | 2917 |
| 48 | Ga0075368_10005467 | 3300006042 | Bacteria | 4369 |
| 49 | Ga0070716_100086787 | 3300006173 | Bacteria | 1883 |
| 50 | Ga0070712_100031789 | 3300006175 | Bacteria | 3558 |
| 51 | Ga0070712_100082714 | 3300006175 | Bacteria | 2329 |
| 52 | Ga0075367_10003844 | 3300006178 | Bacteria | 7239 |
| 53 | Ga0075430_100007812 | 3300006846 | Bacteria | 9037 |
| 54 | Ga0075431_100033865 | 3300006847 | Bacteria | 5264 |
| 55 | Ga0075434_100018644 | 3300006871 | Bacteria | 6704 |
| 56 | Ga0097620_100048153 | 3300006931 | Bacteria | 4282 |
| 57 | Ga0105251_10017136 | 3300009011 | Bacteria | 3891 |
| 58 | Ga0111539_10004429 | 3300009094 | Bacteria | 18349 |
| 59 | Ga0105243_10056759 | 3300009148 | Bacteria | 3115 |
| 60 | Ga0105238_10074742 | 3300009551 | Bacteria | 3381 |
| 61 | Ga0157370_10012834 | 3300013104 | Bacteria | 8661 |
| 62 | Ga0157369_10086089 | 3300013105 | Bacteria | 3357 |
| 63 | Ga0182008_10001039 | 3300014497 | Bacteria | 19279 |
| 64 | Ga0182008_10026478 | 3300014497 | Bacteria | 2941 |
| 65 | Ga0182007_10000456 | 3300015262 | Bacteria | 24668 |
| 66 | Ga0182005_1010631 | 3300015265 | Bacteria | 2642 |
| 67 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 68 | Ga0163161_10081091 | 3300017792 | Bacteria | 2389 |
| 69 | Ga0197907_10498473 | 3300020069 | Bacteria | 2104 |
| 70 | Ga0206349_1237425 | 3300020075 | Bacteria | 2313 |
| 71 | Ga0206354_10145188 | 3300020081 | Bacteria | 2497 |
| 72 | Ga0206353_11186864 | 3300020082 | Bacteria | 5112 |
| 73 | Ga0213872_10001035 | 3300021361 | Bacteria | 19388 |
| 74 | Ga0213872_10007945 | 3300021361 | Bacteria | 5172 |
| 75 | Ga0213874_10000559 | 3300021377 | Bacteria | 7452 |
| 76 | Ga0213874_10001953 | 3300021377 | Bacteria | 4338 |
| 77 | Ga0213876_10007469 | 3300021384 | Bacteria | 5946 |
| 78 | Ga0213876_10013365 | 3300021384 | Bacteria | 4363 |
| 79 | Ga0209233_1000068 | 3300025261 | Bacteria | 377969 |
| 80 | Ga0209758_1002959 | 3300025297 | Bacteria | 16295 |
| 81 | Ga0207426_1009705 | 3300025302 | Bacteria | 3785 |
| 82 | Ga0207692_10005124 | 3300025898 | Bacteria | 5230 |
| 83 | Ga0207692_10035868 | 3300025898 | Bacteria | 2413 |
| 84 | Ga0207688_10003662 | 3300025901 | Bacteria | 8394 |
| 85 | Ga0207647_10014132 | 3300025904 | Bacteria | 5513 |
| 86 | Ga0207685_10001899 | 3300025905 | Bacteria | 4605 |
| 87 | Ga0207699_10002717 | 3300025906 | Bacteria | 8364 |
| 88 | Ga0207705_10086079 | 3300025909 | Bacteria | 2297 |
| 89 | Ga0207707_10003601 | 3300025912 | Bacteria | 13738 |
| 90 | Ga0207707_10010745 | 3300025912 | Bacteria | 7954 |
| 91 | Ga0207693_10053499 | 3300025915 | Bacteria | 3167 |
| 92 | Ga0207693_10053812 | 3300025915 | Bacteria | 3158 |
| 93 | Ga0207693_10096946 | 3300025915 | Bacteria | 2312 |
| 94 | Ga0207663_10056967 | 3300025916 | Bacteria | 2460 |
| 95 | Ga0207662_10019146 | 3300025918 | Bacteria | 3892 |
| 96 | Ga0207652_10018993 | 3300025921 | Bacteria | 5645 |
| 97 | Ga0207700_10002898 | 3300025928 | Bacteria | 9887 |
| 98 | Ga0207700_10007865 | 3300025928 | Bacteria | 6558 |
| 99 | Ga0207700_10009940 | 3300025928 | Bacteria | 5974 |
| 100 | Ga0207700_10085862 | 3300025928 | Bacteria | 2471 |
| 101 | Ga0207664_10000754 | 3300025929 | Bacteria | 22024 |
| 102 | Ga0207664_10078705 | 3300025929 | Bacteria | 2674 |
| 103 | Ga0207706_10056157 | 3300025933 | Bacteria | 3472 |
| 104 | Ga0207665_10075277 | 3300025939 | Bacteria | 2312 |
| 105 | Ga0207661_10039477 | 3300025944 | Bacteria | 3705 |
| 106 | Ga0207639_10070151 | 3300026041 | Bacteria | 2736 |
| 107 | Ga0207678_10018163 | 3300026067 | Bacteria | 6177 |
| 108 | Ga0207702_10058889 | 3300026078 | Bacteria | 3270 |
| 109 | Ga0207674_10014986 | 3300026116 | Bacteria | 8539 |
| 110 | Ga0207675_100187620 | 3300026118 | Bacteria | 1982 |
| 111 | Ga0207683_10015105 | 3300026121 | Bacteria | 6570 |
| 112 | Ga0209813_10002304 | 3300027866 | Bacteria | 4369 |
| 113 | Ga0207428_10003628 | 3300027907 | Bacteria | 14881 |
| 114 | Ga0268264_10095135 | 3300028381 | Bacteria | 2577 |
| 115 | Ga0307517_10002122 | 3300028786 | Bacteria | 32257 |
| 116 | Ga0307515_10000699 | 3300028794 | Bacteria | 77489 |
| 117 | Ga0307515_10134672 | 3300028794 | Bacteria | 2695 |
| 118 | Ga0265338_10005540 | 3300028800 | Bacteria | 16435 |
| 119 | Ga0307511_10000438 | 3300030521 | Bacteria | 44529 |
| 120 | Ga0307512_10004491 | 3300030522 | Bacteria | 15270 |
| 121 | Ga0307512_10109664 | 3300030522 | Bacteria | 1825 |
| 122 | Ga0307513_10022259 | 3300031456 | Bacteria | 7455 |
| 123 | Ga0307509_10040112 | 3300031507 | Bacteria | 5094 |
| 124 | Ga0307509_10043047 | 3300031507 | Bacteria | 4888 |
| 125 | Ga0307508_10001866 | 3300031616 | Bacteria | 23226 |
| 126 | Ga0307508_10011031 | 3300031616 | Bacteria | 8260 |
| 127 | Ga0307508_10168181 | 3300031616 | Bacteria | 1796 |
| 128 | Ga0307516_10009907 | 3300031730 | Bacteria | 10563 |
| 129 | Ga0307413_10057042 | 3300031824 | Bacteria | 2386 |
| 130 | Ga0307406_10033405 | 3300031901 | Bacteria | 3149 |
| 131 | Ga0307416_100126516 | 3300032002 | Bacteria | 2290 |
| 132 | Ga0307416_100131502 | 3300032002 | Bacteria | 2254 |
| 133 | Ga0307507_10015409 | 3300033179 | Bacteria | 8994 |
| 134 | Ga0307507_10024202 | 3300033179 | Bacteria | 6628 |
| 135 | Ga0307510_10024814 | 3300033180 | Bacteria | 6922 |
| 136 | Ga0307510_10049467 | 3300033180 | Bacteria | 4470 |
| 137 | Ga0373926_0004029 | 3300035083 | Bacteria | 4794 |
| 138 | Ga0373929_0005906 | 3300035085 | Bacteria | 2211 |
| 139 | Ga0373934_0014406 | 3300035086 | Bacteria | 2996 |
| 140 | Ga0373934_0018960 | 3300035086 | Bacteria | 2636 |
| 141 | Ga0373923_0000930 | 3300035111 | Bacteria | 7836 |
| 142 | Ga0373923_0025652 | 3300035111 | Bacteria | 2338 |
| 143 | Ga0373936_0005701 | 3300035113 | Bacteria | 4698 |
| 144 | Ga0373936_0028547 | 3300035113 | Bacteria | 2193 |
| 145 | Ga0373945_0011156 | 3300035116 | Bacteria | 2966 |
| 146 | Ga0373953_0000273 | 3300035117 | Bacteria | 14158 |
| 147 | Ga0373953_0018153 | 3300035117 | Bacteria | 2598 |
| 148 | Ga0373954_0000481 | 3300035118 | Bacteria | 14980 |
| 149 | Ga0373954_0026941 | 3300035118 | Bacteria | 2636 |
| 150 | Ga0373956_0025337 | 3300035119 | Bacteria | 2562 |
| 151 | Ga0373957_0006049 | 3300035120 | Bacteria | 3790 |
| 152 | Ga0373943_0005455 | 3300035170 | Bacteria | 5722 |
| 153 | Ga0373946_0000550 | 3300035171 | Bacteria | 12421 |
| 154 | Ga0373955_0040965 | 3300035172 | Bacteria | 2480 |
| 155 | Ga0373942_0005618 | 3300035207 | Bacteria | 2908 |
| 156 | Ga0373931_0022531 | 3300035691 | Bacteria | 3171 |
| 157 | Ga0373935_0005456 | 3300035692 | Bacteria | 7491 |
| 158 | Ga0373947_0002598 | 3300035725 | Bacteria | 10839 |
| 159 | Ga0373937_0058174 | 3300036401 | Bacteria | 3551 |
| 160 | Ga0373925_0004936 | 3300037068 | Bacteria | 10029 |
| 161 | Ga0373925_0012568 | 3300037068 | Bacteria | 6134 |
| 162 | Ga0395899_0004522 | 3300037312 | Bacteria | 10843 |
| 163 | Ga0395900_0021506 | 3300037418 | Bacteria | 6597 |
| 164 | Ga0395898_0006384 | 3300037466 | Bacteria | 12598 |
| 165 | Ga0395898_0065292 | 3300037466 | Bacteria | 3528 |
| 166 | Ga0395898_0081480 | 3300037466 | Bacteria | 3120 |
| 167 | Ga0395898_0091186 | 3300037466 | Bacteria | 2932 |
| 168 | Ga0395905_0027554 | 3300037471 | Bacteria | 5358 |
| 169 | Ga0436364_0455118 | 3300037853 | Bacteria | 2510 |
| 170 | Ga0436364_0499456 | 3300037853 | Bacteria | 6120 |
| 171 | Ga0395901_0009408 | 3300038443 | Bacteria | 9915 |
| 172 | Ga0395901_0047062 | 3300038443 | Bacteria | 4480 |
| 173 | Ga0395901_0061871 | 3300038443 | Bacteria | 3895 |
| 174 | Ga0395901_0196114 | 3300038443 | Bacteria | 2117 |
| 175 | Ga0395901_0294520 | 3300038443 | Bacteria | 1683 |
| 176 | Ga0436365_1215810 | 3300039437 | Bacteria | 13407 |
| 177 | Ga0436365_1569498 | 3300039437 | Bacteria | 7296 |
| 178 | Ga0436361_0362363 | 3300039447 | Bacteria | 2945 |
| 179 | Ga0436361_0931496 | 3300039447 | Bacteria | 14440 |
| 180 | Ga0436363_0089430 | 3300039450 | Bacteria | 7493 |
| 181 | Ga0436363_0837216 | 3300039450 | Bacteria | 2773 |
| 182 | Ga0436363_0931830 | 3300039450 | Bacteria | 42017 |
| 183 | Ga0436363_1004894 | 3300039450 | Bacteria | 14280 |
| 184 | Ga0436362_0088640 | 3300039453 | Bacteria | 10868 |
