F461929

General Info

Members Datasets Scaffolds Average Seq Length
545 360 458 506

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2867475112|2867477636
Length 558
Sequence TTAPEASAVLAVSATKGVNGVALAVFIFFFLAVTVMGFLAARWRKAEESANLDEWGLGGRSFGTWVTWFLLGGDLYTAYTFVAVPAAIYAAGAAGFFAVPYTILVYPLIFTFLPRLWSVSHKHGYVTTSDFVRGRFGSKGLSLAVALTGILATMPYIALQLVGIQAVLDVLGIGGGEHTNWFVKDLPLLIAFAVLAAYTYSSGLRAPALIAFVKDGLIYLVIGVAIIYIPIKLGGFDAVFHSAGKALAQPGPVPGKPRGELTSGPNAQWAYATLALGSALALFMYPHSITATLSSRSRNVIRRNTTILPLYSLMLGLLALLGFMAIKAGTDIQGNPQLAIPQLFEDMFPSWFTGVAFAAIGIGALVPAAIMSIAAANLFTRNVYKDFLKPDATPAQEHKVAKLVSLLVKVGALVFVLTMDKTVAINFQLLGGIWILQTMPSLVGGLFTRWFHRWALLAGWAVGMLYGTLAAYGVASPTQAHFGGSSKEIPGIGEIGYIGLTAFVLNVVVSVVLTVVLKAVNAPEGTDETSPADYTADAGDEGVVVELPPATAGAPAGH

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221548 Streptomyces sp. Root55 Isolate Unclassified
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221647 Streptomyces sp. Root369 Isolate Unclassified
11 2643221670 Streptomyces sp. Root431 Isolate Unclassified
12 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
13 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
14 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
15 2643221714 Streptomyces sp. Root264 Isolate Unclassified
16 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
17 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
18 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
19 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
20 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
21 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
22 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
23 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
24 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
25 2808606448 Streptomyces sp. 193411 Isolate Unclassified
26 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
27 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
28 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
29 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
30 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
31 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
32 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
33 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
34 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
35 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
36 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
37 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
38 2862574272 Streptomyces sp. AcE210 Isolate Nodule
39 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
40 2867369537 Streptomyces sp. Z26 Isolate Unclassified
41 2867428634 Streptomyces sp. RP5T Isolate Unclassified
42 2867475112 Streptomyces sp. TM32 Isolate Unclassified
43 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
44 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
45 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
46 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
47 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
48 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
49 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
50 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
51 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
52 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
53 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
54 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
55 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
56 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
57 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
58 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
59 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
60 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
61 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
62 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
63 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
64 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
65 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
66 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
67 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
68 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
69 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
70 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
71 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
72 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
73 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
74 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
75 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
76 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
78 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
80 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
83 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
84 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
88 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
89 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
90 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
94 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
95 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
96 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
102 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
109 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
210 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
213 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
214 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
215 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
216 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
234 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
239 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
250 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
284 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
290 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
341 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
342 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
346 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
347 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
348 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
349 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
350 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
351 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
352 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
353 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
354 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
355 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
356 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
357 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
358 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
359 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
360 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.94
Metatranscriptomes 1.1
Isolates 15.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0.55
Rhizoplane 2.94
Rhizosphere 80.92
Stem 0
Stem Tuber 0
Unclassified 13.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10015630 3300002067 Bacteria 2365
2 JGI25165J46597_1000016 3300003214 Bacteria 377866
3 rootL2_10007767 3300003322 Bacteria 6531
4 JGI25407J50210_10006427 3300003373 Bacteria 2927
5 Ga0006562J51391_1188152 3300003578 Bacteria 3480
6 Ga0058861_10082260 3300004800 Bacteria 2164
7 Ga0070658_10030822 3300005327 Bacteria 4308
8 Ga0070683_100048161 3300005329 Bacteria 3940
9 Ga0070680_100035954 3300005336 Bacteria 4000
10 Ga0070687_100016953 3300005343 Bacteria 3338
11 Ga0070668_100159801 3300005347 Bacteria 1828
12 Ga0070688_100063709 3300005365 Bacteria 2338
13 Ga0070659_100053342 3300005366 Bacteria 3182
14 Ga0070667_100168906 3300005367 Bacteria 1930
15 Ga0070709_10039996 3300005434 Bacteria 2880
16 Ga0070709_10065342 3300005434 Bacteria 2329
17 Ga0070714_100002170 3300005435 Bacteria 14422
18 Ga0070713_100003769 3300005436 Bacteria 10036
19 Ga0070694_100066955 3300005444 Bacteria 2464
20 Ga0070663_100022215 3300005455 Bacteria 4237
21 Ga0070662_100082933 3300005457 Bacteria 2392
22 Ga0070685_10055939 3300005466 Bacteria 2293
23 Ga0070707_100069378 3300005468 Bacteria 3394
24 Ga0070698_100005079 3300005471 Bacteria 14410
25 Ga0070699_100002283 3300005518 Bacteria 17248
26 Ga0070679_100116986 3300005530 Bacteria 2650
27 Ga0070684_100040580 3300005535 Bacteria 4009
28 Ga0070697_100003717 3300005536 Bacteria 11718
29 Ga0068853_100019858 3300005539 Bacteria 5581
30 Ga0068853_100100069 3300005539 Bacteria 2562
31 Ga0070696_100035241 3300005546 Bacteria 3444
32 Ga0068855_100169730 3300005563 Bacteria 2471
33 Ga0070664_100016550 3300005564 Bacteria 6047
34 Ga0070702_100034681 3300005615 Bacteria 2782
35 Ga0068859_100048153 3300005617 Bacteria 4282
36 Ga0068863_100044396 3300005841 Bacteria 4219
37 Ga0081455_10012607 3300005937 Bacteria 8425
38 Ga0081455_10035007 3300005937 Bacteria 4493
39 Ga0081538_10000369 3300005981 Bacteria 51269
40 Ga0081538_10013180 3300005981 Bacteria 6562
41 Ga0081538_10035970 3300005981 Bacteria 3242
42 Ga0081540_1000607 3300005983 Bacteria 34146
43 Ga0081540_1000665 3300005983 Bacteria 32397
44 Ga0081539_10015242 3300005985 Bacteria 5601
45 Ga0081539_10018975 3300005985 Bacteria 4736
46 Ga0070717_10017610 3300006028 Bacteria 5562
47 Ga0070717_10070278 3300006028 Bacteria 2917
48 Ga0075368_10005467 3300006042 Bacteria 4369
49 Ga0070716_100086787 3300006173 Bacteria 1883
50 Ga0070712_100031789 3300006175 Bacteria 3558
51 Ga0070712_100082714 3300006175 Bacteria 2329
52 Ga0075367_10003844 3300006178 Bacteria 7239
53 Ga0075430_100007812 3300006846 Bacteria 9037
54 Ga0075431_100033865 3300006847 Bacteria 5264
55 Ga0075434_100018644 3300006871 Bacteria 6704
56 Ga0097620_100048153 3300006931 Bacteria 4282
57 Ga0105251_10017136 3300009011 Bacteria 3891
58 Ga0111539_10004429 3300009094 Bacteria 18349
59 Ga0105243_10056759 3300009148 Bacteria 3115
60 Ga0105238_10074742 3300009551 Bacteria 3381
61 Ga0157370_10012834 3300013104 Bacteria 8661
62 Ga0157369_10086089 3300013105 Bacteria 3357
63 Ga0182008_10001039 3300014497 Bacteria 19279
64 Ga0182008_10026478 3300014497 Bacteria 2941
65 Ga0182007_10000456 3300015262 Bacteria 24668
66 Ga0182005_1010631 3300015265 Bacteria 2642
67 Ga0183367_1002 3300015688 Bacteria 1101531
68 Ga0163161_10081091 3300017792 Bacteria 2389
69 Ga0197907_10498473 3300020069 Bacteria 2104
70 Ga0206349_1237425 3300020075 Bacteria 2313
71 Ga0206354_10145188 3300020081 Bacteria 2497
72 Ga0206353_11186864 3300020082 Bacteria 5112
73 Ga0213872_10001035 3300021361 Bacteria 19388
74 Ga0213872_10007945 3300021361 Bacteria 5172
75 Ga0213874_10000559 3300021377 Bacteria 7452
76 Ga0213874_10001953 3300021377 Bacteria 4338
77 Ga0213876_10007469 3300021384 Bacteria 5946
78 Ga0213876_10013365 3300021384 Bacteria 4363
79 Ga0209233_1000068 3300025261 Bacteria 377969
80 Ga0209758_1002959 3300025297 Bacteria 16295
81 Ga0207426_1009705 3300025302 Bacteria 3785
82 Ga0207692_10005124 3300025898 Bacteria 5230
83 Ga0207692_10035868 3300025898 Bacteria 2413
84 Ga0207688_10003662 3300025901 Bacteria 8394
85 Ga0207647_10014132 3300025904 Bacteria 5513
86 Ga0207685_10001899 3300025905 Bacteria 4605
87 Ga0207699_10002717 3300025906 Bacteria 8364
88 Ga0207705_10086079 3300025909 Bacteria 2297
89 Ga0207707_10003601 3300025912 Bacteria 13738
90 Ga0207707_10010745 3300025912 Bacteria 7954
91 Ga0207693_10053499 3300025915 Bacteria 3167
92 Ga0207693_10053812 3300025915 Bacteria 3158
93 Ga0207693_10096946 3300025915 Bacteria 2312
94 Ga0207663_10056967 3300025916 Bacteria 2460
95 Ga0207662_10019146 3300025918 Bacteria 3892
96 Ga0207652_10018993 3300025921 Bacteria 5645
97 Ga0207700_10002898 3300025928 Bacteria 9887
98 Ga0207700_10007865 3300025928 Bacteria 6558
99 Ga0207700_10009940 3300025928 Bacteria 5974
100 Ga0207700_10085862 3300025928 Bacteria 2471
101 Ga0207664_10000754 3300025929 Bacteria 22024
102 Ga0207664_10078705 3300025929 Bacteria 2674
103 Ga0207706_10056157 3300025933 Bacteria 3472
104 Ga0207665_10075277 3300025939 Bacteria 2312
105 Ga0207661_10039477 3300025944 Bacteria 3705
106 Ga0207639_10070151 3300026041 Bacteria 2736
107 Ga0207678_10018163 3300026067 Bacteria 6177
108 Ga0207702_10058889 3300026078 Bacteria 3270
109 Ga0207674_10014986 3300026116 Bacteria 8539
110 Ga0207675_100187620 3300026118 Bacteria 1982
111 Ga0207683_10015105 3300026121 Bacteria 6570
112 Ga0209813_10002304 3300027866 Bacteria 4369
113 Ga0207428_10003628 3300027907 Bacteria 14881
114 Ga0268264_10095135 3300028381 Bacteria 2577
115 Ga0307517_10002122 3300028786 Bacteria 32257
116 Ga0307515_10000699 3300028794 Bacteria 77489
117 Ga0307515_10134672 3300028794 Bacteria 2695
118 Ga0265338_10005540 3300028800 Bacteria 16435
119 Ga0307511_10000438 3300030521 Bacteria 44529
120 Ga0307512_10004491 3300030522 Bacteria 15270
121 Ga0307512_10109664 3300030522 Bacteria 1825
122 Ga0307513_10022259 3300031456 Bacteria 7455
123 Ga0307509_10040112 3300031507 Bacteria 5094
124 Ga0307509_10043047 3300031507 Bacteria 4888
125 Ga0307508_10001866 3300031616 Bacteria 23226
126 Ga0307508_10011031 3300031616 Bacteria 8260
127 Ga0307508_10168181 3300031616 Bacteria 1796
128 Ga0307516_10009907 3300031730 Bacteria 10563
129 Ga0307413_10057042 3300031824 Bacteria 2386
130 Ga0307406_10033405 3300031901 Bacteria 3149
131 Ga0307416_100126516 3300032002 Bacteria 2290
132 Ga0307416_100131502 3300032002 Bacteria 2254
133 Ga0307507_10015409 3300033179 Bacteria 8994
134 Ga0307507_10024202 3300033179 Bacteria 6628
135 Ga0307510_10024814 3300033180 Bacteria 6922
136 Ga0307510_10049467 3300033180 Bacteria 4470
137 Ga0373926_0004029 3300035083 Bacteria 4794
138 Ga0373929_0005906 3300035085 Bacteria 2211
139 Ga0373934_0014406 3300035086 Bacteria 2996
140 Ga0373934_0018960 3300035086 Bacteria 2636
141 Ga0373923_0000930 3300035111 Bacteria 7836
142 Ga0373923_0025652 3300035111 Bacteria 2338
143 Ga0373936_0005701 3300035113 Bacteria 4698
144 Ga0373936_0028547 3300035113 Bacteria 2193
145 Ga0373945_0011156 3300035116 Bacteria 2966
146 Ga0373953_0000273 3300035117 Bacteria 14158
147 Ga0373953_0018153 3300035117 Bacteria 2598
148 Ga0373954_0000481 3300035118 Bacteria 14980
149 Ga0373954_0026941 3300035118 Bacteria 2636
150 Ga0373956_0025337 3300035119 Bacteria 2562
151 Ga0373957_0006049 3300035120 Bacteria 3790
152 Ga0373943_0005455 3300035170 Bacteria 5722
153 Ga0373946_0000550 3300035171 Bacteria 12421
154 Ga0373955_0040965 3300035172 Bacteria 2480
155 Ga0373942_0005618 3300035207 Bacteria 2908
156 Ga0373931_0022531 3300035691 Bacteria 3171
157 Ga0373935_0005456 3300035692 Bacteria 7491
158 Ga0373947_0002598 3300035725 Bacteria 10839
159 Ga0373937_0058174 3300036401 Bacteria 3551
160 Ga0373925_0004936 3300037068 Bacteria 10029
161 Ga0373925_0012568 3300037068 Bacteria 6134
162 Ga0395899_0004522 3300037312 Bacteria 10843
163 Ga0395900_0021506 3300037418 Bacteria 6597
164 Ga0395898_0006384 3300037466 Bacteria 12598
165 Ga0395898_0065292 3300037466 Bacteria 3528
166 Ga0395898_0081480 3300037466 Bacteria 3120
167 Ga0395898_0091186 3300037466 Bacteria 2932