| 185 | Ga0439436_0012369 | 3300041404 | Bacteria | 2591 |
| 186 | Ga0439439_0011540 | 3300041406 | Bacteria | 2128 |
| 187 | Ga0451853_1669613 | 3300041512 | Bacteria | 2535 |
| 188 | Ga0451853_2445254 | 3300041512 | Bacteria | 3529 |
| 189 | Ga0439449_0003395 | 3300042007 | Bacteria | 6202 |
| 190 | Ga0439457_000096 | 3300042014 | Bacteria | 20343 |
| 191 | Ga0439457_000227 | 3300042014 | Bacteria | 15018 |
| 192 | Ga0450894_000044 | 3300042131 | Bacteria | 18520 |
| 193 | Ga0450903_000328 | 3300042138 | Bacteria | 10474 |
| 194 | Ga0450906_003098 | 3300042145 | Bacteria | 3599 |
| 195 | Ga0466969_0064011 | 3300044656 | Bacteria | 1781 |
| 196 | Ga0466972_0004538 | 3300044658 | Bacteria | 6954 |
| 197 | Ga0466972_0009735 | 3300044658 | Bacteria | 4824 |
| 198 | Ga0466972_0016149 | 3300044658 | Bacteria | 3732 |
| 199 | Ga0466972_0031961 | 3300044658 | Bacteria | 2586 |
| 200 | Ga0466965_0000566 | 3300044683 | Bacteria | 13393 |
| 201 | Ga0466966_0001405 | 3300044684 | Bacteria | 15491 |
| 202 | Ga0466966_0012382 | 3300044684 | Bacteria | 5652 |
| 203 | Ga0466966_0016667 | 3300044684 | Bacteria | 4853 |
| 204 | Ga0466966_0040076 | 3300044684 | Bacteria | 3014 |
| 205 | Ga0466961_0001027 | 3300044693 | Bacteria | 17242 |
| 206 | Ga0466961_0009050 | 3300044693 | Bacteria | 6350 |
| 207 | Ga0466961_0011484 | 3300044693 | Bacteria | 5664 |
| 208 | Ga0466963_0001259 | 3300044694 | Bacteria | 13417 |
| 209 | Ga0466963_0003744 | 3300044694 | Bacteria | 8757 |
| 210 | Ga0466971_0001303 | 3300044719 | Bacteria | 10417 |
| 211 | Ga0466971_0007423 | 3300044719 | Bacteria | 4774 |
| 212 | Ga0466971_0016647 | 3300044719 | Bacteria | 3248 |
| 213 | Ga0466970_0001620 | 3300044765 | Bacteria | 10842 |
| 214 | Ga0466970_0009740 | 3300044765 | Bacteria | 4863 |
| 215 | Ga0466970_0057829 | 3300044765 | Bacteria | 2074 |
| 216 | Ga0466957_0000445 | 3300044842 | Bacteria | 20385 |
| 217 | Ga0466959_0001189 | 3300045049 | Bacteria | 15706 |
| 218 | Ga0466959_0051766 | 3300045049 | Bacteria | 3009 |
| 219 | Ga0466958_0001212 | 3300045836 | Bacteria | 12056 |
| 220 | Ga0466958_0002791 | 3300045836 | Bacteria | 8885 |
| 221 | Ga0466958_0021504 | 3300045836 | Bacteria | 3772 |
| 222 | Ga0466967_0001978 | 3300045976 | Bacteria | 12436 |
| 223 | Ga0466967_0003250 | 3300045976 | Bacteria | 10522 |
| 224 | Ga0466967_0047717 | 3300045976 | Bacteria | 3735 |
| 225 | Ga0466967_0133694 | 3300045976 | Bacteria | 2305 |
| 226 | Ga0495592_0070261 | 3300046454 | Bacteria | 2551 |
| 227 | Ga0495592_0077037 | 3300046454 | Bacteria | 2418 |
| 228 | Ga0495603_0000055 | 3300046455 | Bacteria | 48787 |
| 229 | Ga0495603_0000850 | 3300046455 | Bacteria | 17499 |
| 230 | Ga0495603_0003850 | 3300046455 | Bacteria | 8938 |
| 231 | Ga0495603_0007602 | 3300046455 | Bacteria | 6521 |
| 232 | Ga0495603_0053276 | 3300046455 | Bacteria | 2400 |
| 233 | Ga0495629_0001320 | 3300046459 | Bacteria | 19491 |
| 234 | Ga0495629_0001340 | 3300046459 | Bacteria | 19372 |
| 235 | Ga0495629_0002039 | 3300046459 | Bacteria | 15693 |
| 236 | Ga0495629_0007249 | 3300046459 | Bacteria | 8167 |
| 237 | Ga0495629_0011903 | 3300046459 | Bacteria | 6308 |
| 238 | Ga0495629_0026307 | 3300046459 | Bacteria | 4134 |
| 239 | Ga0495638_0063751 | 3300046460 | Bacteria | 2271 |
| 240 | Ga0495651_0038168 | 3300046462 | Bacteria | 3740 |
| 241 | Ga0495651_0073613 | 3300046462 | Bacteria | 2592 |
| 242 | Ga0495651_0083084 | 3300046462 | Bacteria | 2415 |
| 243 | Ga0495653_0069575 | 3300046463 | Bacteria | 2636 |
| 244 | Ga0495653_0118035 | 3300046463 | Bacteria | 1895 |
| 245 | Ga0495582_0015447 | 3300046473 | Bacteria | 4193 |
| 246 | Ga0495605_0063442 | 3300046474 | Bacteria | 1762 |
| 247 | Ga0495639_0000683 | 3300046475 | Bacteria | 15585 |
| 248 | Ga0495662_0000647 | 3300046476 | Bacteria | 16321 |
| 249 | Ga0495662_0006794 | 3300046476 | Bacteria | 5693 |
| 250 | Ga0495662_0009390 | 3300046476 | Bacteria | 4798 |
| 251 | Ga0495662_0022257 | 3300046476 | Bacteria | 3062 |
| 252 | Ga0495664_0000922 | 3300046477 | Bacteria | 15150 |
| 253 | Ga0495664_0050774 | 3300046477 | Bacteria | 2462 |
| 254 | Ga0495594_0002696 | 3300046499 | Bacteria | 9220 |
| 255 | Ga0495594_0003561 | 3300046499 | Bacteria | 8013 |
| 256 | Ga0495594_0033611 | 3300046499 | Bacteria | 2789 |
| 257 | Ga0495606_0011392 | 3300046507 | Bacteria | 7257 |
| 258 | Ga0495610_0050260 | 3300046512 | Bacteria | 2036 |
| 259 | Ga0495616_0066786 | 3300046513 | Bacteria | 1749 |
| 260 | Ga0495618_0046969 | 3300046514 | Bacteria | 2725 |
| 261 | Ga0495618_0058822 | 3300046514 | Bacteria | 2435 |
| 262 | Ga0495628_0013478 | 3300046516 | Bacteria | 6877 |
| 263 | Ga0495628_0017622 | 3300046516 | Bacteria | 5938 |
| 264 | Ga0495628_0074137 | 3300046516 | Bacteria | 2651 |
| 265 | Ga0495628_0090076 | 3300046516 | Bacteria | 2375 |
| 266 | Ga0495630_0006156 | 3300046517 | Bacteria | 8508 |
| 267 | Ga0495630_0064187 | 3300046517 | Bacteria | 2759 |
| 268 | Ga0495630_0070565 | 3300046517 | Bacteria | 2628 |
| 269 | Ga0495631_0012544 | 3300046518 | Bacteria | 4135 |
| 270 | Ga0495666_0000827 | 3300046526 | Bacteria | 14282 |
| 271 | Ga0495642_0016890 | 3300046528 | Bacteria | 2848 |
| 272 | Ga0495652_0003299 | 3300046529 | Bacteria | 16057 |
| 273 | Ga0495652_0022352 | 3300046529 | Bacteria | 5611 |
| 274 | Ga0495652_0086234 | 3300046529 | Bacteria | 2578 |
| 275 | Ga0495652_0157453 | 3300046529 | Bacteria | 1767 |
| 276 | Ga0495654_0020479 | 3300046530 | Bacteria | 3446 |
| 277 | Ga0495665_0001206 | 3300046531 | Bacteria | 13786 |
| 278 | Ga0495665_0040004 | 3300046531 | Bacteria | 2497 |
| 279 | Ga0495640_0003536 | 3300046533 | Bacteria | 12561 |
| 280 | Ga0495645_0035589 | 3300046543 | Bacteria | 3629 |
| 281 | Ga0495645_0077631 | 3300046543 | Bacteria | 2387 |
| 282 | Ga0495633_0022477 | 3300046558 | Bacteria | 3137 |
| 283 | Ga0495667_0037648 | 3300046559 | Bacteria | 3223 |
| 284 | Ga0495667_0069123 | 3300046559 | Bacteria | 2305 |
| 285 | Ga0495668_0009995 | 3300046616 | Bacteria | 5777 |
| 286 | Ga0495634_0003936 | 3300046642 | Bacteria | 11787 |
| 287 | Ga0495634_0058624 | 3300046642 | Bacteria | 2565 |
| 288 | Ga0495611_0037758 | 3300046648 | Bacteria | 2147 |
| 289 | Ga0495625_0005273 | 3300046660 | Bacteria | 11867 |
| 290 | Ga0495635_0024275 | 3300046663 | Bacteria | 4226 |
| 291 | Ga0495635_0025826 | 3300046663 | Bacteria | 4091 |
| 292 | Ga0495635_0066228 | 3300046663 | Bacteria | 2477 |
| 293 | Ga0495661_0063325 | 3300046665 | Bacteria | 2186 |
| 294 | Ga0495588_0007574 | 3300046674 | Bacteria | 4949 |
| 295 | Ga0495588_0010585 | 3300046674 | Bacteria | 4295 |
| 296 | Ga0495588_0032075 | 3300046674 | Bacteria | 2647 |
| 297 | Ga0495657_0009922 | 3300046675 | Bacteria | 7185 |
| 298 | Ga0495657_0064249 | 3300046675 | Bacteria | 2418 |
| 299 | Ga0495657_0106777 | 3300046675 | Bacteria | 1777 |
| 300 | Ga0495599_0049407 | 3300046678 | Bacteria | 2636 |
| 301 | Ga0495599_0050020 | 3300046678 | Bacteria | 2619 |
| 302 | Ga0495623_0019201 | 3300046679 | Bacteria | 4418 |
| 303 | Ga0495623_0022170 | 3300046679 | Bacteria | 4102 |
| 304 | Ga0495623_0059461 | 3300046679 | Bacteria | 2400 |
| 305 | Ga0495623_0088456 | 3300046679 | Bacteria | 1906 |
| 306 | Ga0495646_0001220 | 3300046680 | Bacteria | 15076 |
| 307 | Ga0495646_0004593 | 3300046680 | Bacteria | 8704 |
| 308 | Ga0495646_0051886 | 3300046680 | Bacteria | 2480 |
| 309 | Ga0495647_0007117 | 3300046681 | Bacteria | 3737 |
| 310 | Ga0495658_0003983 | 3300046683 | Bacteria | 7278 |
| 311 | Ga0495613_0002320 | 3300046689 | Bacteria | 14418 |
| 312 | Ga0495613_0005048 | 3300046689 | Bacteria | 9900 |
| 313 | Ga0495613_0008818 | 3300046689 | Bacteria | 7479 |
| 314 | Ga0495613_0041563 | 3300046689 | Bacteria | 3404 |
| 315 | Ga0495613_0131042 | 3300046689 | Bacteria | 1795 |
| 316 | Ga0495624_0004619 | 3300046690 | Bacteria | 10036 |
| 317 | Ga0495649_0038321 | 3300046694 | Bacteria | 2630 |
| 318 | Ga0495589_0006599 | 3300046794 | Bacteria | 6114 |
| 319 | Ga0495589_0024134 | 3300046794 | Bacteria | 3091 |
| 320 | Ga0495600_0001908 | 3300046809 | Bacteria | 11711 |
| 321 | Ga0495600_0011862 | 3300046809 | Bacteria | 5442 |
| 322 | Ga0495600_0026692 | 3300046809 | Bacteria | 3728 |
| 323 | Ga0495600_0061406 | 3300046809 | Bacteria | 2454 |