168 Ga0395905_0027554 3300037471 Bacteria 5358
169 Ga0436364_0455118 3300037853 Bacteria 2510
170 Ga0436364_0499456 3300037853 Bacteria 6120
171 Ga0395901_0009408 3300038443 Bacteria 9915
172 Ga0395901_0047062 3300038443 Bacteria 4480
173 Ga0395901_0061871 3300038443 Bacteria 3895
174 Ga0395901_0196114 3300038443 Bacteria 2117
175 Ga0395901_0294520 3300038443 Bacteria 1683
176 Ga0436365_1215810 3300039437 Bacteria 13407
177 Ga0436365_1569498 3300039437 Bacteria 7296
178 Ga0436361_0362363 3300039447 Bacteria 2945
179 Ga0436361_0931496 3300039447 Bacteria 14440
180 Ga0436363_0089430 3300039450 Bacteria 7493
181 Ga0436363_0837216 3300039450 Bacteria 2773
182 Ga0436363_0931830 3300039450 Bacteria 42017
183 Ga0436363_1004894 3300039450 Bacteria 14280
184 Ga0436362_0088640 3300039453 Bacteria 10868
185 Ga0439436_0012369 3300041404 Bacteria 2591
186 Ga0439439_0011540 3300041406 Bacteria 2128
187 Ga0451853_1669613 3300041512 Bacteria 2535
188 Ga0451853_2445254 3300041512 Bacteria 3529
189 Ga0439449_0003395 3300042007 Bacteria 6202
190 Ga0439457_000096 3300042014 Bacteria 20343
191 Ga0439457_000227 3300042014 Bacteria 15018
192 Ga0450894_000044 3300042131 Bacteria 18520
193 Ga0450903_000328 3300042138 Bacteria 10474
194 Ga0450906_003098 3300042145 Bacteria 3599
195 Ga0466969_0064011 3300044656 Bacteria 1781
196 Ga0466972_0004538 3300044658 Bacteria 6954
197 Ga0466972_0009735 3300044658 Bacteria 4824
198 Ga0466972_0016149 3300044658 Bacteria 3732
199 Ga0466972_0031961 3300044658 Bacteria 2586
200 Ga0466965_0000566 3300044683 Bacteria 13393
201 Ga0466966_0001405 3300044684 Bacteria 15491
202 Ga0466966_0012382 3300044684 Bacteria 5652
203 Ga0466966_0016667 3300044684 Bacteria 4853
204 Ga0466966_0040076 3300044684 Bacteria 3014
205 Ga0466961_0001027 3300044693 Bacteria 17242
206 Ga0466961_0009050 3300044693 Bacteria 6350
207 Ga0466961_0011484 3300044693 Bacteria 5664
208 Ga0466963_0001259 3300044694 Bacteria 13417
209 Ga0466963_0003744 3300044694 Bacteria 8757
210 Ga0466971_0001303 3300044719 Bacteria 10417
211 Ga0466971_0007423 3300044719 Bacteria 4774
212 Ga0466971_0016647 3300044719 Bacteria 3248
213 Ga0466970_0001620 3300044765 Bacteria 10842
214 Ga0466970_0009740 3300044765 Bacteria 4863
215 Ga0466970_0057829 3300044765 Bacteria 2074
216 Ga0466957_0000445 3300044842 Bacteria 20385
217 Ga0466959_0001189 3300045049 Bacteria 15706
218 Ga0466959_0051766 3300045049 Bacteria 3009
219 Ga0466958_0001212 3300045836 Bacteria 12056
220 Ga0466958_0002791 3300045836 Bacteria 8885
221 Ga0466958_0021504 3300045836 Bacteria 3772
222 Ga0466967_0001978 3300045976 Bacteria 12436
223 Ga0466967_0003250 3300045976 Bacteria 10522
224 Ga0466967_0047717 3300045976 Bacteria 3735
225 Ga0466967_0133694 3300045976 Bacteria 2305
226 Ga0495592_0070261 3300046454 Bacteria 2551
227 Ga0495592_0077037 3300046454 Bacteria 2418
228 Ga0495603_0000055 3300046455 Bacteria 48787
229 Ga0495603_0000850 3300046455 Bacteria 17499
230 Ga0495603_0003850 3300046455 Bacteria 8938
231 Ga0495603_0007602 3300046455 Bacteria 6521
232 Ga0495603_0053276 3300046455 Bacteria 2400
233 Ga0495629_0001320 3300046459 Bacteria 19491
234 Ga0495629_0001340 3300046459 Bacteria 19372
235 Ga0495629_0002039 3300046459 Bacteria 15693
236 Ga0495629_0007249 3300046459 Bacteria 8167
237 Ga0495629_0011903 3300046459 Bacteria 6308
238 Ga0495629_0026307 3300046459 Bacteria 4134
239 Ga0495638_0063751 3300046460 Bacteria 2271
240 Ga0495651_0038168 3300046462 Bacteria 3740
241 Ga0495651_0073613 3300046462 Bacteria 2592
242 Ga0495651_0083084 3300046462 Bacteria 2415
243 Ga0495653_0069575 3300046463 Bacteria 2636
244 Ga0495653_0118035 3300046463 Bacteria 1895
245 Ga0495582_0015447 3300046473 Bacteria 4193
246 Ga0495605_0063442 3300046474 Bacteria 1762
247 Ga0495639_0000683 3300046475 Bacteria 15585
248 Ga0495662_0000647 3300046476 Bacteria 16321
249 Ga0495662_0006794 3300046476 Bacteria 5693
250 Ga0495662_0009390 3300046476 Bacteria 4798
251 Ga0495662_0022257 3300046476 Bacteria 3062
252 Ga0495664_0000922 3300046477 Bacteria 15150
253 Ga0495664_0050774 3300046477 Bacteria 2462
254 Ga0495594_0002696 3300046499 Bacteria 9220
255 Ga0495594_0003561 3300046499 Bacteria 8013
256 Ga0495594_0033611 3300046499 Bacteria 2789
257 Ga0495606_0011392 3300046507 Bacteria 7257
258 Ga0495610_0050260 3300046512 Bacteria 2036
259 Ga0495616_0066786 3300046513 Bacteria 1749
260 Ga0495618_0046969 3300046514 Bacteria 2725
261 Ga0495618_0058822 3300046514 Bacteria 2435
262 Ga0495628_0013478 3300046516 Bacteria 6877
263 Ga0495628_0017622 3300046516 Bacteria 5938
264 Ga0495628_0074137 3300046516 Bacteria 2651
265 Ga0495628_0090076 3300046516 Bacteria 2375
266 Ga0495630_0006156 3300046517 Bacteria 8508
267 Ga0495630_0064187 3300046517 Bacteria 2759
268 Ga0495630_0070565 3300046517 Bacteria 2628
269 Ga0495631_0012544 3300046518 Bacteria 4135
270 Ga0495666_0000827 3300046526 Bacteria 14282
271 Ga0495642_0016890 3300046528 Bacteria 2848
272 Ga0495652_0003299 3300046529 Bacteria 16057
273 Ga0495652_0022352 3300046529 Bacteria 5611
274 Ga0495652_0086234 3300046529 Bacteria 2578
275 Ga0495652_0157453 3300046529 Bacteria 1767
276 Ga0495654_0020479 3300046530 Bacteria 3446
277 Ga0495665_0001206 3300046531 Bacteria 13786
278 Ga0495665_0040004 3300046531 Bacteria 2497
279 Ga0495640_0003536 3300046533 Bacteria 12561
280 Ga0495645_0035589 3300046543 Bacteria 3629
281 Ga0495645_0077631 3300046543 Bacteria 2387
282 Ga0495633_0022477 3300046558 Bacteria 3137
283 Ga0495667_0037648 3300046559 Bacteria 3223
284 Ga0495667_0069123 3300046559 Bacteria 2305
285 Ga0495668_0009995 3300046616 Bacteria 5777
286 Ga0495634_0003936 3300046642 Bacteria 11787
287 Ga0495634_0058624 3300046642 Bacteria 2565
288 Ga0495611_0037758 3300046648 Bacteria 2147
289 Ga0495625_0005273 3300046660 Bacteria 11867
290 Ga0495635_0024275 3300046663 Bacteria 4226
291 Ga0495635_0025826 3300046663 Bacteria 4091
292 Ga0495635_0066228 3300046663 Bacteria 2477
293 Ga0495661_0063325 3300046665 Bacteria 2186
294 Ga0495588_0007574 3300046674 Bacteria 4949
295 Ga0495588_0010585 3300046674 Bacteria 4295
296 Ga0495588_0032075 3300046674 Bacteria 2647
297 Ga0495657_0009922 3300046675 Bacteria 7185
298 Ga0495657_0064249 3300046675 Bacteria 2418
299 Ga0495657_0106777 3300046675 Bacteria 1777
300 Ga0495599_0049407 3300046678 Bacteria 2636
301 Ga0495599_0050020 3300046678 Bacteria 2619
302 Ga0495623_0019201 3300046679 Bacteria 4418
303 Ga0495623_0022170 3300046679 Bacteria 4102
304 Ga0495623_0059461 3300046679 Bacteria 2400
305 Ga0495623_0088456 3300046679 Bacteria 1906
306 Ga0495646_0001220 3300046680 Bacteria 15076
307 Ga0495646_0004593 3300046680 Bacteria 8704
308 Ga0495646_0051886 3300046680 Bacteria 2480
309 Ga0495647_0007117 3300046681 Bacteria 3737
310 Ga0495658_0003983 3300046683 Bacteria 7278
311 Ga0495613_0002320 3300046689 Bacteria 14418
312 Ga0495613_0005048 3300046689 Bacteria 9900
313 Ga0495613_0008818 3300046689 Bacteria 7479
314 Ga0495613_0041563 3300046689 Bacteria 3404
315 Ga0495613_0131042 3300046689 Bacteria 1795
316 Ga0495624_0004619 3300046690 Bacteria 10036
317 Ga0495649_0038321 3300046694 Bacteria 2630
318 Ga0495589_0006599 3300046794 Bacteria 6114
319 Ga0495589_0024134 3300046794 Bacteria 3091
320 Ga0495600_0001908 3300046809 Bacteria 11711
321 Ga0495600_0011862 3300046809 Bacteria 5442
322 Ga0495600_0026692 3300046809 Bacteria 3728
323 Ga0495600_0061406 3300046809 Bacteria 2454
324 Ga0495600_0075426 3300046809 Bacteria 2202
325 Ga0495581_0001150 3300047315 Bacteria 14471
326 Ga0495581_0032945 3300047315 Bacteria 2999
327 Ga0495581_0059919 3300047315 Bacteria 2200