| 324 | Ga0495600_0075426 | 3300046809 | Bacteria | 2202 |
| 325 | Ga0495581_0001150 | 3300047315 | Bacteria | 14471 |
| 326 | Ga0495581_0032945 | 3300047315 | Bacteria | 2999 |
| 327 | Ga0495581_0059919 | 3300047315 | Bacteria | 2200 |
| 328 | Ga0495581_0063066 | 3300047315 | Bacteria | 2141 |
| 329 | Ga0495604_0000141 | 3300047317 | Bacteria | 61811 |
| 330 | Ga0495604_0000946 | 3300047317 | Bacteria | 24219 |
| 331 | Ga0495604_0003620 | 3300047317 | Bacteria | 12321 |
| 332 | Ga0495604_0005936 | 3300047317 | Bacteria | 9686 |
| 333 | Ga0495604_0038275 | 3300047317 | Bacteria | 3773 |
| 334 | Ga0495604_0104801 | 3300047317 | Bacteria | 2071 |
| 335 | Ga0495674_0012139 | 3300047319 | Bacteria | 8118 |
| 336 | Ga0495674_0015389 | 3300047319 | Bacteria | 7152 |
| 337 | Ga0495674_0033987 | 3300047319 | Bacteria | 4613 |
| 338 | Ga0495676_0000192 | 3300047321 | Bacteria | 48607 |
| 339 | Ga0495676_0000913 | 3300047321 | Bacteria | 24709 |
| 340 | Ga0495676_0002484 | 3300047321 | Bacteria | 16405 |
| 341 | Ga0495676_0013360 | 3300047321 | Bacteria | 7376 |
| 342 | Ga0495676_0031418 | 3300047321 | Bacteria | 4491 |
| 343 | Ga0495680_0013287 | 3300047322 | Bacteria | 7191 |
| 344 | Ga0495680_0027228 | 3300047322 | Bacteria | 4699 |
| 345 | Ga0495680_0081189 | 3300047322 | Bacteria | 2448 |
| 346 | Ga0495683_0019121 | 3300047323 | Bacteria | 3535 |
| 347 | Ga0495683_0039048 | 3300047323 | Bacteria | 2400 |
| 348 | Ga0495683_0059486 | 3300047323 | Bacteria | 1895 |
| 349 | Ga0495687_001311 | 3300047443 | Bacteria | 23302 |
| 350 | Ga0495687_001496 | 3300047443 | Bacteria | 21346 |
| 351 | Ga0495675_0037865 | 3300047444 | Bacteria | 3071 |
| 352 | Ga0495675_0114450 | 3300047444 | Bacteria | 1682 |
| 353 | Ga0495685_003865 | 3300047447 | Bacteria | 4805 |
| 354 | Ga0495681_0001659 | 3300047470 | Bacteria | 16506 |
| 355 | Ga0495684_0001886 | 3300047471 | Bacteria | 16800 |
| 356 | Ga0495684_0071484 | 3300047471 | Bacteria | 2636 |
| 357 | Ga0495686_0011098 | 3300047472 | Bacteria | 6364 |
| 358 | Ga0495593_0001354 | 3300047673 | Bacteria | 14302 |
| 359 | Ga0495602_0086508 | 3300048088 | Bacteria | 2616 |
| 360 | Ga0495614_0007729 | 3300048089 | Bacteria | 4777 |
| 361 | Ga0495614_0016579 | 3300048089 | Bacteria | 3205 |
| 362 | Ga0495626_0025069 | 3300048091 | Bacteria | 2919 |
| 363 | Ga0496101_0089263 | 3300048904 | Bacteria | 2290 |
| 364 | Ga0496104_0077443 | 3300048907 | Bacteria | 3168 |
| 365 | Ga0496104_0132382 | 3300048907 | Bacteria | 2395 |
| 366 | Ga0496105_0004703 | 3300048908 | Bacteria | 10293 |
| 367 | Ga0496105_0066326 | 3300048908 | Bacteria | 2979 |
| 368 | Ga0496106_0108910 | 3300048909 | Bacteria | 2155 |
| 369 | Ga0496109_0159004 | 3300048912 | Bacteria | 2117 |
| 370 | Ga0496110_0042263 | 3300048913 | Bacteria | 3979 |
| 371 | Ga0496110_0156783 | 3300048913 | Bacteria | 2062 |
| 372 | Ga0496111_0019694 | 3300048914 | Bacteria | 4691 |
| 373 | Ga0496112_0020417 | 3300048915 | Bacteria | 6279 |
| 374 | Ga0496114_0032466 | 3300048917 | Bacteria | 4297 |
| 375 | Ga0496114_0052063 | 3300048917 | Bacteria | 3410 |
| 376 | Ga0496115_0103426 | 3300048918 | Bacteria | 2336 |
| 377 | Ga0496115_0110858 | 3300048918 | Bacteria | 2254 |
| 378 | Ga0496119_0011050 | 3300048922 | Bacteria | 7527 |
| 379 | Ga0496126_0002208 | 3300048929 | Bacteria | 26954 |
| 380 | Ga0495682_0028778 | 3300049460 | Bacteria | 2058 |
| 381 | Ga0501031_0002776 | 3300049568 | Bacteria | 11152 |
| 382 | Ga0501032_0072338 | 3300049569 | Bacteria | 2298 |
| 383 | Ga0501033_0000756 | 3300049570 | Bacteria | 29733 |
| 384 | Ga0501033_0004830 | 3300049570 | Bacteria | 10754 |
| 385 | Ga0501033_0010531 | 3300049570 | Bacteria | 7091 |
| 386 | Ga0501033_0016434 | 3300049570 | Bacteria | 5605 |
| 387 | Ga0501034_0002496 | 3300049571 | Bacteria | 22077 |
| 388 | Ga0501034_0009661 | 3300049571 | Bacteria | 10088 |
| 389 | Ga0501034_0010815 | 3300049571 | Bacteria | 9480 |
| 390 | Ga0501034_0159881 | 3300049571 | Bacteria | 2224 |
| 391 | Ga0501036_0001066 | 3300049572 | Bacteria | 20756 |
| 392 | Ga0501036_0003255 | 3300049572 | Bacteria | 12949 |
| 393 | Ga0501036_0021234 | 3300049572 | Bacteria | 5454 |
| 394 | Ga0501036_0039597 | 3300049572 | Bacteria | 3988 |
| 395 | Ga0501037_0000553 | 3300049573 | Bacteria | 29785 |
| 396 | Ga0501037_0002555 | 3300049573 | Bacteria | 13157 |
| 397 | Ga0501037_0031552 | 3300049573 | Bacteria | 3912 |
| 398 | Ga0501038_0001453 | 3300049574 | Bacteria | 21771 |
| 399 | Ga0501038_0002636 | 3300049574 | Bacteria | 16776 |
| 400 | Ga0501038_0021157 | 3300049574 | Bacteria | 5843 |
| 401 | Ga0501038_0079787 | 3300049574 | Bacteria | 2759 |
| 402 | Ga0501038_0116633 | 3300049574 | Bacteria | 2206 |
| 403 | Ga0501038_0184395 | 3300049574 | Bacteria | 1682 |
| 404 | Ga0501039_0022397 | 3300049575 | Bacteria | 4850 |
| 405 | Ga0501041_0014192 | 3300049577 | Bacteria | 4729 |
| 406 | Ga0501042_0027970 | 3300049578 | Bacteria | 3968 |
| 407 | Ga0501043_0001506 | 3300049579 | Bacteria | 20343 |
| 408 | Ga0501043_0020853 | 3300049579 | Bacteria | 5140 |
| 409 | Ga0501046_0002619 | 3300049580 | Bacteria | 16807 |
| 410 | Ga0501046_0026575 | 3300049580 | Bacteria | 4727 |
| 411 | Ga0501047_0000964 | 3300049581 | Bacteria | 29099 |
| 412 | Ga0501047_0001549 | 3300049581 | Bacteria | 22497 |
| 413 | Ga0501047_0005936 | 3300049581 | Bacteria | 11484 |
| 414 | Ga0501047_0047880 | 3300049581 | Bacteria | 4130 |
| 415 | Ga0501047_0062171 | 3300049581 | Bacteria | 3602 |
| 416 | Ga0501048_0002110 | 3300049582 | Bacteria | 15156 |
| 417 | Ga0501067_0012775 | 3300049583 | Bacteria | 4652 |
| 418 | Ga0501067_0022741 | 3300049583 | Bacteria | 3469 |
| 419 | Ga0501068_0002541 | 3300049584 | Bacteria | 9687 |
| 420 | Ga0501070_0001890 | 3300049586 | Bacteria | 18511 |
| 421 | Ga0501071_0000948 | 3300049587 | Bacteria | 15776 |
| 422 | Ga0501072_0000511 | 3300049588 | Bacteria | 27865 |
| 423 | Ga0501072_0007477 | 3300049588 | Bacteria | 8290 |
| 424 | Ga0501073_0014292 | 3300049589 | Bacteria | 5766 |
| 425 | Ga0501074_0001957 | 3300049590 | Bacteria | 14168 |
| 426 | Ga0501074_0004233 | 3300049590 | Bacteria | 10241 |
| 427 | Ga0501074_0005247 | 3300049590 | Bacteria | 9321 |
| 428 | Ga0501076_0004537 | 3300049592 | Bacteria | 9893 |
| 429 | Ga0501079_0001551 | 3300049741 | Bacteria | 16278 |
| 430 | Ga0501079_0106640 | 3300049741 | Bacteria | 2174 |
| 431 | Ga0501080_0017078 | 3300049742 | Bacteria | 6702 |
| 432 | Ga0501080_0020590 | 3300049742 | Bacteria | 6108 |
| 433 | Ga0501083_0000503 | 3300049744 | Bacteria | 24974 |
| 434 | Ga0501035_0003520 | 3300049822 | Bacteria | 14966 |
| 435 | Ga0501035_0086971 | 3300049822 | Bacteria | 2754 |
| 436 | Ga0501044_0001273 | 3300049823 | Bacteria | 29785 |
| 437 | Ga0501044_0006283 | 3300049823 | Bacteria | 13129 |
| 438 | Ga0501044_0042826 | 3300049823 | Bacteria | 4707 |
| 439 | Ga0501044_0072131 | 3300049823 | Bacteria | 3511 |
| 440 | Ga0501044_0077297 | 3300049823 | Bacteria | 3376 |
| 441 | Ga0501044_0115347 | 3300049823 | Bacteria | 2691 |
| 442 | nmdc:mga03n38_9299_c1 | 3300050490 | Bacteria | 3568 |
| 443 | nmdc:mga06z11_6884_c1 | 3300050494 | Bacteria | 4651 |
| 444 | nmdc:mga04h51_2502_c1 | 3300050495 | Bacteria | 4369 |
| 445 | nmdc:mga08y16_47884_c1 | 3300050511 | Bacteria | 4475 |
| 446 | nmdc:mga0n895_20202_c1 | 3300050512 | Bacteria | 6207 |
| 447 | nmdc:mga0a205_5028_c1 | 3300050515 | Bacteria | 11911 |
| 448 | nmdc:mga0a205_5170_c1 | 3300050515 | Bacteria | 11733 |
| 449 | Ga0495601_0001464 | 3300053077 | Bacteria | 13008 |
| 450 | Ga0495595_0022893 | 3300053084 | Bacteria | 2747 |
| 451 | Ga0495619_0006734 | 3300053085 | Bacteria | 7269 |
| 452 | Ga0500560_000162 | 3300053107 | Bacteria | 7600 |
| 453 | Ga0500560_003860 | 3300053107 | Bacteria | 3099 |
| 454 | Ga0500573_0013538 | 3300053140 | Bacteria | 4600 |
| 455 | Ga0500616_0000985 | 3300053153 | Bacteria | 30767 |
| 456 | Ga0501084_0004469 | 3300054114 | Bacteria | 11418 |
| 457 | Ga0501082_0004283 | 3300060353 | Bacteria | 12479 |
| 458 | Ga0466962_0010310 | 3300061719 | Bacteria | 4488 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0047062 | Ga0395901_0047062_2003_3352 | 377 |
| 2 | 3300021361 | Ga0213872_10007945 | Ga0213872_100079456 | 404 |