328 Ga0495581_0063066 3300047315 Bacteria 2141
329 Ga0495604_0000141 3300047317 Bacteria 61811
330 Ga0495604_0000946 3300047317 Bacteria 24219
331 Ga0495604_0003620 3300047317 Bacteria 12321
332 Ga0495604_0005936 3300047317 Bacteria 9686
333 Ga0495604_0038275 3300047317 Bacteria 3773
334 Ga0495604_0104801 3300047317 Bacteria 2071
335 Ga0495674_0012139 3300047319 Bacteria 8118
336 Ga0495674_0015389 3300047319 Bacteria 7152
337 Ga0495674_0033987 3300047319 Bacteria 4613
338 Ga0495676_0000192 3300047321 Bacteria 48607
339 Ga0495676_0000913 3300047321 Bacteria 24709
340 Ga0495676_0002484 3300047321 Bacteria 16405
341 Ga0495676_0013360 3300047321 Bacteria 7376
342 Ga0495676_0031418 3300047321 Bacteria 4491
343 Ga0495680_0013287 3300047322 Bacteria 7191
344 Ga0495680_0027228 3300047322 Bacteria 4699
345 Ga0495680_0081189 3300047322 Bacteria 2448
346 Ga0495683_0019121 3300047323 Bacteria 3535
347 Ga0495683_0039048 3300047323 Bacteria 2400
348 Ga0495683_0059486 3300047323 Bacteria 1895
349 Ga0495687_001311 3300047443 Bacteria 23302
350 Ga0495687_001496 3300047443 Bacteria 21346
351 Ga0495675_0037865 3300047444 Bacteria 3071
352 Ga0495675_0114450 3300047444 Bacteria 1682
353 Ga0495685_003865 3300047447 Bacteria 4805
354 Ga0495681_0001659 3300047470 Bacteria 16506
355 Ga0495684_0001886 3300047471 Bacteria 16800
356 Ga0495684_0071484 3300047471 Bacteria 2636
357 Ga0495686_0011098 3300047472 Bacteria 6364
358 Ga0495593_0001354 3300047673 Bacteria 14302
359 Ga0495602_0086508 3300048088 Bacteria 2616
360 Ga0495614_0007729 3300048089 Bacteria 4777
361 Ga0495614_0016579 3300048089 Bacteria 3205
362 Ga0495626_0025069 3300048091 Bacteria 2919
363 Ga0496101_0089263 3300048904 Bacteria 2290
364 Ga0496104_0077443 3300048907 Bacteria 3168
365 Ga0496104_0132382 3300048907 Bacteria 2395
366 Ga0496105_0004703 3300048908 Bacteria 10293
367 Ga0496105_0066326 3300048908 Bacteria 2979
368 Ga0496106_0108910 3300048909 Bacteria 2155
369 Ga0496109_0159004 3300048912 Bacteria 2117
370 Ga0496110_0042263 3300048913 Bacteria 3979
371 Ga0496110_0156783 3300048913 Bacteria 2062
372 Ga0496111_0019694 3300048914 Bacteria 4691
373 Ga0496112_0020417 3300048915 Bacteria 6279
374 Ga0496114_0032466 3300048917 Bacteria 4297
375 Ga0496114_0052063 3300048917 Bacteria 3410
376 Ga0496115_0103426 3300048918 Bacteria 2336
377 Ga0496115_0110858 3300048918 Bacteria 2254
378 Ga0496119_0011050 3300048922 Bacteria 7527
379 Ga0496126_0002208 3300048929 Bacteria 26954
380 Ga0495682_0028778 3300049460 Bacteria 2058
381 Ga0501031_0002776 3300049568 Bacteria 11152
382 Ga0501032_0072338 3300049569 Bacteria 2298
383 Ga0501033_0000756 3300049570 Bacteria 29733
384 Ga0501033_0004830 3300049570 Bacteria 10754
385 Ga0501033_0010531 3300049570 Bacteria 7091
386 Ga0501033_0016434 3300049570 Bacteria 5605
387 Ga0501034_0002496 3300049571 Bacteria 22077
388 Ga0501034_0009661 3300049571 Bacteria 10088
389 Ga0501034_0010815 3300049571 Bacteria 9480
390 Ga0501034_0159881 3300049571 Bacteria 2224
391 Ga0501036_0001066 3300049572 Bacteria 20756
392 Ga0501036_0003255 3300049572 Bacteria 12949
393 Ga0501036_0021234 3300049572 Bacteria 5454
394 Ga0501036_0039597 3300049572 Bacteria 3988
395 Ga0501037_0000553 3300049573 Bacteria 29785
396 Ga0501037_0002555 3300049573 Bacteria 13157
397 Ga0501037_0031552 3300049573 Bacteria 3912
398 Ga0501038_0001453 3300049574 Bacteria 21771
399 Ga0501038_0002636 3300049574 Bacteria 16776
400 Ga0501038_0021157 3300049574 Bacteria 5843
401 Ga0501038_0079787 3300049574 Bacteria 2759
402 Ga0501038_0116633 3300049574 Bacteria 2206
403 Ga0501038_0184395 3300049574 Bacteria 1682
404 Ga0501039_0022397 3300049575 Bacteria 4850
405 Ga0501041_0014192 3300049577 Bacteria 4729
406 Ga0501042_0027970 3300049578 Bacteria 3968
407 Ga0501043_0001506 3300049579 Bacteria 20343
408 Ga0501043_0020853 3300049579 Bacteria 5140
409 Ga0501046_0002619 3300049580 Bacteria 16807
410 Ga0501046_0026575 3300049580 Bacteria 4727
411 Ga0501047_0000964 3300049581 Bacteria 29099
412 Ga0501047_0001549 3300049581 Bacteria 22497
413 Ga0501047_0005936 3300049581 Bacteria 11484
414 Ga0501047_0047880 3300049581 Bacteria 4130
415 Ga0501047_0062171 3300049581 Bacteria 3602
416 Ga0501048_0002110 3300049582 Bacteria 15156
417 Ga0501067_0012775 3300049583 Bacteria 4652
418 Ga0501067_0022741 3300049583 Bacteria 3469
419 Ga0501068_0002541 3300049584 Bacteria 9687
420 Ga0501070_0001890 3300049586 Bacteria 18511
421 Ga0501071_0000948 3300049587 Bacteria 15776
422 Ga0501072_0000511 3300049588 Bacteria 27865
423 Ga0501072_0007477 3300049588 Bacteria 8290
424 Ga0501073_0014292 3300049589 Bacteria 5766
425 Ga0501074_0001957 3300049590 Bacteria 14168
426 Ga0501074_0004233 3300049590 Bacteria 10241
427 Ga0501074_0005247 3300049590 Bacteria 9321
428 Ga0501076_0004537 3300049592 Bacteria 9893
429 Ga0501079_0001551 3300049741 Bacteria 16278
430 Ga0501079_0106640 3300049741 Bacteria 2174
431 Ga0501080_0017078 3300049742 Bacteria 6702
432 Ga0501080_0020590 3300049742 Bacteria 6108
433 Ga0501083_0000503 3300049744 Bacteria 24974
434 Ga0501035_0003520 3300049822 Bacteria 14966
435 Ga0501035_0086971 3300049822 Bacteria 2754
436 Ga0501044_0001273 3300049823 Bacteria 29785
437 Ga0501044_0006283 3300049823 Bacteria 13129
438 Ga0501044_0042826 3300049823 Bacteria 4707
439 Ga0501044_0072131 3300049823 Bacteria 3511
440 Ga0501044_0077297 3300049823 Bacteria 3376
441 Ga0501044_0115347 3300049823 Bacteria 2691
442 nmdc:mga03n38_9299_c1 3300050490 Bacteria 3568
443 nmdc:mga06z11_6884_c1 3300050494 Bacteria 4651
444 nmdc:mga04h51_2502_c1 3300050495 Bacteria 4369
445 nmdc:mga08y16_47884_c1 3300050511 Bacteria 4475
446 nmdc:mga0n895_20202_c1 3300050512 Bacteria 6207
447 nmdc:mga0a205_5028_c1 3300050515 Bacteria 11911
448 nmdc:mga0a205_5170_c1 3300050515 Bacteria 11733
449 Ga0495601_0001464 3300053077 Bacteria 13008
450 Ga0495595_0022893 3300053084 Bacteria 2747
451 Ga0495619_0006734 3300053085 Bacteria 7269
452 Ga0500560_000162 3300053107 Bacteria 7600
453 Ga0500560_003860 3300053107 Bacteria 3099
454 Ga0500573_0013538 3300053140 Bacteria 4600
455 Ga0500616_0000985 3300053153 Bacteria 30767
456 Ga0501084_0004469 3300054114 Bacteria 11418
457 Ga0501082_0004283 3300060353 Bacteria 12479
458 Ga0466962_0010310 3300061719 Bacteria 4488

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0047062 Ga0395901_0047062_2003_3352 377
2 3300021361 Ga0213872_10007945 Ga0213872_100079456 404
3 3300025918 Ga0207662_10019146 Ga0207662_100191463 406
4 3300005365 Ga0070688_100063709 Ga0070688_1000637091 409
5 3300005981 Ga0081538_10013180 Ga0081538_100131807 409
6 3300005343 Ga0070687_100016953 Ga0070687_1000169532 410
7 3300021377 Ga0213874_10000559 Ga0213874_100005594 410
8 3300039450 Ga0436363_0931830 Ga0436363_0931830_27516_29156 410
9 3300005327 Ga0070658_10030822 Ga0070658_100308223 411
10 3300005329 Ga0070683_100048161 Ga0070683_1000481613 411
11 3300005336 Ga0070680_100035954 Ga0070680_1000359541 411
12 3300005347 Ga0070668_100159801 Ga0070668_1001598011 411
13 3300005367 Ga0070667_100168906 Ga0070667_1001689062 411
14 3300005444 Ga0070694_100066955 Ga0070694_1000669552 411
15 3300005455 Ga0070663_100022215 Ga0070663_1000222152 411
16 3300005457 Ga0070662_100082933 Ga0070662_1000829332 411
17 3300005466 Ga0070685_10055939 Ga0070685_100559392 411
18 3300005530 Ga0070679_100116986 Ga0070679_1001169862 411
19 3300005535 Ga0070684_100040580 Ga0070684_1000405803 411
20 3300005539 Ga0068853_100019858 Ga0068853_1000198586 411
21 3300005546 Ga0070696_100035241 Ga0070696_1000352413 411
22 3300005563 Ga0068855_100169730 Ga0068855_1001697302 411
23 3300005564 Ga0070664_100016550 Ga0070664_1000165502 411
24 3300005615 Ga0070702_100034681 Ga0070702_1000346812 411
25 3300005617 Ga0068859_100048153 Ga0068859_1000481532 411
26 3300005841 Ga0068863_100044396 Ga0068863_1000443963 411
27 3300006931 Ga0097620_100048153 Ga0097620_1000481532 411
28 3300009011 Ga0105251_10017136 Ga0105251_100171363 411
29 3300009148 Ga0105243_10056759 Ga0105243_100567592 411
30 3300009551 Ga0105238_10074742 Ga0105238_100747422 411
31 3300020069 Ga0197907_10498473 Ga0197907_104984732 411
32 3300020081 Ga0206354_10145188 Ga0206354_101451882 411
33 3300025901 Ga0207688_10003662 Ga0207688_100036628 411
34 3300025905 Ga0207685_10001899 Ga0207685_100018993 411
35 3300025906 Ga0207699_10002717 Ga0207699_100027176 411
36 3300025928 Ga0207700_10007865 Ga0207700_100078653 411
37 3300025933 Ga0207706_10056157 Ga0207706_100561572 411
38 3300026067 Ga0207678_10018163 Ga0207678_100181633 411
39 3300026078 Ga0207702_10058889 Ga0207702_100588892 411
40 3300026116 Ga0207674_10014986 Ga0207674_100149866 411
41 3300026118 Ga0207675_100187620 Ga0207675_1001876202 411
42 3300026121 Ga0207683_10015105 Ga0207683_100151051 411
43 3300028381 Ga0268264_10095135 Ga0268264_100951352 411
44 3300035085 Ga0373929_0005906 Ga0373929_0005906_284_1933 411
45 3300035207 Ga0373942_0005618 Ga0373942_0005618_985_2634 411
46 3300035691 Ga0373931_0022531 Ga0373931_0022531_1103_2752 411
47 3300048904 Ga0496101_0089263 Ga0496101_0089263_185_1834 411
48 3300048907 Ga0496104_0077443 Ga0496104_0077443_316_1965 411
49 3300048908 Ga0496105_0066326 Ga0496105_0066326_304_1953 411
50 3300048913 Ga0496110_0156783 Ga0496110_0156783_293_1942 411
51 3300048914 Ga0496111_0019694 Ga0496111_0019694_2095_3744 411
52 3300048917 Ga0496114_0052063 Ga0496114_0052063_744_2393 411
53 3300048918 Ga0496115_0110858 Ga0496115_0110858_323_1972 411
54 3300049571 Ga0501034_0159881 Ga0501034_0159881_634_2190 411
55 3300044658 Ga0466972_0004538 Ga0466972_0004538_60_1640 415
56 3300048922 Ga0496119_0011050 Ga0496119_0011050_1276_2811 417
57 3300035113 Ga0373936_0028547 Ga0373936_0028547_11_1441 419
58 3300021361 Ga0213872_10001035 Ga0213872_100010352 422
59 3300039447 Ga0436361_0362363 Ga0436361_0362363_158_1699 422
60 3300039447 Ga0436361_0931496 Ga0436361_0931496_12844_14385 422
61 3300005435 Ga0070714_100002170 Ga0070714_10000217012 425
62 3300005436 Ga0070713_100003769 Ga0070713_1000037692 425
63 3300006028 Ga0070717_10017610 Ga0070717_100176102 425
64 3300025928 Ga0207700_10002898 Ga0207700_100028983 425
65 3300035083 Ga0373926_0004029 Ga0373926_0004029_1201_2850 426
66 3300035111 Ga0373923_0000930 Ga0373923_0000930_1194_2843 426
67 3300035113 Ga0373936_0005701 Ga0373936_0005701_745_2394 426
68 3300035116 Ga0373945_0011156 Ga0373945_0011156_823_2472 426
69 3300035170 Ga0373943_0005455 Ga0373943_0005455_1769_3418 426
70 3300035171 Ga0373946_0000550 Ga0373946_0000550_7028_8677 426
71 3300035692 Ga0373935_0005456 Ga0373935_0005456_2849_4498 426
72 3300035725 Ga0373947_0002598 Ga0373947_0002598_2305_3954 426
73 3300037068 Ga0373925_0004936 Ga0373925_0004936_1065_2714 426
74 3300045836 Ga0466958_0021504 Ga0466958_0021504_673_2262 426
75 3300046455 Ga0495603_0007602 Ga0495603_0007602_2568_4217 426
76 3300046459 Ga0495629_0007249 Ga0495629_0007249_2433_4082 426
77 3300046473 Ga0495582_0015447 Ga0495582_0015447_2305_3954 426
78 3300046475 Ga0495639_0000683 Ga0495639_0000683_3192_4841 426
79 3300046476 Ga0495662_0009390 Ga0495662_0009390_156_1805 426
80 3300046499 Ga0495594_0033611 Ga0495594_0033611_352_2001 426
81 3300046516 Ga0495628_0017622 Ga0495628_0017622_1973_3622 426
82 3300046526 Ga0495666_0000827 Ga0495666_0000827_5683_7332 426
83 3300046531 Ga0495665_0001206 Ga0495665_0001206_2994_4643 426
84 3300046533 Ga0495640_0003536 Ga0495640_0003536_8480_10129 426
85 3300046642 Ga0495634_0003936 Ga0495634_0003936_7834_9483 426
86 3300046678 Ga0495599_0050020 Ga0495599_0050020_938_2587 426
87 3300046679 Ga0495623_0088456 Ga0495623_0088456_115_1764 426
88 3300046680 Ga0495646_0004593 Ga0495646_0004593_4751_6400 426
89 3300046683 Ga0495658_0003983 Ga0495658_0003983_4975_6624 426
90 3300046689 Ga0495613_0008818 Ga0495613_0008818_3745_5394 426
91 3300046690 Ga0495624_0004619 Ga0495624_0004619_6283_7932 426
92 3300046809 Ga0495600_0026692 Ga0495600_0026692_746_2395 426
93 3300047315 Ga0495581_0001150 Ga0495581_0001150_938_2587 426
94 3300047319 Ga0495674_0012139 Ga0495674_0012139_4165_5814 426
95 3300047471 Ga0495684_0001886 Ga0495684_0001886_11535_13184 426
96 3300053077 Ga0495601_0001464 Ga0495601_0001464_1958_3607 426
97 3300053085 Ga0495619_0006734 Ga0495619_0006734_1400_3049 426
98 3300046681 Ga0495647_0007117 Ga0495647_0007117_16_1665 427
99 3300046516 Ga0495628_0013478 Ga0495628_0013478_2424_3977 428
100 3300005366 Ga0070659_100053342 Ga0070659_1000533423 429
101 3300049581 Ga0501047_0001549 Ga0501047_0001549_16926_18473 430
102 3300049583 Ga0501067_0012775 Ga0501067_0012775_1042_2589 430
103 3300049588 Ga0501072_0007477 Ga0501072_0007477_5246_6793 430
104 3300049741 Ga0501079_0106640 Ga0501079_0106640_594_2141 430
105 3300005983 Ga0081540_1000607 Ga0081540_100060729 434
106 3300021384 Ga0213876_10013365 Ga0213876_100133652 434
107 3300031824 Ga0307413_10057042 Ga0307413_100570422 434
108 3300032002 Ga0307416_100131502 Ga0307416_1001315023 434
109 3300039437 Ga0436365_1569498 Ga0436365_1569498_4347_5891 434
110 3300039450 Ga0436363_0089430 Ga0436363_0089430_2449_3990 434
111 3300039450 Ga0436363_1004894 Ga0436363_1004894_2495_4039 434
112 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016196 435
113 3300021377 Ga0213874_10001953 Ga0213874_100019532 435
114 3300025261 Ga0209233_1000068 Ga0209233_1000068198 435
115 3300044684 Ga0466966_0040076 Ga0466966_0040076_946_2484 435
116 3300044719 Ga0466971_0007423 Ga0466971_0007423_167_1705 435
117 3300044765 Ga0466970_0009740 Ga0466970_0009740_463_2001 435
118 3300044656 Ga0466969_0064011 Ga0466969_0064011_69_1688 436
119 3300044693 Ga0466961_0011484 Ga0466961_0011484_1901_3520 436
120 3300045049 Ga0466959_0051766 Ga0466959_0051766_844_2463 436
121 3300005983 Ga0081540_1000665 Ga0081540_10006656 437
122 3300049574 Ga0501038_0079787 Ga0501038_0079787_190_1779 437
123 3300049823 Ga0501044_0115347 Ga0501044_0115347_909_2498 437
124 3300005471 Ga0070698_100005079 Ga0070698_10000507914 438
125 3300005981 Ga0081538_10000369 Ga0081538_1000036918 438
126 3300006175 Ga0070712_100031789 Ga0070712_1000317892 438
127 3300025898 Ga0207692_10005124 Ga0207692_100051242 438
128 3300025915 Ga0207693_10053812 Ga0207693_100538121 438
129 3300025928 Ga0207700_10009940 Ga0207700_100099406 438
130 3300021384 Ga0213876_10007469 Ga0213876_100074693 439
131 3300036401 Ga0373937_0058174 Ga0373937_0058174_1540_3195 439
132 3300037853 Ga0436364_0499456 Ga0436364_0499456_3081_4625 439
133 3300039437 Ga0436365_1215810 Ga0436365_1215810_33_1577 439
134 3300039450 Ga0436363_0837216 Ga0436363_0837216_356_1900 439
135 3300039453 Ga0436362_0088640 Ga0436362_0088640_4784_6328 439
136 3300046462 Ga0495651_0038168 Ga0495651_0038168_1300_2955 439
137 3300046559 Ga0495667_0037648 Ga0495667_0037648_180_1835 439
138 3300047322 Ga0495680_0027228 Ga0495680_0027228_2393_4048 439
139 3300003373 JGI25407J50210_10006427 JGI25407J50210_100064272 441
140 3300005468 Ga0070707_100069378 Ga0070707_1000693782 441
141 3300005536 Ga0070697_100003717 Ga0070697_1000037175 441
142 3300005981 Ga0081538_10035970 Ga0081538_100359704 441
143 3300047317 Ga0495604_0104801 Ga0495604_0104801_133_1788 441
144 iso_pu_bacteria 2582581313 2585311198 441