| 3 | 3300025918 | Ga0207662_10019146 | Ga0207662_100191463 | 406 |
| 4 | 3300005365 | Ga0070688_100063709 | Ga0070688_1000637091 | 409 |
| 5 | 3300005981 | Ga0081538_10013180 | Ga0081538_100131807 | 409 |
| 6 | 3300005343 | Ga0070687_100016953 | Ga0070687_1000169532 | 410 |
| 7 | 3300021377 | Ga0213874_10000559 | Ga0213874_100005594 | 410 |
| 8 | 3300039450 | Ga0436363_0931830 | Ga0436363_0931830_27516_29156 | 410 |
| 9 | 3300005327 | Ga0070658_10030822 | Ga0070658_100308223 | 411 |
| 10 | 3300005329 | Ga0070683_100048161 | Ga0070683_1000481613 | 411 |
| 11 | 3300005336 | Ga0070680_100035954 | Ga0070680_1000359541 | 411 |
| 12 | 3300005347 | Ga0070668_100159801 | Ga0070668_1001598011 | 411 |
| 13 | 3300005367 | Ga0070667_100168906 | Ga0070667_1001689062 | 411 |
| 14 | 3300005444 | Ga0070694_100066955 | Ga0070694_1000669552 | 411 |
| 15 | 3300005455 | Ga0070663_100022215 | Ga0070663_1000222152 | 411 |
| 16 | 3300005457 | Ga0070662_100082933 | Ga0070662_1000829332 | 411 |
| 17 | 3300005466 | Ga0070685_10055939 | Ga0070685_100559392 | 411 |
| 18 | 3300005530 | Ga0070679_100116986 | Ga0070679_1001169862 | 411 |
| 19 | 3300005535 | Ga0070684_100040580 | Ga0070684_1000405803 | 411 |
| 20 | 3300005539 | Ga0068853_100019858 | Ga0068853_1000198586 | 411 |
| 21 | 3300005546 | Ga0070696_100035241 | Ga0070696_1000352413 | 411 |
| 22 | 3300005563 | Ga0068855_100169730 | Ga0068855_1001697302 | 411 |
| 23 | 3300005564 | Ga0070664_100016550 | Ga0070664_1000165502 | 411 |
| 24 | 3300005615 | Ga0070702_100034681 | Ga0070702_1000346812 | 411 |
| 25 | 3300005617 | Ga0068859_100048153 | Ga0068859_1000481532 | 411 |
| 26 | 3300005841 | Ga0068863_100044396 | Ga0068863_1000443963 | 411 |
| 27 | 3300006931 | Ga0097620_100048153 | Ga0097620_1000481532 | 411 |
| 28 | 3300009011 | Ga0105251_10017136 | Ga0105251_100171363 | 411 |
| 29 | 3300009148 | Ga0105243_10056759 | Ga0105243_100567592 | 411 |
| 30 | 3300009551 | Ga0105238_10074742 | Ga0105238_100747422 | 411 |
| 31 | 3300020069 | Ga0197907_10498473 | Ga0197907_104984732 | 411 |
| 32 | 3300020081 | Ga0206354_10145188 | Ga0206354_101451882 | 411 |
| 33 | 3300025901 | Ga0207688_10003662 | Ga0207688_100036628 | 411 |
| 34 | 3300025905 | Ga0207685_10001899 | Ga0207685_100018993 | 411 |
| 35 | 3300025906 | Ga0207699_10002717 | Ga0207699_100027176 | 411 |
| 36 | 3300025928 | Ga0207700_10007865 | Ga0207700_100078653 | 411 |
| 37 | 3300025933 | Ga0207706_10056157 | Ga0207706_100561572 | 411 |
| 38 | 3300026067 | Ga0207678_10018163 | Ga0207678_100181633 | 411 |
| 39 | 3300026078 | Ga0207702_10058889 | Ga0207702_100588892 | 411 |
| 40 | 3300026116 | Ga0207674_10014986 | Ga0207674_100149866 | 411 |
| 41 | 3300026118 | Ga0207675_100187620 | Ga0207675_1001876202 | 411 |
| 42 | 3300026121 | Ga0207683_10015105 | Ga0207683_100151051 | 411 |
| 43 | 3300028381 | Ga0268264_10095135 | Ga0268264_100951352 | 411 |
| 44 | 3300035085 | Ga0373929_0005906 | Ga0373929_0005906_284_1933 | 411 |
| 45 | 3300035207 | Ga0373942_0005618 | Ga0373942_0005618_985_2634 | 411 |
| 46 | 3300035691 | Ga0373931_0022531 | Ga0373931_0022531_1103_2752 | 411 |
| 47 | 3300048904 | Ga0496101_0089263 | Ga0496101_0089263_185_1834 | 411 |
| 48 | 3300048907 | Ga0496104_0077443 | Ga0496104_0077443_316_1965 | 411 |
| 49 | 3300048908 | Ga0496105_0066326 | Ga0496105_0066326_304_1953 | 411 |
| 50 | 3300048913 | Ga0496110_0156783 | Ga0496110_0156783_293_1942 | 411 |
| 51 | 3300048914 | Ga0496111_0019694 | Ga0496111_0019694_2095_3744 | 411 |
| 52 | 3300048917 | Ga0496114_0052063 | Ga0496114_0052063_744_2393 | 411 |
| 53 | 3300048918 | Ga0496115_0110858 | Ga0496115_0110858_323_1972 | 411 |
| 54 | 3300049571 | Ga0501034_0159881 | Ga0501034_0159881_634_2190 | 411 |
| 55 | 3300044658 | Ga0466972_0004538 | Ga0466972_0004538_60_1640 | 415 |
| 56 | 3300048922 | Ga0496119_0011050 | Ga0496119_0011050_1276_2811 | 417 |
| 57 | 3300035113 | Ga0373936_0028547 | Ga0373936_0028547_11_1441 | 419 |
| 58 | 3300021361 | Ga0213872_10001035 | Ga0213872_100010352 | 422 |
| 59 | 3300039447 | Ga0436361_0362363 | Ga0436361_0362363_158_1699 | 422 |
| 60 | 3300039447 | Ga0436361_0931496 | Ga0436361_0931496_12844_14385 | 422 |
| 61 | 3300005435 | Ga0070714_100002170 | Ga0070714_10000217012 | 425 |
| 62 | 3300005436 | Ga0070713_100003769 | Ga0070713_1000037692 | 425 |
| 63 | 3300006028 | Ga0070717_10017610 | Ga0070717_100176102 | 425 |
| 64 | 3300025928 | Ga0207700_10002898 | Ga0207700_100028983 | 425 |
| 65 | 3300035083 | Ga0373926_0004029 | Ga0373926_0004029_1201_2850 | 426 |
| 66 | 3300035111 | Ga0373923_0000930 | Ga0373923_0000930_1194_2843 | 426 |
| 67 | 3300035113 | Ga0373936_0005701 | Ga0373936_0005701_745_2394 | 426 |
| 68 | 3300035116 | Ga0373945_0011156 | Ga0373945_0011156_823_2472 | 426 |
| 69 | 3300035170 | Ga0373943_0005455 | Ga0373943_0005455_1769_3418 | 426 |
| 70 | 3300035171 | Ga0373946_0000550 | Ga0373946_0000550_7028_8677 | 426 |
| 71 | 3300035692 | Ga0373935_0005456 | Ga0373935_0005456_2849_4498 | 426 |
| 72 | 3300035725 | Ga0373947_0002598 | Ga0373947_0002598_2305_3954 | 426 |
| 73 | 3300037068 | Ga0373925_0004936 | Ga0373925_0004936_1065_2714 | 426 |
| 74 | 3300045836 | Ga0466958_0021504 | Ga0466958_0021504_673_2262 | 426 |
| 75 | 3300046455 | Ga0495603_0007602 | Ga0495603_0007602_2568_4217 | 426 |
| 76 | 3300046459 | Ga0495629_0007249 | Ga0495629_0007249_2433_4082 | 426 |
| 77 | 3300046473 | Ga0495582_0015447 | Ga0495582_0015447_2305_3954 | 426 |
| 78 | 3300046475 | Ga0495639_0000683 | Ga0495639_0000683_3192_4841 | 426 |
| 79 | 3300046476 | Ga0495662_0009390 | Ga0495662_0009390_156_1805 | 426 |
| 80 | 3300046499 | Ga0495594_0033611 | Ga0495594_0033611_352_2001 | 426 |
| 81 | 3300046516 | Ga0495628_0017622 | Ga0495628_0017622_1973_3622 | 426 |
| 82 | 3300046526 | Ga0495666_0000827 | Ga0495666_0000827_5683_7332 | 426 |
| 83 | 3300046531 | Ga0495665_0001206 | Ga0495665_0001206_2994_4643 | 426 |
| 84 | 3300046533 | Ga0495640_0003536 | Ga0495640_0003536_8480_10129 | 426 |
| 85 | 3300046642 | Ga0495634_0003936 | Ga0495634_0003936_7834_9483 | 426 |
| 86 | 3300046678 | Ga0495599_0050020 | Ga0495599_0050020_938_2587 | 426 |
| 87 | 3300046679 | Ga0495623_0088456 | Ga0495623_0088456_115_1764 | 426 |
| 88 | 3300046680 | Ga0495646_0004593 | Ga0495646_0004593_4751_6400 | 426 |
| 89 | 3300046683 | Ga0495658_0003983 | Ga0495658_0003983_4975_6624 | 426 |
| 90 | 3300046689 | Ga0495613_0008818 | Ga0495613_0008818_3745_5394 | 426 |
| 91 | 3300046690 | Ga0495624_0004619 | Ga0495624_0004619_6283_7932 | 426 |
| 92 | 3300046809 | Ga0495600_0026692 | Ga0495600_0026692_746_2395 | 426 |
| 93 | 3300047315 | Ga0495581_0001150 | Ga0495581_0001150_938_2587 | 426 |
| 94 | 3300047319 | Ga0495674_0012139 | Ga0495674_0012139_4165_5814 | 426 |
| 95 | 3300047471 | Ga0495684_0001886 | Ga0495684_0001886_11535_13184 | 426 |
| 96 | 3300053077 | Ga0495601_0001464 | Ga0495601_0001464_1958_3607 | 426 |
| 97 | 3300053085 | Ga0495619_0006734 | Ga0495619_0006734_1400_3049 | 426 |
| 98 | 3300046681 | Ga0495647_0007117 | Ga0495647_0007117_16_1665 | 427 |
| 99 | 3300046516 | Ga0495628_0013478 | Ga0495628_0013478_2424_3977 | 428 |
| 100 | 3300005366 | Ga0070659_100053342 | Ga0070659_1000533423 | 429 |
| 101 | 3300049581 | Ga0501047_0001549 | Ga0501047_0001549_16926_18473 | 430 |
| 102 | 3300049583 | Ga0501067_0012775 | Ga0501067_0012775_1042_2589 | 430 |
| 103 | 3300049588 | Ga0501072_0007477 | Ga0501072_0007477_5246_6793 | 430 |
| 104 | 3300049741 | Ga0501079_0106640 | Ga0501079_0106640_594_2141 | 430 |
| 105 | 3300005983 | Ga0081540_1000607 | Ga0081540_100060729 | 434 |
| 106 | 3300021384 | Ga0213876_10013365 | Ga0213876_100133652 | 434 |
| 107 | 3300031824 | Ga0307413_10057042 | Ga0307413_100570422 | 434 |
| 108 | 3300032002 | Ga0307416_100131502 | Ga0307416_1001315023 | 434 |
| 109 | 3300039437 | Ga0436365_1569498 | Ga0436365_1569498_4347_5891 | 434 |
| 110 | 3300039450 | Ga0436363_0089430 | Ga0436363_0089430_2449_3990 | 434 |
| 111 | 3300039450 | Ga0436363_1004894 | Ga0436363_1004894_2495_4039 | 434 |
| 112 | 3300003214 | JGI25165J46597_1000016 | JGI25165J46597_1000016196 | 435 |
| 113 | 3300021377 | Ga0213874_10001953 | Ga0213874_100019532 | 435 |
| 114 | 3300025261 | Ga0209233_1000068 | Ga0209233_1000068198 | 435 |
| 115 | 3300044684 | Ga0466966_0040076 | Ga0466966_0040076_946_2484 | 435 |
| 116 | 3300044719 | Ga0466971_0007423 | Ga0466971_0007423_167_1705 | 435 |
| 117 | 3300044765 | Ga0466970_0009740 | Ga0466970_0009740_463_2001 | 435 |
| 118 | 3300044656 | Ga0466969_0064011 | Ga0466969_0064011_69_1688 | 436 |
| 119 | 3300044693 | Ga0466961_0011484 | Ga0466961_0011484_1901_3520 | 436 |
| 120 | 3300045049 | Ga0466959_0051766 | Ga0466959_0051766_844_2463 | 436 |
| 121 | 3300005983 | Ga0081540_1000665 | Ga0081540_10006656 | 437 |
| 122 | 3300049574 | Ga0501038_0079787 | Ga0501038_0079787_190_1779 | 437 |
| 123 | 3300049823 | Ga0501044_0115347 | Ga0501044_0115347_909_2498 | 437 |
| 124 | 3300005471 | Ga0070698_100005079 | Ga0070698_10000507914 | 438 |
| 125 | 3300005981 | Ga0081538_10000369 | Ga0081538_1000036918 | 438 |
| 126 | 3300006175 | Ga0070712_100031789 | Ga0070712_1000317892 | 438 |
| 127 | 3300025898 | Ga0207692_10005124 | Ga0207692_100051242 | 438 |
| 128 | 3300025915 | Ga0207693_10053812 | Ga0207693_100538121 | 438 |
| 129 | 3300025928 | Ga0207700_10009940 | Ga0207700_100099406 | 438 |
| 130 | 3300021384 | Ga0213876_10007469 | Ga0213876_100074693 | 439 |
| 131 | 3300036401 | Ga0373937_0058174 | Ga0373937_0058174_1540_3195 | 439 |
| 132 | 3300037853 | Ga0436364_0499456 | Ga0436364_0499456_3081_4625 | 439 |
| 133 | 3300039437 | Ga0436365_1215810 | Ga0436365_1215810_33_1577 | 439 |
| 134 | 3300039450 | Ga0436363_0837216 | Ga0436363_0837216_356_1900 | 439 |
| 135 | 3300039453 | Ga0436362_0088640 | Ga0436362_0088640_4784_6328 | 439 |
| 136 | 3300046462 | Ga0495651_0038168 | Ga0495651_0038168_1300_2955 | 439 |
| 137 | 3300046559 | Ga0495667_0037648 | Ga0495667_0037648_180_1835 | 439 |
| 138 | 3300047322 | Ga0495680_0027228 | Ga0495680_0027228_2393_4048 | 439 |
| 139 | 3300003373 | JGI25407J50210_10006427 | JGI25407J50210_100064272 | 441 |
| 140 | 3300005468 | Ga0070707_100069378 | Ga0070707_1000693782 | 441 |
| 141 | 3300005536 | Ga0070697_100003717 | Ga0070697_1000037175 | 441 |
| 142 | 3300005981 | Ga0081538_10035970 | Ga0081538_100359704 | 441 |
| 143 | 3300047317 | Ga0495604_0104801 | Ga0495604_0104801_133_1788 | 441 |
| 144 | iso_pu_bacteria | 2582581313 | 2585311198 | 441 |
| 145 | 3300045976 | Ga0466967_0133694 | Ga0466967_0133694_91_1737 | 446 |
| 146 | 3300005937 | Ga0081455_10035007 | Ga0081455_100350073 | 447 |
| 147 | 3300005985 | Ga0081539_10015242 | Ga0081539_100152424 | 447 |
| 148 | 3300045976 | Ga0466967_0047717 | Ga0466967_0047717_2009_3655 | 447 |
| 149 | 3300046455 | Ga0495603_0000055 | Ga0495603_0000055_35208_36836 | 447 |
| 150 | 3300046459 | Ga0495629_0001320 | Ga0495629_0001320_1404_3032 | 447 |
| 151 | 3300046499 | Ga0495594_0002696 | Ga0495594_0002696_3074_4702 | 447 |
| 152 | 3300046674 | Ga0495588_0010585 | Ga0495588_0010585_735_2363 | 447 |
| 153 | 3300047321 | Ga0495676_0000192 | Ga0495676_0000192_35028_36656 | 447 |
| 154 | 3300004800 | Ga0058861_10082260 | Ga0058861_100822602 | 449 |
| 155 | 3300005434 | Ga0070709_10065342 | Ga0070709_100653422 | 449 |
| 156 | 3300005985 | Ga0081539_10018975 | Ga0081539_100189752 | 449 |
| 157 | 3300006173 | Ga0070716_100086787 | Ga0070716_1000867872 | 449 |
| 158 | 3300006175 | Ga0070712_100082714 | Ga0070712_1000827142 | 449 |
| 159 | 3300006846 | Ga0075430_100007812 | Ga0075430_1000078124 | 449 |
| 160 | 3300006847 | Ga0075431_100033865 | Ga0075431_1000338656 | 449 |
| 161 | 3300006871 | Ga0075434_100018644 | Ga0075434_1000186444 | 449 |
| 162 | 3300009094 | Ga0111539_10004429 | Ga0111539_1000442912 | 449 |
| 163 | 3300013104 | Ga0157370_10012834 | Ga0157370_100128347 | 449 |
| 164 | 3300014497 | Ga0182008_10026478 | Ga0182008_100264783 | 449 |
| 165 | 3300020075 | Ga0206349_1237425 | Ga0206349_12374252 | 449 |
| 166 | 3300020082 | Ga0206353_11186864 | Ga0206353_111868644 | 449 |
| 167 | 3300025898 | Ga0207692_10035868 | Ga0207692_100358682 | 449 |
| 168 | 3300025909 | Ga0207705_10086079 | Ga0207705_100860792 | 449 |
| 169 | 3300025912 | Ga0207707_10010745 | Ga0207707_100107455 | 449 |
| 170 | 3300025915 | Ga0207693_10096946 | Ga0207693_100969463 | 449 |
| 171 | 3300025916 | Ga0207663_10056967 | Ga0207663_100569672 | 449 |
| 172 | 3300025921 | Ga0207652_10018993 | Ga0207652_100189933 | 449 |
| 173 | 3300025928 | Ga0207700_10085862 | Ga0207700_100858622 | 449 |
| 174 | 3300025929 | Ga0207664_10078705 | Ga0207664_100787052 | 449 |
| 175 | 3300025939 | Ga0207665_10075277 | Ga0207665_100752773 | 449 |
| 176 | 3300025944 | Ga0207661_10039477 | Ga0207661_100394772 | 449 |
| 177 | 3300027907 | Ga0207428_10003628 | Ga0207428_100036283 | 449 |
| 178 | 3300031901 | Ga0307406_10033405 | Ga0307406_100334054 | 449 |
| 179 | 3300037418 | Ga0395900_0021506 | Ga0395900_0021506_3101_4672 | 449 |
| 180 | 3300037466 | Ga0395898_0091186 | Ga0395898_0091186_389_1960 | 449 |
| 181 | 3300037471 | Ga0395905_0027554 | Ga0395905_0027554_937_2508 | 449 |
| 182 | 3300038443 | Ga0395901_0009408 | Ga0395901_0009408_3774_5345 | 449 |
| 183 | 3300038443 | Ga0395901_0294520 | Ga0395901_0294520_90_1658 | 449 |
| 184 | 3300048907 | Ga0496104_0132382 | Ga0496104_0132382_162_1811 | 449 |
| 185 | 3300048909 | Ga0496106_0108910 | Ga0496106_0108910_12_1661 | 449 |
| 186 | 3300048912 | Ga0496109_0159004 | Ga0496109_0159004_394_2040 | 449 |
| 187 | 3300048915 | Ga0496112_0020417 | Ga0496112_0020417_523_2172 | 449 |
| 188 | 3300048918 | Ga0496115_0103426 | Ga0496115_0103426_516_2165 | 449 |
| 189 | 3300050511 | nmdc:mga08y16_47884_c1 | nmdc:mga08y16_47884_c1_363_1934 | 449 |
| 190 | 3300050512 | nmdc:mga0n895_20202_c1 | nmdc:mga0n895_20202_c1_4604_6175 | 449 |
| 191 | 3300050515 | nmdc:mga0a205_5028_c1 | nmdc:mga0a205_5028_c1_4350_5921 | 449 |
| 192 | 3300050515 | nmdc:mga0a205_5170_c1 | nmdc:mga0a205_5170_c1_7770_9341 | 449 |
| 193 | 3300053153 | Ga0500616_0000985 | Ga0500616_0000985_14245_15903 | 449 |
| 194 | 3300032002 | Ga0307416_100126516 | Ga0307416_1001265161 | 450 |
| 195 | 3300049590 | Ga0501074_0005247 | Ga0501074_0005247_6749_8377 | 451 |
| 196 | 3300005518 | Ga0070699_100002283 | Ga0070699_10000228310 | 454 |
| 197 | 3300048908 | Ga0496105_0004703 | Ga0496105_0004703_8261_9943 | 454 |
| 198 | 3300048929 | Ga0496126_0002208 | Ga0496126_0002208_19490_21130 | 454 |
| 199 | 3300028800 | Ga0265338_10005540 | Ga0265338_100055407 | 456 |
| 200 | 3300049574 | Ga0501038_0184395 | Ga0501038_0184395_128_1672 | 457 |
| 201 | 3300035086 | Ga0373934_0018960 | Ga0373934_0018960_862_2502 | 458 |
| 202 | 3300035111 | Ga0373923_0025652 | Ga0373923_0025652_128_1768 | 458 |
| 203 | 3300035117 | Ga0373953_0018153 | Ga0373953_0018153_824_2464 | 458 |
| 204 | 3300035118 | Ga0373954_0026941 | Ga0373954_0026941_862_2502 | 458 |
| 205 | 3300035120 | Ga0373957_0006049 | Ga0373957_0006049_439_2079 | 458 |
| 206 | 3300035172 | Ga0373955_0040965 | Ga0373955_0040965_134_1774 | 458 |
| 207 | 3300046454 | Ga0495592_0070261 | Ga0495592_0070261_796_2436 | 458 |
| 208 | 3300046462 | Ga0495651_0073613 | Ga0495651_0073613_91_1731 | 458 |
| 209 | 3300046463 | Ga0495653_0069575 | Ga0495653_0069575_862_2502 | 458 |
| 210 | 3300046477 | Ga0495664_0050774 | Ga0495664_0050774_107_1747 | 458 |
| 211 | 3300046514 | Ga0495618_0058822 | Ga0495618_0058822_666_2306 | 458 |
| 212 | 3300046516 | Ga0495628_0074137 | Ga0495628_0074137_666_2306 | 458 |
| 213 | 3300046517 | Ga0495630_0070565 | Ga0495630_0070565_862_2502 | 458 |
| 214 | 3300046529 | Ga0495652_0086234 | Ga0495652_0086234_110_1750 | 458 |
| 215 | 3300046531 | Ga0495665_0040004 | Ga0495665_0040004_734_2374 | 458 |
| 216 | 3300046543 | Ga0495645_0035589 | Ga0495645_0035589_1855_3495 | 458 |
| 217 | 3300046559 | Ga0495667_0069123 | Ga0495667_0069123_127_1767 | 458 |
| 218 | 3300046642 | Ga0495634_0058624 | Ga0495634_0058624_43_1683 | 458 |
| 219 | 3300046663 | Ga0495635_0066228 | Ga0495635_0066228_134_1774 | 458 |
| 220 | 3300046678 | Ga0495599_0049407 | Ga0495599_0049407_862_2502 | 458 |
| 221 | 3300046680 | Ga0495646_0051886 | Ga0495646_0051886_714_2354 | 458 |
| 222 | 3300046809 | Ga0495600_0061406 | Ga0495600_0061406_691_2331 | 458 |
| 223 | 3300047315 | Ga0495581_0059919 | Ga0495581_0059919_52_1692 | 458 |
| 224 | 3300047317 | Ga0495604_0038275 | Ga0495604_0038275_132_1772 | 458 |