145 3300045976 Ga0466967_0133694 Ga0466967_0133694_91_1737 446
146 3300005937 Ga0081455_10035007 Ga0081455_100350073 447
147 3300005985 Ga0081539_10015242 Ga0081539_100152424 447
148 3300045976 Ga0466967_0047717 Ga0466967_0047717_2009_3655 447
149 3300046455 Ga0495603_0000055 Ga0495603_0000055_35208_36836 447
150 3300046459 Ga0495629_0001320 Ga0495629_0001320_1404_3032 447
151 3300046499 Ga0495594_0002696 Ga0495594_0002696_3074_4702 447
152 3300046674 Ga0495588_0010585 Ga0495588_0010585_735_2363 447
153 3300047321 Ga0495676_0000192 Ga0495676_0000192_35028_36656 447
154 3300004800 Ga0058861_10082260 Ga0058861_100822602 449
155 3300005434 Ga0070709_10065342 Ga0070709_100653422 449
156 3300005985 Ga0081539_10018975 Ga0081539_100189752 449
157 3300006173 Ga0070716_100086787 Ga0070716_1000867872 449
158 3300006175 Ga0070712_100082714 Ga0070712_1000827142 449
159 3300006846 Ga0075430_100007812 Ga0075430_1000078124 449
160 3300006847 Ga0075431_100033865 Ga0075431_1000338656 449
161 3300006871 Ga0075434_100018644 Ga0075434_1000186444 449
162 3300009094 Ga0111539_10004429 Ga0111539_1000442912 449
163 3300013104 Ga0157370_10012834 Ga0157370_100128347 449
164 3300014497 Ga0182008_10026478 Ga0182008_100264783 449
165 3300020075 Ga0206349_1237425 Ga0206349_12374252 449
166 3300020082 Ga0206353_11186864 Ga0206353_111868644 449
167 3300025898 Ga0207692_10035868 Ga0207692_100358682 449
168 3300025909 Ga0207705_10086079 Ga0207705_100860792 449
169 3300025912 Ga0207707_10010745 Ga0207707_100107455 449
170 3300025915 Ga0207693_10096946 Ga0207693_100969463 449
171 3300025916 Ga0207663_10056967 Ga0207663_100569672 449
172 3300025921 Ga0207652_10018993 Ga0207652_100189933 449
173 3300025928 Ga0207700_10085862 Ga0207700_100858622 449
174 3300025929 Ga0207664_10078705 Ga0207664_100787052 449
175 3300025939 Ga0207665_10075277 Ga0207665_100752773 449
176 3300025944 Ga0207661_10039477 Ga0207661_100394772 449
177 3300027907 Ga0207428_10003628 Ga0207428_100036283 449
178 3300031901 Ga0307406_10033405 Ga0307406_100334054 449
179 3300037418 Ga0395900_0021506 Ga0395900_0021506_3101_4672 449
180 3300037466 Ga0395898_0091186 Ga0395898_0091186_389_1960 449
181 3300037471 Ga0395905_0027554 Ga0395905_0027554_937_2508 449
182 3300038443 Ga0395901_0009408 Ga0395901_0009408_3774_5345 449
183 3300038443 Ga0395901_0294520 Ga0395901_0294520_90_1658 449
184 3300048907 Ga0496104_0132382 Ga0496104_0132382_162_1811 449
185 3300048909 Ga0496106_0108910 Ga0496106_0108910_12_1661 449
186 3300048912 Ga0496109_0159004 Ga0496109_0159004_394_2040 449
187 3300048915 Ga0496112_0020417 Ga0496112_0020417_523_2172 449
188 3300048918 Ga0496115_0103426 Ga0496115_0103426_516_2165 449
189 3300050511 nmdc:mga08y16_47884_c1 nmdc:mga08y16_47884_c1_363_1934 449
190 3300050512 nmdc:mga0n895_20202_c1 nmdc:mga0n895_20202_c1_4604_6175 449
191 3300050515 nmdc:mga0a205_5028_c1 nmdc:mga0a205_5028_c1_4350_5921 449
192 3300050515 nmdc:mga0a205_5170_c1 nmdc:mga0a205_5170_c1_7770_9341 449
193 3300053153 Ga0500616_0000985 Ga0500616_0000985_14245_15903 449
194 3300032002 Ga0307416_100126516 Ga0307416_1001265161 450
195 3300049590 Ga0501074_0005247 Ga0501074_0005247_6749_8377 451
196 3300005518 Ga0070699_100002283 Ga0070699_10000228310 454
197 3300048908 Ga0496105_0004703 Ga0496105_0004703_8261_9943 454
198 3300048929 Ga0496126_0002208 Ga0496126_0002208_19490_21130 454
199 3300028800 Ga0265338_10005540 Ga0265338_100055407 456
200 3300049574 Ga0501038_0184395 Ga0501038_0184395_128_1672 457
201 3300035086 Ga0373934_0018960 Ga0373934_0018960_862_2502 458
202 3300035111 Ga0373923_0025652 Ga0373923_0025652_128_1768 458
203 3300035117 Ga0373953_0018153 Ga0373953_0018153_824_2464 458
204 3300035118 Ga0373954_0026941 Ga0373954_0026941_862_2502 458
205 3300035120 Ga0373957_0006049 Ga0373957_0006049_439_2079 458
206 3300035172 Ga0373955_0040965 Ga0373955_0040965_134_1774 458
207 3300046454 Ga0495592_0070261 Ga0495592_0070261_796_2436 458
208 3300046462 Ga0495651_0073613 Ga0495651_0073613_91_1731 458
209 3300046463 Ga0495653_0069575 Ga0495653_0069575_862_2502 458
210 3300046477 Ga0495664_0050774 Ga0495664_0050774_107_1747 458
211 3300046514 Ga0495618_0058822 Ga0495618_0058822_666_2306 458
212 3300046516 Ga0495628_0074137 Ga0495628_0074137_666_2306 458
213 3300046517 Ga0495630_0070565 Ga0495630_0070565_862_2502 458
214 3300046529 Ga0495652_0086234 Ga0495652_0086234_110_1750 458
215 3300046531 Ga0495665_0040004 Ga0495665_0040004_734_2374 458
216 3300046543 Ga0495645_0035589 Ga0495645_0035589_1855_3495 458
217 3300046559 Ga0495667_0069123 Ga0495667_0069123_127_1767 458
218 3300046642 Ga0495634_0058624 Ga0495634_0058624_43_1683 458
219 3300046663 Ga0495635_0066228 Ga0495635_0066228_134_1774 458
220 3300046678 Ga0495599_0049407 Ga0495599_0049407_862_2502 458
221 3300046680 Ga0495646_0051886 Ga0495646_0051886_714_2354 458
222 3300046809 Ga0495600_0061406 Ga0495600_0061406_691_2331 458
223 3300047315 Ga0495581_0059919 Ga0495581_0059919_52_1692 458
224 3300047317 Ga0495604_0038275 Ga0495604_0038275_132_1772 458
225 3300047319 Ga0495674_0033987 Ga0495674_0033987_1009_2649 458
226 3300047322 Ga0495680_0081189 Ga0495680_0081189_85_1725 458
227 3300047444 Ga0495675_0037865 Ga0495675_0037865_135_1775 458
228 3300047471 Ga0495684_0071484 Ga0495684_0071484_862_2502 458
229 3300048088 Ga0495602_0086508 Ga0495602_0086508_846_2486 458
230 3300035118 Ga0373954_0000481 Ga0373954_0000481_12946_14592 459
231 3300047317 Ga0495604_0000141 Ga0495604_0000141_59777_61423 459
232 3300035117 Ga0373953_0000273 Ga0373953_0000273_10260_11906 460
233 3300035119 Ga0373956_0025337 Ga0373956_0025337_207_1853 460
234 3300046454 Ga0495592_0077037 Ga0495592_0077037_755_2401 460
235 3300046675 Ga0495657_0064249 Ga0495657_0064249_755_2401 460
236 3300046809 Ga0495600_0075426 Ga0495600_0075426_191_1837 460
237 3300048913 Ga0496110_0042263 Ga0496110_0042263_2030_3688 460
238 3300053084 Ga0495595_0022893 Ga0495595_0022893_735_2381 460
239 3300005434 Ga0070709_10039996 Ga0070709_100399961 462
240 3300025929 Ga0207664_10000754 Ga0207664_100007549 462
241 3300046517 Ga0495630_0064187 Ga0495630_0064187_631_2280 462
242 3300047319 Ga0495674_0015389 Ga0495674_0015389_5458_7107 462
243 3300049570 Ga0501033_0016434 Ga0501033_0016434_3352_4962 463
244 3300049572 Ga0501036_0021234 Ga0501036_0021234_2382_3992 463
245 3300049574 Ga0501038_0116633 Ga0501038_0116633_505_2115 463
246 3300049579 Ga0501043_0020853 Ga0501043_0020853_88_1698 463
247 3300049586 Ga0501070_0001890 Ga0501070_0001890_2254_3864 463
248 3300044684 Ga0466966_0016667 Ga0466966_0016667_2318_3970 464
249 3300044693 Ga0466961_0009050 Ga0466961_0009050_265_1917 464
250 3300044719 Ga0466971_0016647 Ga0466971_0016647_824_2476 464
251 3300045049 Ga0466959_0001189 Ga0466959_0001189_5261_6913 464
252 3300045836 Ga0466958_0002791 Ga0466958_0002791_3895_5547 464
253 3300049571 Ga0501034_0009661 Ga0501034_0009661_4016_5635 464
254 3300049572 Ga0501036_0001066 Ga0501036_0001066_12390_14009 464
255 3300049573 Ga0501037_0031552 Ga0501037_0031552_777_2396 464
256 3300049574 Ga0501038_0021157 Ga0501038_0021157_2948_4567 464
257 3300049575 Ga0501039_0022397 Ga0501039_0022397_317_1936 464
258 3300049581 Ga0501047_0005936 Ga0501047_0005936_21_1640 464
259 3300049589 Ga0501073_0014292 Ga0501073_0014292_198_1817 464
260 3300049590 Ga0501074_0001957 Ga0501074_0001957_4234_5853 464
261 3300049823 Ga0501044_0077297 Ga0501044_0077297_1481_3100 464
262 iso_pu_bacteria 2773857762 2774395220 464
263 iso_pu_bacteria 2808606439 2809193948 464
264 iso_pu_bacteria 2811994878 2812348688 464
265 iso_pu_bacteria 2891968417 2891973578 464
266 iso_pu_bacteria 8053945823 8053947842 464
267 3300025915 Ga0207693_10053499 Ga0207693_100534991 466
268 3300025912 Ga0207707_10003601 Ga0207707_1000360111 467
269 iso_pu_bacteria 2867369537 2867373725 467
270 iso_pu_bacteria 3002998708 3003005704 467
271 iso_pu_bacteria 2818991472 2819740736 468
272 3300028794 Ga0307515_10134672 Ga0307515_101346724 470
273 3300037312 Ga0395899_0004522 Ga0395899_0004522_1478_3133 470
274 3300049568 Ga0501031_0002776 Ga0501031_0002776_2008_3666 470
275 3300049570 Ga0501033_0004830 Ga0501033_0004830_7507_9165 470
276 3300049571 Ga0501034_0002496 Ga0501034_0002496_7487_9145 470
277 3300049572 Ga0501036_0003255 Ga0501036_0003255_3805_5463 470
278 3300049573 Ga0501037_0000553 Ga0501037_0000553_20641_22299 470
279 3300049574 Ga0501038_0001453 Ga0501038_0001453_7379_9037 470
280 3300049577 Ga0501041_0014192 Ga0501041_0014192_1617_3275 470
281 3300049579 Ga0501043_0001506 Ga0501043_0001506_11199_12857 470
282 3300049580 Ga0501046_0002619 Ga0501046_0002619_9322_10980 470
283 3300049581 Ga0501047_0000964 Ga0501047_0000964_6682_8340 470
284 3300049582 Ga0501048_0002110 Ga0501048_0002110_6012_7670 470
285 3300049583 Ga0501067_0022741 Ga0501067_0022741_1590_3248 470
286 3300049584 Ga0501068_0002541 Ga0501068_0002541_1590_3248 470
287 3300049587 Ga0501071_0000948 Ga0501071_0000948_11893_13551 470
288 3300049588 Ga0501072_0000511 Ga0501072_0000511_18544_20202 470
289 3300049590 Ga0501074_0004233 Ga0501074_0004233_1590_3248 470
290 3300049592 Ga0501076_0004537 Ga0501076_0004537_495_2153 470
291 3300049741 Ga0501079_0001551 Ga0501079_0001551_5645_7303 470
292 3300049742 Ga0501080_0017078 Ga0501080_0017078_3038_4696 470
293 3300049744 Ga0501083_0000503 Ga0501083_0000503_15683_17341 470
294 3300049822 Ga0501035_0003520 Ga0501035_0003520_5822_7480 470
295 3300049823 Ga0501044_0001273 Ga0501044_0001273_7487_9145 470
296 3300054114 Ga0501084_0004469 Ga0501084_0004469_7515_9173 470
297 3300060353 Ga0501082_0004283 Ga0501082_0004283_4971_6629 470
298 iso_pu_bacteria 2816332119 2816426973 470
299 3300046476 Ga0495662_0022257 Ga0495662_0022257_57_1682 471
300 3300046674 Ga0495588_0032075 Ga0495588_0032075_181_1797 471
301 iso_pu_bacteria 2547132111 2547408518 471
302 iso_pu_bacteria 2784132148 2784590275 471
303 iso_pu_bacteria 2808606448 2809233949 471
304 iso_pu_bacteria 2852635781 2852640869 471
305 iso_pu_bacteria 2862382967 2862383433 471
306 iso_pu_bacteria 2919468124 2919471580 471
307 iso_pu_bacteria 2990088156 2990088621 471
308 iso_pu_bacteria 3006493962 3006498118 471
309 iso_pu_bacteria 8023623736 8023627941 471
310 3300025297 Ga0209758_1002959 Ga0209758_100295915 472
311 3300046529 Ga0495652_0157453 Ga0495652_0157453_105_1754 472
312 3300046679 Ga0495623_0022170 Ga0495623_0022170_1934_3562 472
313 3300047317 Ga0495604_0005936 Ga0495604_0005936_6767_8395 472
314 iso_pu_bacteria 2582581314 2585318615 472
315 iso_pu_bacteria 2643221587 2643945523 472
316 iso_pu_bacteria 2643221677 2644431186 472
317 iso_pu_bacteria 2918501144 2918506346 472
318 iso_pu_bacteria 8025478263 8025482569 472
319 iso_pu_bacteria 8056447290 8056447745 472
320 3300017792 Ga0163161_10081091 Ga0163161_100810912 473
321 3300037853 Ga0436364_0455118 Ga0436364_0455118_865_2493 473
322 3300041512 Ga0451853_1669613 Ga0451853_1669613_450_2099 473
323 3300047317 Ga0495604_0003620 Ga0495604_0003620_6233_7879 473
324 3300048917 Ga0496114_0032466 Ga0496114_0032466_2375_4024 473
325 iso_pu_bacteria 2554235005 2554256347 473
326 3300035086 Ga0373934_0014406 Ga0373934_0014406_759_2405 474
327 3300037068 Ga0373925_0012568 Ga0373925_0012568_180_1829 474
328 3300037466 Ga0395898_0081480 Ga0395898_0081480_1408_3084 474
329 3300038443 Ga0395901_0061871 Ga0395901_0061871_40_1716 474
330 3300046462 Ga0495651_0083084 Ga0495651_0083084_752_2398 474
331 3300046543 Ga0495645_0077631 Ga0495645_0077631_456_2105 474
332 3300046679 Ga0495623_0019201 Ga0495623_0019201_735_2381 474
333 3300049578 Ga0501042_0027970 Ga0501042_0027970_1087_2682 474
334 iso_pu_bacteria 2643221678 2644439892 474
335 iso_pu_bacteria 2643221714 2644632777 474
336 iso_pu_bacteria 2791355406 2793975242 474
337 iso_pu_bacteria 2808606359 2808843899 474
338 iso_pu_bacteria 2808606982 2811844561 474
339 iso_pu_bacteria 2862178590 2862179110 474
340 iso_pu_bacteria 2990059506 2990064519 474
341 iso_pu_bacteria 8047893842 8047896269 474
342 iso_pu_bacteria 8048356638 8048362667 474
343 iso_pu_bacteria 8048369669 8048373278 474
344 iso_pu_bacteria 8048379754 8048384964 474
345 iso_pu_bacteria 8056667051 8056671508 474
346 3300006028 Ga0070717_10070278 Ga0070717_100702783 475
347 3300053107 Ga0500560_003860 Ga0500560_003860_565_2196 475
348 3300053140 Ga0500573_0013538 Ga0500573_0013538_693_2324 475
349 iso_pu_bacteria 2582581312 2585296461 475
350 iso_pu_bacteria 2616644814 2616697163 475
351 iso_pu_bacteria 2616644941 2616900050 475
352 iso_pu_bacteria 2643221548 2643763865 475
353 iso_pu_bacteria 2643221647 2644265947 475
354 iso_pu_bacteria 2643221670 2644386761 475
355 iso_pu_bacteria 2643221682 2644461701 475
356 iso_pu_bacteria 2784746763 2785341339 475
357 iso_pu_bacteria 2784746768 2785371342 475
358 iso_pu_bacteria 2786546132 2786672533 475
359 iso_pu_bacteria 2811994879 2812356131 475
360 iso_pu_bacteria 2811994917 2812478896 475
361 iso_pu_bacteria 2818991463 2819694750 475
362 iso_pu_bacteria 2862281513 2862285138 475
363 iso_pu_bacteria 2862507626 2862513345 475
364 iso_pu_bacteria 2862574272 2862577659 475
365 iso_pu_bacteria 2863404153 2863408471 475
366 iso_pu_bacteria 2867428634 2867435342 475
367 iso_pu_bacteria 2877676314 2877679256 475
368 iso_pu_bacteria 2912715099 2912717859 475
369 iso_pu_bacteria 2912723979 2912730288 475
370 iso_pu_bacteria 2946064051 2946069718 475
371 iso_pu_bacteria 2946072368 2946077607 475
372 iso_pu_bacteria 2947224130 2947227078 475
373 iso_pu_bacteria 2954002825 2954005319 475
374 iso_pu_bacteria 2954380949 2954384146 475
375 iso_pu_bacteria 2954673503 2954678805 475
376 iso_pu_bacteria 2954682443 2954685347 475
377 iso_pu_bacteria 2954691527 2954694969 475
378 iso_pu_bacteria 2954701450 2954710143 475
379 iso_pu_bacteria 2954711539 2954714462 475
380 iso_pu_bacteria 2954721474 2954724408 475
381 iso_pu_bacteria 2954731030 2954737410 475
382 iso_pu_bacteria 2954740390 2954743330 475
383 iso_pu_bacteria 2954749733 2954756264 475
384 iso_pu_bacteria 2954759201 2954762287 475
385 iso_pu_bacteria 2966598605 2966600984 475
386 iso_pu_bacteria 3006393351 3006393775 475
387 iso_pu_bacteria 8008558824 8008562642 475
388 iso_pu_bacteria 8008574985 8008577297 475
389 iso_pu_bacteria 8048127548 8048135076 475
390 iso_pu_bacteria 8048406513 8048406600 475
391 iso_pu_bacteria 8056829672 8056832014 475
392 3300031507 Ga0307509_10040112 Ga0307509_100401124 476
393 3300031616 Ga0307508_10168181 Ga0307508_101681811 476
394 3300033179 Ga0307507_10024202 Ga0307507_100242023 476
395 3300033180 Ga0307510_10049467 Ga0307510_100494671 476
396 3300046463 Ga0495653_0118035 Ga0495653_0118035_120_1721 476
397 3300046476 Ga0495662_0000647 Ga0495662_0000647_14648_16249 476
398 3300046476 Ga0495662_0006794 Ga0495662_0006794_1040_2641 476
399 3300046477 Ga0495664_0000922 Ga0495664_0000922_7234_8835 476
400 3300046516 Ga0495628_0090076 Ga0495628_0090076_622_2223 476
401 3300046517 Ga0495630_0006156 Ga0495630_0006156_6724_8325 476
402 3300046529 Ga0495652_0003299 Ga0495652_0003299_6542_8143 476
403 3300046663 Ga0495635_0024275 Ga0495635_0024275_2437_4038 476
404 3300046675 Ga0495657_0009922 Ga0495657_0009922_4385_5986 476
405 3300046680 Ga0495646_0001220 Ga0495646_0001220_6044_7645 476