| 225 | 3300047319 | Ga0495674_0033987 | Ga0495674_0033987_1009_2649 | 458 |
| 226 | 3300047322 | Ga0495680_0081189 | Ga0495680_0081189_85_1725 | 458 |
| 227 | 3300047444 | Ga0495675_0037865 | Ga0495675_0037865_135_1775 | 458 |
| 228 | 3300047471 | Ga0495684_0071484 | Ga0495684_0071484_862_2502 | 458 |
| 229 | 3300048088 | Ga0495602_0086508 | Ga0495602_0086508_846_2486 | 458 |
| 230 | 3300035118 | Ga0373954_0000481 | Ga0373954_0000481_12946_14592 | 459 |
| 231 | 3300047317 | Ga0495604_0000141 | Ga0495604_0000141_59777_61423 | 459 |
| 232 | 3300035117 | Ga0373953_0000273 | Ga0373953_0000273_10260_11906 | 460 |
| 233 | 3300035119 | Ga0373956_0025337 | Ga0373956_0025337_207_1853 | 460 |
| 234 | 3300046454 | Ga0495592_0077037 | Ga0495592_0077037_755_2401 | 460 |
| 235 | 3300046675 | Ga0495657_0064249 | Ga0495657_0064249_755_2401 | 460 |
| 236 | 3300046809 | Ga0495600_0075426 | Ga0495600_0075426_191_1837 | 460 |
| 237 | 3300048913 | Ga0496110_0042263 | Ga0496110_0042263_2030_3688 | 460 |
| 238 | 3300053084 | Ga0495595_0022893 | Ga0495595_0022893_735_2381 | 460 |
| 239 | 3300005434 | Ga0070709_10039996 | Ga0070709_100399961 | 462 |
| 240 | 3300025929 | Ga0207664_10000754 | Ga0207664_100007549 | 462 |
| 241 | 3300046517 | Ga0495630_0064187 | Ga0495630_0064187_631_2280 | 462 |
| 242 | 3300047319 | Ga0495674_0015389 | Ga0495674_0015389_5458_7107 | 462 |
| 243 | 3300049570 | Ga0501033_0016434 | Ga0501033_0016434_3352_4962 | 463 |
| 244 | 3300049572 | Ga0501036_0021234 | Ga0501036_0021234_2382_3992 | 463 |
| 245 | 3300049574 | Ga0501038_0116633 | Ga0501038_0116633_505_2115 | 463 |
| 246 | 3300049579 | Ga0501043_0020853 | Ga0501043_0020853_88_1698 | 463 |
| 247 | 3300049586 | Ga0501070_0001890 | Ga0501070_0001890_2254_3864 | 463 |
| 248 | 3300044684 | Ga0466966_0016667 | Ga0466966_0016667_2318_3970 | 464 |
| 249 | 3300044693 | Ga0466961_0009050 | Ga0466961_0009050_265_1917 | 464 |
| 250 | 3300044719 | Ga0466971_0016647 | Ga0466971_0016647_824_2476 | 464 |
| 251 | 3300045049 | Ga0466959_0001189 | Ga0466959_0001189_5261_6913 | 464 |
| 252 | 3300045836 | Ga0466958_0002791 | Ga0466958_0002791_3895_5547 | 464 |
| 253 | 3300049571 | Ga0501034_0009661 | Ga0501034_0009661_4016_5635 | 464 |
| 254 | 3300049572 | Ga0501036_0001066 | Ga0501036_0001066_12390_14009 | 464 |
| 255 | 3300049573 | Ga0501037_0031552 | Ga0501037_0031552_777_2396 | 464 |
| 256 | 3300049574 | Ga0501038_0021157 | Ga0501038_0021157_2948_4567 | 464 |
| 257 | 3300049575 | Ga0501039_0022397 | Ga0501039_0022397_317_1936 | 464 |
| 258 | 3300049581 | Ga0501047_0005936 | Ga0501047_0005936_21_1640 | 464 |
| 259 | 3300049589 | Ga0501073_0014292 | Ga0501073_0014292_198_1817 | 464 |
| 260 | 3300049590 | Ga0501074_0001957 | Ga0501074_0001957_4234_5853 | 464 |
| 261 | 3300049823 | Ga0501044_0077297 | Ga0501044_0077297_1481_3100 | 464 |
| 262 | iso_pu_bacteria | 2773857762 | 2774395220 | 464 |
| 263 | iso_pu_bacteria | 2808606439 | 2809193948 | 464 |
| 264 | iso_pu_bacteria | 2811994878 | 2812348688 | 464 |
| 265 | iso_pu_bacteria | 2891968417 | 2891973578 | 464 |
| 266 | iso_pu_bacteria | 8053945823 | 8053947842 | 464 |
| 267 | 3300025915 | Ga0207693_10053499 | Ga0207693_100534991 | 466 |
| 268 | 3300025912 | Ga0207707_10003601 | Ga0207707_1000360111 | 467 |
| 269 | iso_pu_bacteria | 2867369537 | 2867373725 | 467 |
| 270 | iso_pu_bacteria | 3002998708 | 3003005704 | 467 |
| 271 | iso_pu_bacteria | 2818991472 | 2819740736 | 468 |
| 272 | 3300028794 | Ga0307515_10134672 | Ga0307515_101346724 | 470 |
| 273 | 3300037312 | Ga0395899_0004522 | Ga0395899_0004522_1478_3133 | 470 |
| 274 | 3300049568 | Ga0501031_0002776 | Ga0501031_0002776_2008_3666 | 470 |
| 275 | 3300049570 | Ga0501033_0004830 | Ga0501033_0004830_7507_9165 | 470 |
| 276 | 3300049571 | Ga0501034_0002496 | Ga0501034_0002496_7487_9145 | 470 |
| 277 | 3300049572 | Ga0501036_0003255 | Ga0501036_0003255_3805_5463 | 470 |
| 278 | 3300049573 | Ga0501037_0000553 | Ga0501037_0000553_20641_22299 | 470 |
| 279 | 3300049574 | Ga0501038_0001453 | Ga0501038_0001453_7379_9037 | 470 |
| 280 | 3300049577 | Ga0501041_0014192 | Ga0501041_0014192_1617_3275 | 470 |
| 281 | 3300049579 | Ga0501043_0001506 | Ga0501043_0001506_11199_12857 | 470 |
| 282 | 3300049580 | Ga0501046_0002619 | Ga0501046_0002619_9322_10980 | 470 |
| 283 | 3300049581 | Ga0501047_0000964 | Ga0501047_0000964_6682_8340 | 470 |
| 284 | 3300049582 | Ga0501048_0002110 | Ga0501048_0002110_6012_7670 | 470 |
| 285 | 3300049583 | Ga0501067_0022741 | Ga0501067_0022741_1590_3248 | 470 |
| 286 | 3300049584 | Ga0501068_0002541 | Ga0501068_0002541_1590_3248 | 470 |
| 287 | 3300049587 | Ga0501071_0000948 | Ga0501071_0000948_11893_13551 | 470 |
| 288 | 3300049588 | Ga0501072_0000511 | Ga0501072_0000511_18544_20202 | 470 |
| 289 | 3300049590 | Ga0501074_0004233 | Ga0501074_0004233_1590_3248 | 470 |
| 290 | 3300049592 | Ga0501076_0004537 | Ga0501076_0004537_495_2153 | 470 |
| 291 | 3300049741 | Ga0501079_0001551 | Ga0501079_0001551_5645_7303 | 470 |
| 292 | 3300049742 | Ga0501080_0017078 | Ga0501080_0017078_3038_4696 | 470 |
| 293 | 3300049744 | Ga0501083_0000503 | Ga0501083_0000503_15683_17341 | 470 |
| 294 | 3300049822 | Ga0501035_0003520 | Ga0501035_0003520_5822_7480 | 470 |
| 295 | 3300049823 | Ga0501044_0001273 | Ga0501044_0001273_7487_9145 | 470 |
| 296 | 3300054114 | Ga0501084_0004469 | Ga0501084_0004469_7515_9173 | 470 |
| 297 | 3300060353 | Ga0501082_0004283 | Ga0501082_0004283_4971_6629 | 470 |
| 298 | iso_pu_bacteria | 2816332119 | 2816426973 | 470 |
| 299 | 3300046476 | Ga0495662_0022257 | Ga0495662_0022257_57_1682 | 471 |
| 300 | 3300046674 | Ga0495588_0032075 | Ga0495588_0032075_181_1797 | 471 |
| 301 | iso_pu_bacteria | 2547132111 | 2547408518 | 471 |
| 302 | iso_pu_bacteria | 2784132148 | 2784590275 | 471 |
| 303 | iso_pu_bacteria | 2808606448 | 2809233949 | 471 |
| 304 | iso_pu_bacteria | 2852635781 | 2852640869 | 471 |
| 305 | iso_pu_bacteria | 2862382967 | 2862383433 | 471 |
| 306 | iso_pu_bacteria | 2919468124 | 2919471580 | 471 |
| 307 | iso_pu_bacteria | 2990088156 | 2990088621 | 471 |
| 308 | iso_pu_bacteria | 3006493962 | 3006498118 | 471 |
| 309 | iso_pu_bacteria | 8023623736 | 8023627941 | 471 |
| 310 | 3300025297 | Ga0209758_1002959 | Ga0209758_100295915 | 472 |
| 311 | 3300046529 | Ga0495652_0157453 | Ga0495652_0157453_105_1754 | 472 |
| 312 | 3300046679 | Ga0495623_0022170 | Ga0495623_0022170_1934_3562 | 472 |
| 313 | 3300047317 | Ga0495604_0005936 | Ga0495604_0005936_6767_8395 | 472 |
| 314 | iso_pu_bacteria | 2582581314 | 2585318615 | 472 |
| 315 | iso_pu_bacteria | 2643221587 | 2643945523 | 472 |
| 316 | iso_pu_bacteria | 2643221677 | 2644431186 | 472 |
| 317 | iso_pu_bacteria | 2918501144 | 2918506346 | 472 |
| 318 | iso_pu_bacteria | 8025478263 | 8025482569 | 472 |
| 319 | iso_pu_bacteria | 8056447290 | 8056447745 | 472 |
| 320 | 3300017792 | Ga0163161_10081091 | Ga0163161_100810912 | 473 |
| 321 | 3300037853 | Ga0436364_0455118 | Ga0436364_0455118_865_2493 | 473 |
| 322 | 3300041512 | Ga0451853_1669613 | Ga0451853_1669613_450_2099 | 473 |
| 323 | 3300047317 | Ga0495604_0003620 | Ga0495604_0003620_6233_7879 | 473 |
| 324 | 3300048917 | Ga0496114_0032466 | Ga0496114_0032466_2375_4024 | 473 |
| 325 | iso_pu_bacteria | 2554235005 | 2554256347 | 473 |
| 326 | 3300035086 | Ga0373934_0014406 | Ga0373934_0014406_759_2405 | 474 |
| 327 | 3300037068 | Ga0373925_0012568 | Ga0373925_0012568_180_1829 | 474 |
| 328 | 3300037466 | Ga0395898_0081480 | Ga0395898_0081480_1408_3084 | 474 |
| 329 | 3300038443 | Ga0395901_0061871 | Ga0395901_0061871_40_1716 | 474 |
| 330 | 3300046462 | Ga0495651_0083084 | Ga0495651_0083084_752_2398 | 474 |
| 331 | 3300046543 | Ga0495645_0077631 | Ga0495645_0077631_456_2105 | 474 |
| 332 | 3300046679 | Ga0495623_0019201 | Ga0495623_0019201_735_2381 | 474 |
| 333 | 3300049578 | Ga0501042_0027970 | Ga0501042_0027970_1087_2682 | 474 |
| 334 | iso_pu_bacteria | 2643221678 | 2644439892 | 474 |
| 335 | iso_pu_bacteria | 2643221714 | 2644632777 | 474 |
| 336 | iso_pu_bacteria | 2791355406 | 2793975242 | 474 |
| 337 | iso_pu_bacteria | 2808606359 | 2808843899 | 474 |
| 338 | iso_pu_bacteria | 2808606982 | 2811844561 | 474 |
| 339 | iso_pu_bacteria | 2862178590 | 2862179110 | 474 |
| 340 | iso_pu_bacteria | 2990059506 | 2990064519 | 474 |
| 341 | iso_pu_bacteria | 8047893842 | 8047896269 | 474 |
| 342 | iso_pu_bacteria | 8048356638 | 8048362667 | 474 |
| 343 | iso_pu_bacteria | 8048369669 | 8048373278 | 474 |
| 344 | iso_pu_bacteria | 8048379754 | 8048384964 | 474 |
| 345 | iso_pu_bacteria | 8056667051 | 8056671508 | 474 |
| 346 | 3300006028 | Ga0070717_10070278 | Ga0070717_100702783 | 475 |
| 347 | 3300053107 | Ga0500560_003860 | Ga0500560_003860_565_2196 | 475 |
| 348 | 3300053140 | Ga0500573_0013538 | Ga0500573_0013538_693_2324 | 475 |
| 349 | iso_pu_bacteria | 2582581312 | 2585296461 | 475 |
| 350 | iso_pu_bacteria | 2616644814 | 2616697163 | 475 |
| 351 | iso_pu_bacteria | 2616644941 | 2616900050 | 475 |
| 352 | iso_pu_bacteria | 2643221548 | 2643763865 | 475 |
| 353 | iso_pu_bacteria | 2643221647 | 2644265947 | 475 |
| 354 | iso_pu_bacteria | 2643221670 | 2644386761 | 475 |
| 355 | iso_pu_bacteria | 2643221682 | 2644461701 | 475 |
| 356 | iso_pu_bacteria | 2784746763 | 2785341339 | 475 |
| 357 | iso_pu_bacteria | 2784746768 | 2785371342 | 475 |
| 358 | iso_pu_bacteria | 2786546132 | 2786672533 | 475 |
| 359 | iso_pu_bacteria | 2811994879 | 2812356131 | 475 |
| 360 | iso_pu_bacteria | 2811994917 | 2812478896 | 475 |
| 361 | iso_pu_bacteria | 2818991463 | 2819694750 | 475 |
| 362 | iso_pu_bacteria | 2862281513 | 2862285138 | 475 |
| 363 | iso_pu_bacteria | 2862507626 | 2862513345 | 475 |
| 364 | iso_pu_bacteria | 2862574272 | 2862577659 | 475 |
| 365 | iso_pu_bacteria | 2863404153 | 2863408471 | 475 |
| 366 | iso_pu_bacteria | 2867428634 | 2867435342 | 475 |
| 367 | iso_pu_bacteria | 2877676314 | 2877679256 | 475 |
| 368 | iso_pu_bacteria | 2912715099 | 2912717859 | 475 |
| 369 | iso_pu_bacteria | 2912723979 | 2912730288 | 475 |
| 370 | iso_pu_bacteria | 2946064051 | 2946069718 | 475 |
| 371 | iso_pu_bacteria | 2946072368 | 2946077607 | 475 |
| 372 | iso_pu_bacteria | 2947224130 | 2947227078 | 475 |
| 373 | iso_pu_bacteria | 2954002825 | 2954005319 | 475 |
| 374 | iso_pu_bacteria | 2954380949 | 2954384146 | 475 |
| 375 | iso_pu_bacteria | 2954673503 | 2954678805 | 475 |
| 376 | iso_pu_bacteria | 2954682443 | 2954685347 | 475 |
| 377 | iso_pu_bacteria | 2954691527 | 2954694969 | 475 |
| 378 | iso_pu_bacteria | 2954701450 | 2954710143 | 475 |
| 379 | iso_pu_bacteria | 2954711539 | 2954714462 | 475 |
| 380 | iso_pu_bacteria | 2954721474 | 2954724408 | 475 |
| 381 | iso_pu_bacteria | 2954731030 | 2954737410 | 475 |
| 382 | iso_pu_bacteria | 2954740390 | 2954743330 | 475 |
| 383 | iso_pu_bacteria | 2954749733 | 2954756264 | 475 |
| 384 | iso_pu_bacteria | 2954759201 | 2954762287 | 475 |
| 385 | iso_pu_bacteria | 2966598605 | 2966600984 | 475 |
| 386 | iso_pu_bacteria | 3006393351 | 3006393775 | 475 |
| 387 | iso_pu_bacteria | 8008558824 | 8008562642 | 475 |
| 388 | iso_pu_bacteria | 8008574985 | 8008577297 | 475 |
| 389 | iso_pu_bacteria | 8048127548 | 8048135076 | 475 |
| 390 | iso_pu_bacteria | 8048406513 | 8048406600 | 475 |
| 391 | iso_pu_bacteria | 8056829672 | 8056832014 | 475 |
| 392 | 3300031507 | Ga0307509_10040112 | Ga0307509_100401124 | 476 |
| 393 | 3300031616 | Ga0307508_10168181 | Ga0307508_101681811 | 476 |
| 394 | 3300033179 | Ga0307507_10024202 | Ga0307507_100242023 | 476 |
| 395 | 3300033180 | Ga0307510_10049467 | Ga0307510_100494671 | 476 |
| 396 | 3300046463 | Ga0495653_0118035 | Ga0495653_0118035_120_1721 | 476 |
| 397 | 3300046476 | Ga0495662_0000647 | Ga0495662_0000647_14648_16249 | 476 |
| 398 | 3300046476 | Ga0495662_0006794 | Ga0495662_0006794_1040_2641 | 476 |
| 399 | 3300046477 | Ga0495664_0000922 | Ga0495664_0000922_7234_8835 | 476 |
| 400 | 3300046516 | Ga0495628_0090076 | Ga0495628_0090076_622_2223 | 476 |
| 401 | 3300046517 | Ga0495630_0006156 | Ga0495630_0006156_6724_8325 | 476 |
| 402 | 3300046529 | Ga0495652_0003299 | Ga0495652_0003299_6542_8143 | 476 |
| 403 | 3300046663 | Ga0495635_0024275 | Ga0495635_0024275_2437_4038 | 476 |
| 404 | 3300046675 | Ga0495657_0009922 | Ga0495657_0009922_4385_5986 | 476 |
| 405 | 3300046680 | Ga0495646_0001220 | Ga0495646_0001220_6044_7645 | 476 |
| 406 | 3300046689 | Ga0495613_0005048 | Ga0495613_0005048_8200_9801 | 476 |
| 407 | 3300046809 | Ga0495600_0001908 | Ga0495600_0001908_2725_4326 | 476 |
| 408 | 3300047317 | Ga0495604_0000946 | Ga0495604_0000946_10209_11810 | 476 |
| 409 | 3300047321 | Ga0495676_0000913 | Ga0495676_0000913_7460_9061 | 476 |
| 410 | 3300047673 | Ga0495593_0001354 | Ga0495593_0001354_4932_6533 | 476 |
| 411 | 3300048089 | Ga0495614_0016579 | Ga0495614_0016579_405_2006 | 476 |
| 412 | 3300044765 | Ga0466970_0001620 | Ga0466970_0001620_3783_5411 | 477 |
| 413 | 3300046455 | Ga0495603_0000850 | Ga0495603_0000850_1998_3653 | 477 |
| 414 | 3300046459 | Ga0495629_0002039 | Ga0495629_0002039_13817_15472 | 477 |
| 415 | 3300046689 | Ga0495613_0002320 | Ga0495613_0002320_11420_13075 | 477 |
| 416 | 3300047321 | Ga0495676_0002484 | Ga0495676_0002484_4412_6067 | 477 |
| 417 | 3300003578 | Ga0006562J51391_1188152 | Ga0006562J51391_11881522 | 478 |
| 418 | 3300030522 | Ga0307512_10109664 | Ga0307512_101096642 | 478 |
| 419 | 3300033180 | Ga0307510_10024814 | Ga0307510_100248143 | 478 |
| 420 | 3300042138 | Ga0450903_000328 | Ga0450903_000328_4375_6003 | 478 |
| 421 | 3300044658 | Ga0466972_0031961 | Ga0466972_0031961_449_2077 | 478 |
| 422 | 3300044684 | Ga0466966_0012382 | Ga0466966_0012382_1008_2636 | 478 |
| 423 | 3300047443 | Ga0495687_001311 | Ga0495687_001311_7415_9025 | 478 |
| 424 | 3300049569 | Ga0501032_0072338 | Ga0501032_0072338_332_1957 | 478 |
| 425 | 3300049574 | Ga0501038_0002636 | Ga0501038_0002636_6446_8071 | 478 |
| 426 | 3300049581 | Ga0501047_0062171 | Ga0501047_0062171_759_2384 | 478 |
| 427 | 3300049742 | Ga0501080_0020590 | Ga0501080_0020590_3543_5168 | 478 |
| 428 | 3300049822 | Ga0501035_0086971 | Ga0501035_0086971_389_2014 | 478 |
| 429 | 3300049823 | Ga0501044_0072131 | Ga0501044_0072131_1127_2752 | 478 |
| 430 | iso_pu_bacteria | 2808606375 | 2808913453 | 478 |
| 431 | iso_pu_bacteria | 2873151551 | 2873154186 | 478 |
| 432 | iso_pu_bacteria | 2997600082 | 2997603009 | 478 |
| 433 | iso_pu_bacteria | 8054160619 | 8054161140 | 478 |
| 434 | 3300003322 | rootL2_10007767 | rootL2_100077674 | 479 |
| 435 | 3300005539 | Ga0068853_100100069 | Ga0068853_1001000693 | 479 |
| 436 | 3300005937 | Ga0081455_10012607 | Ga0081455_100126071 | 479 |
| 437 | 3300015688 | Ga0183367_1002 | Ga0183367_1002189 | 479 |
| 438 | 3300025302 | Ga0207426_1009705 | Ga0207426_10097053 | 479 |
| 439 | 3300026041 | Ga0207639_10070151 | Ga0207639_100701513 | 479 |
| 440 | 3300028786 | Ga0307517_10002122 | Ga0307517_100021228 | 479 |
| 441 | 3300028794 | Ga0307515_10000699 | Ga0307515_1000069932 | 479 |
| 442 | 3300030521 | Ga0307511_10000438 | Ga0307511_1000043815 | 479 |
| 443 | 3300030522 | Ga0307512_10004491 | Ga0307512_100044913 | 479 |
| 444 | 3300031456 | Ga0307513_10022259 | Ga0307513_100222593 | 479 |
| 445 | 3300031507 | Ga0307509_10043047 | Ga0307509_100430473 | 479 |
| 446 | 3300031616 | Ga0307508_10001866 | Ga0307508_1000186611 | 479 |
| 447 | 3300031616 | Ga0307508_10011031 | Ga0307508_100110315 | 479 |
| 448 | 3300031730 | Ga0307516_10009907 | Ga0307516_100099076 | 479 |
| 449 | 3300033179 | Ga0307507_10015409 | Ga0307507_100154095 | 479 |
| 450 | 3300037466 | Ga0395898_0006384 | Ga0395898_0006384_2918_4549 | 479 |
| 451 | 3300037466 | Ga0395898_0065292 | Ga0395898_0065292_507_2135 | 479 |
| 452 | 3300038443 | Ga0395901_0196114 | Ga0395901_0196114_244_1872 | 479 |
| 453 | 3300041404 | Ga0439436_0012369 | Ga0439436_0012369_61_1689 | 479 |
| 454 | 3300041512 | Ga0451853_2445254 | Ga0451853_2445254_156_1784 | 479 |
| 455 | 3300042014 | Ga0439457_000227 | Ga0439457_000227_13180_14808 | 479 |
| 456 | 3300042131 | Ga0450894_000044 | Ga0450894_000044_9856_11484 | 479 |
| 457 | 3300042145 | Ga0450906_003098 | Ga0450906_003098_908_2536 | 479 |
| 458 | 3300044658 | Ga0466972_0016149 | Ga0466972_0016149_590_2200 | 479 |
| 459 | 3300044683 | Ga0466965_0000566 | Ga0466965_0000566_5491_7101 | 479 |
| 460 | 3300044684 | Ga0466966_0001405 | Ga0466966_0001405_2714_4324 | 479 |