406 3300046689 Ga0495613_0005048 Ga0495613_0005048_8200_9801 476
407 3300046809 Ga0495600_0001908 Ga0495600_0001908_2725_4326 476
408 3300047317 Ga0495604_0000946 Ga0495604_0000946_10209_11810 476
409 3300047321 Ga0495676_0000913 Ga0495676_0000913_7460_9061 476
410 3300047673 Ga0495593_0001354 Ga0495593_0001354_4932_6533 476
411 3300048089 Ga0495614_0016579 Ga0495614_0016579_405_2006 476
412 3300044765 Ga0466970_0001620 Ga0466970_0001620_3783_5411 477
413 3300046455 Ga0495603_0000850 Ga0495603_0000850_1998_3653 477
414 3300046459 Ga0495629_0002039 Ga0495629_0002039_13817_15472 477
415 3300046689 Ga0495613_0002320 Ga0495613_0002320_11420_13075 477
416 3300047321 Ga0495676_0002484 Ga0495676_0002484_4412_6067 477
417 3300003578 Ga0006562J51391_1188152 Ga0006562J51391_11881522 478
418 3300030522 Ga0307512_10109664 Ga0307512_101096642 478
419 3300033180 Ga0307510_10024814 Ga0307510_100248143 478
420 3300042138 Ga0450903_000328 Ga0450903_000328_4375_6003 478
421 3300044658 Ga0466972_0031961 Ga0466972_0031961_449_2077 478
422 3300044684 Ga0466966_0012382 Ga0466966_0012382_1008_2636 478
423 3300047443 Ga0495687_001311 Ga0495687_001311_7415_9025 478
424 3300049569 Ga0501032_0072338 Ga0501032_0072338_332_1957 478
425 3300049574 Ga0501038_0002636 Ga0501038_0002636_6446_8071 478
426 3300049581 Ga0501047_0062171 Ga0501047_0062171_759_2384 478
427 3300049742 Ga0501080_0020590 Ga0501080_0020590_3543_5168 478
428 3300049822 Ga0501035_0086971 Ga0501035_0086971_389_2014 478
429 3300049823 Ga0501044_0072131 Ga0501044_0072131_1127_2752 478
430 iso_pu_bacteria 2808606375 2808913453 478
431 iso_pu_bacteria 2873151551 2873154186 478
432 iso_pu_bacteria 2997600082 2997603009 478
433 iso_pu_bacteria 8054160619 8054161140 478
434 3300003322 rootL2_10007767 rootL2_100077674 479
435 3300005539 Ga0068853_100100069 Ga0068853_1001000693 479
436 3300005937 Ga0081455_10012607 Ga0081455_100126071 479
437 3300015688 Ga0183367_1002 Ga0183367_1002189 479
438 3300025302 Ga0207426_1009705 Ga0207426_10097053 479
439 3300026041 Ga0207639_10070151 Ga0207639_100701513 479
440 3300028786 Ga0307517_10002122 Ga0307517_100021228 479
441 3300028794 Ga0307515_10000699 Ga0307515_1000069932 479
442 3300030521 Ga0307511_10000438 Ga0307511_1000043815 479
443 3300030522 Ga0307512_10004491 Ga0307512_100044913 479
444 3300031456 Ga0307513_10022259 Ga0307513_100222593 479
445 3300031507 Ga0307509_10043047 Ga0307509_100430473 479
446 3300031616 Ga0307508_10001866 Ga0307508_1000186611 479
447 3300031616 Ga0307508_10011031 Ga0307508_100110315 479
448 3300031730 Ga0307516_10009907 Ga0307516_100099076 479
449 3300033179 Ga0307507_10015409 Ga0307507_100154095 479
450 3300037466 Ga0395898_0006384 Ga0395898_0006384_2918_4549 479
451 3300037466 Ga0395898_0065292 Ga0395898_0065292_507_2135 479
452 3300038443 Ga0395901_0196114 Ga0395901_0196114_244_1872 479
453 3300041404 Ga0439436_0012369 Ga0439436_0012369_61_1689 479
454 3300041512 Ga0451853_2445254 Ga0451853_2445254_156_1784 479
455 3300042014 Ga0439457_000227 Ga0439457_000227_13180_14808 479
456 3300042131 Ga0450894_000044 Ga0450894_000044_9856_11484 479
457 3300042145 Ga0450906_003098 Ga0450906_003098_908_2536 479
458 3300044658 Ga0466972_0016149 Ga0466972_0016149_590_2200 479
459 3300044683 Ga0466965_0000566 Ga0466965_0000566_5491_7101 479
460 3300044684 Ga0466966_0001405 Ga0466966_0001405_2714_4324 479
461 3300044693 Ga0466961_0001027 Ga0466961_0001027_4465_6075 479
462 3300044694 Ga0466963_0001259 Ga0466963_0001259_6316_7926 479
463 3300044694 Ga0466963_0003744 Ga0466963_0003744_147_1760 479
464 3300044719 Ga0466971_0001303 Ga0466971_0001303_398_2008 479
465 3300044765 Ga0466970_0057829 Ga0466970_0057829_67_1677 479
466 3300044842 Ga0466957_0000445 Ga0466957_0000445_10391_12001 479
467 3300045836 Ga0466958_0001212 Ga0466958_0001212_10099_11709 479
468 3300045976 Ga0466967_0001978 Ga0466967_0001978_10263_11891 479
469 3300045976 Ga0466967_0003250 Ga0466967_0003250_8789_10417 479
470 3300046455 Ga0495603_0003850 Ga0495603_0003850_2017_3627 479
471 3300046455 Ga0495603_0053276 Ga0495603_0053276_519_2150 479
472 3300046459 Ga0495629_0001340 Ga0495629_0001340_38_1693 479
473 3300046459 Ga0495629_0011903 Ga0495629_0011903_2823_4433 479
474 3300046459 Ga0495629_0026307 Ga0495629_0026307_1419_3029 479
475 3300046460 Ga0495638_0063751 Ga0495638_0063751_269_1900 479
476 3300046474 Ga0495605_0063442 Ga0495605_0063442_37_1647 479
477 3300046499 Ga0495594_0003561 Ga0495594_0003561_6309_7964 479
478 3300046507 Ga0495606_0011392 Ga0495606_0011392_97_1707 479
479 3300046512 Ga0495610_0050260 Ga0495610_0050260_15_1625 479
480 3300046513 Ga0495616_0066786 Ga0495616_0066786_112_1722 479
481 3300046514 Ga0495618_0046969 Ga0495618_0046969_900_2510 479
482 3300046518 Ga0495631_0012544 Ga0495631_0012544_161_1771 479
483 3300046528 Ga0495642_0016890 Ga0495642_0016890_66_1676 479
484 3300046529 Ga0495652_0022352 Ga0495652_0022352_3178_4788 479
485 3300046530 Ga0495654_0020479 Ga0495654_0020479_1722_3332 479
486 3300046558 Ga0495633_0022477 Ga0495633_0022477_128_1738 479
487 3300046616 Ga0495668_0009995 Ga0495668_0009995_1275_2885 479
488 3300046648 Ga0495611_0037758 Ga0495611_0037758_120_1751 479
489 3300046660 Ga0495625_0005273 Ga0495625_0005273_8989_10599 479
490 3300046663 Ga0495635_0025826 Ga0495635_0025826_358_1968 479
491 3300046665 Ga0495661_0063325 Ga0495661_0063325_99_1709 479
492 3300046674 Ga0495588_0007574 Ga0495588_0007574_292_1902 479
493 3300046675 Ga0495657_0106777 Ga0495657_0106777_106_1716 479
494 3300046679 Ga0495623_0059461 Ga0495623_0059461_58_1668 479
495 3300046689 Ga0495613_0041563 Ga0495613_0041563_29_1639 479
496 3300046689 Ga0495613_0131042 Ga0495613_0131042_129_1739 479
497 3300046694 Ga0495649_0038321 Ga0495649_0038321_30_1640 479
498 3300046794 Ga0495589_0006599 Ga0495589_0006599_1620_3251 479
499 3300046794 Ga0495589_0024134 Ga0495589_0024134_1303_2913 479
500 3300046809 Ga0495600_0011862 Ga0495600_0011862_1882_3492 479
501 3300047315 Ga0495581_0032945 Ga0495581_0032945_829_2439 479
502 3300047315 Ga0495581_0063066 Ga0495581_0063066_103_1713 479
503 3300047321 Ga0495676_0013360 Ga0495676_0013360_5677_7332 479
504 3300047321 Ga0495676_0031418 Ga0495676_0031418_711_2321 479
505 3300047322 Ga0495680_0013287 Ga0495680_0013287_2311_3921 479
506 3300047323 Ga0495683_0019121 Ga0495683_0019121_44_1675 479
507 3300047323 Ga0495683_0039048 Ga0495683_0039048_244_1854 479
508 3300047323 Ga0495683_0059486 Ga0495683_0059486_116_1726 479
509 3300047443 Ga0495687_001496 Ga0495687_001496_1887_3497 479
510 3300047444 Ga0495675_0114450 Ga0495675_0114450_54_1664 479
511 3300047447 Ga0495685_003865 Ga0495685_003865_1410_3020 479
512 3300047470 Ga0495681_0001659 Ga0495681_0001659_4443_6053 479
513 3300047472 Ga0495686_0011098 Ga0495686_0011098_1182_2810 479
514 3300048089 Ga0495614_0007729 Ga0495614_0007729_1106_2716 479
515 3300048091 Ga0495626_0025069 Ga0495626_0025069_1148_2758 479
516 3300049460 Ga0495682_0028778 Ga0495682_0028778_39_1649 479
517 3300049570 Ga0501033_0000756 Ga0501033_0000756_13565_15193 479
518 3300049570 Ga0501033_0010531 Ga0501033_0010531_2174_3784 479
519 3300049571 Ga0501034_0010815 Ga0501034_0010815_3240_4850 479
520 3300049572 Ga0501036_0039597 Ga0501036_0039597_452_2062 479
521 3300049573 Ga0501037_0002555 Ga0501037_0002555_7059_8669 479
522 3300049580 Ga0501046_0026575 Ga0501046_0026575_2310_3920 479
523 3300049581 Ga0501047_0047880 Ga0501047_0047880_2058_3668 479
524 3300049823 Ga0501044_0006283 Ga0501044_0006283_4544_6154 479
525 3300049823 Ga0501044_0042826 Ga0501044_0042826_1444_3