| 461 | 3300044693 | Ga0466961_0001027 | Ga0466961_0001027_4465_6075 | 479 |
| 462 | 3300044694 | Ga0466963_0001259 | Ga0466963_0001259_6316_7926 | 479 |
| 463 | 3300044694 | Ga0466963_0003744 | Ga0466963_0003744_147_1760 | 479 |
| 464 | 3300044719 | Ga0466971_0001303 | Ga0466971_0001303_398_2008 | 479 |
| 465 | 3300044765 | Ga0466970_0057829 | Ga0466970_0057829_67_1677 | 479 |
| 466 | 3300044842 | Ga0466957_0000445 | Ga0466957_0000445_10391_12001 | 479 |
| 467 | 3300045836 | Ga0466958_0001212 | Ga0466958_0001212_10099_11709 | 479 |
| 468 | 3300045976 | Ga0466967_0001978 | Ga0466967_0001978_10263_11891 | 479 |
| 469 | 3300045976 | Ga0466967_0003250 | Ga0466967_0003250_8789_10417 | 479 |
| 470 | 3300046455 | Ga0495603_0003850 | Ga0495603_0003850_2017_3627 | 479 |
| 471 | 3300046455 | Ga0495603_0053276 | Ga0495603_0053276_519_2150 | 479 |
| 472 | 3300046459 | Ga0495629_0001340 | Ga0495629_0001340_38_1693 | 479 |
| 473 | 3300046459 | Ga0495629_0011903 | Ga0495629_0011903_2823_4433 | 479 |
| 474 | 3300046459 | Ga0495629_0026307 | Ga0495629_0026307_1419_3029 | 479 |
| 475 | 3300046460 | Ga0495638_0063751 | Ga0495638_0063751_269_1900 | 479 |
| 476 | 3300046474 | Ga0495605_0063442 | Ga0495605_0063442_37_1647 | 479 |
| 477 | 3300046499 | Ga0495594_0003561 | Ga0495594_0003561_6309_7964 | 479 |
| 478 | 3300046507 | Ga0495606_0011392 | Ga0495606_0011392_97_1707 | 479 |
| 479 | 3300046512 | Ga0495610_0050260 | Ga0495610_0050260_15_1625 | 479 |
| 480 | 3300046513 | Ga0495616_0066786 | Ga0495616_0066786_112_1722 | 479 |
| 481 | 3300046514 | Ga0495618_0046969 | Ga0495618_0046969_900_2510 | 479 |
| 482 | 3300046518 | Ga0495631_0012544 | Ga0495631_0012544_161_1771 | 479 |
| 483 | 3300046528 | Ga0495642_0016890 | Ga0495642_0016890_66_1676 | 479 |
| 484 | 3300046529 | Ga0495652_0022352 | Ga0495652_0022352_3178_4788 | 479 |
| 485 | 3300046530 | Ga0495654_0020479 | Ga0495654_0020479_1722_3332 | 479 |
| 486 | 3300046558 | Ga0495633_0022477 | Ga0495633_0022477_128_1738 | 479 |
| 487 | 3300046616 | Ga0495668_0009995 | Ga0495668_0009995_1275_2885 | 479 |
| 488 | 3300046648 | Ga0495611_0037758 | Ga0495611_0037758_120_1751 | 479 |
| 489 | 3300046660 | Ga0495625_0005273 | Ga0495625_0005273_8989_10599 | 479 |
| 490 | 3300046663 | Ga0495635_0025826 | Ga0495635_0025826_358_1968 | 479 |
| 491 | 3300046665 | Ga0495661_0063325 | Ga0495661_0063325_99_1709 | 479 |
| 492 | 3300046674 | Ga0495588_0007574 | Ga0495588_0007574_292_1902 | 479 |
| 493 | 3300046675 | Ga0495657_0106777 | Ga0495657_0106777_106_1716 | 479 |
| 494 | 3300046679 | Ga0495623_0059461 | Ga0495623_0059461_58_1668 | 479 |
| 495 | 3300046689 | Ga0495613_0041563 | Ga0495613_0041563_29_1639 | 479 |
| 496 | 3300046689 | Ga0495613_0131042 | Ga0495613_0131042_129_1739 | 479 |
| 497 | 3300046694 | Ga0495649_0038321 | Ga0495649_0038321_30_1640 | 479 |
| 498 | 3300046794 | Ga0495589_0006599 | Ga0495589_0006599_1620_3251 | 479 |
| 499 | 3300046794 | Ga0495589_0024134 | Ga0495589_0024134_1303_2913 | 479 |
| 500 | 3300046809 | Ga0495600_0011862 | Ga0495600_0011862_1882_3492 | 479 |
| 501 | 3300047315 | Ga0495581_0032945 | Ga0495581_0032945_829_2439 | 479 |
| 502 | 3300047315 | Ga0495581_0063066 | Ga0495581_0063066_103_1713 | 479 |
| 503 | 3300047321 | Ga0495676_0013360 | Ga0495676_0013360_5677_7332 | 479 |
| 504 | 3300047321 | Ga0495676_0031418 | Ga0495676_0031418_711_2321 | 479 |
| 505 | 3300047322 | Ga0495680_0013287 | Ga0495680_0013287_2311_3921 | 479 |
| 506 | 3300047323 | Ga0495683_0019121 | Ga0495683_0019121_44_1675 | 479 |
| 507 | 3300047323 | Ga0495683_0039048 | Ga0495683_0039048_244_1854 | 479 |
| 508 | 3300047323 | Ga0495683_0059486 | Ga0495683_0059486_116_1726 | 479 |
| 509 | 3300047443 | Ga0495687_001496 | Ga0495687_001496_1887_3497 | 479 |
| 510 | 3300047444 | Ga0495675_0114450 | Ga0495675_0114450_54_1664 | 479 |
| 511 | 3300047447 | Ga0495685_003865 | Ga0495685_003865_1410_3020 | 479 |
| 512 | 3300047470 | Ga0495681_0001659 | Ga0495681_0001659_4443_6053 | 479 |
| 513 | 3300047472 | Ga0495686_0011098 | Ga0495686_0011098_1182_2810 | 479 |
| 514 | 3300048089 | Ga0495614_0007729 | Ga0495614_0007729_1106_2716 | 479 |
| 515 | 3300048091 | Ga0495626_0025069 | Ga0495626_0025069_1148_2758 | 479 |
| 516 | 3300049460 | Ga0495682_0028778 | Ga0495682_0028778_39_1649 | 479 |
| 517 | 3300049570 | Ga0501033_0000756 | Ga0501033_0000756_13565_15193 | 479 |
| 518 | 3300049570 | Ga0501033_0010531 | Ga0501033_0010531_2174_3784 | 479 |
| 519 | 3300049571 | Ga0501034_0010815 | Ga0501034_0010815_3240_4850 | 479 |
| 520 | 3300049572 | Ga0501036_0039597 | Ga0501036_0039597_452_2062 | 479 |
| 521 | 3300049573 | Ga0501037_0002555 | Ga0501037_0002555_7059_8669 | 479 |
| 522 | 3300049580 | Ga0501046_0026575 | Ga0501046_0026575_2310_3920 | 479 |
| 523 | 3300049581 | Ga0501047_0047880 | Ga0501047_0047880_2058_3668 | 479 |
| 524 | 3300049823 | Ga0501044_0006283 | Ga0501044_0006283_4544_6154 | 479 |
| 525 | 3300049823 | Ga0501044_0042826 | Ga0501044_0042826_1444_3072 | 479 |
| 526 | 3300050490 | nmdc:mga03n38_9299_c1 | nmdc:mga03n38_9299_c1_1028_2656 | 479 |
| 527 | 3300053107 | Ga0500560_000162 | Ga0500560_000162_1726_3336 | 479 |
| 528 | 3300061719 | Ga0466962_0010310 | Ga0466962_0010310_2586_4196 | 479 |
| 529 | iso_pu_bacteria | 2867475112 | 2867477636 | 479 |
| 530 | iso_pu_bacteria | 2997451912 | 2997453208 | 479 |
| 531 | 3300044658 | Ga0466972_0009735 | Ga0466972_0009735_583_2220 | 480 |
| 532 | 3300002067 | JGI24735J21928_10015630 | JGI24735J21928_100156302 | 482 |
| 533 | 3300006042 | Ga0075368_10005467 | Ga0075368_100054674 | 482 |
| 534 | 3300006178 | Ga0075367_10003844 | Ga0075367_100038443 | 482 |
| 535 | 3300013105 | Ga0157369_10086089 | Ga0157369_100860892 | 482 |
| 536 | 3300014497 | Ga0182008_10001039 | Ga0182008_1000103916 | 482 |
| 537 | 3300015262 | Ga0182007_10000456 | Ga0182007_1000045610 | 482 |
| 538 | 3300015265 | Ga0182005_1010631 | Ga0182005_10106311 | 482 |
| 539 | 3300025904 | Ga0207647_10014132 | Ga0207647_100141325 | 482 |
| 540 | 3300027866 | Ga0209813_10002304 | Ga0209813_100023044 | 482 |
| 541 | 3300041406 | Ga0439439_0011540 | Ga0439439_0011540_200_1837 | 482 |
| 542 | 3300042007 | Ga0439449_0003395 | Ga0439449_0003395_3713_5332 | 482 |
| 543 | 3300042014 | Ga0439457_000096 | Ga0439457_000096_6106_7743 | 482 |
| 544 | 3300050494 | nmdc:mga06z11_6884_c1 | nmdc:mga06z11_6884_c1_925_2553 | 482 |
| 545 | 3300050495 | nmdc:mga04h51_2502_c1 | nmdc:mga04h51_2502_c1_2525_4153 | 482 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5nv9-assembly1.cif.gz_A | substrate-bound outward-open state of a na+-coupled sialic acid symporter reveals a novel na+-site | 0.6664 | 8 | 422 |
| 8hez-assembly1.cif.gz_A | structure of human sglt2-map17 complex with dapagliflozin | 0.6186 | 6 | 417 |
| 8hdh-assembly1.cif.gz_A | structure of human sglt2-map17 complex with canagliflozin | 0.6083 | 6 | 417 |
| 8fhp-assembly1.cif.gz_A | cryo-em structure of human ncc (class 3-1) | 0.6065 | 48 | 417 |
| 8hin-assembly1.cif.gz_A | structure of human sglt2-map17 complex with phlorizin | 0.5863 | 8 | 417 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P32705_52_542_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.7479 | 27 | 421 | 1.20.1730.10 |
| af_A0A0H2UJX9_34_534_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.7168 | 37 | 422 | 1.20.1730.10 |
| af_Q9W3R0_60_567_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.7029 | 44 | 422 | 1.20.1730.10 |
| af_Q59UP3_34_539_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.6954 | 35 | 423 | 1.20.1730.10 |
| af_A0A1D8PDB5_36_538_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.6927 | 38 | 422 | 1.20.1730.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W6BI68-F1-model_v4 | Sodium:solute symporter | 0.9292 | 10 | 315 |
GO:0005886
GO:0022857 |
| AF-A0A2W6BI68-F1-model_v4 | Sodium:solute symporter | 0.9004 | 10 | 315 |
GO:0005886
GO:0022857 |
| AF-A0A402A2P0-F1-model_v4 | Sodium:solute symporter | 0.8928 | 8 | 422 |
GO:0005886
GO:0022857 |
| AF-A0A653PZ41-F1-model_v4 | Monocarboxylate transport permease protein | 0.8921 | 1 | 401 |
GO:0005886
GO:0022857 |
| AF-S3B1B6-F1-model_v4 | Solute:sodium symporter (SSS) family transporter | 0.8851 | 1 | 466 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar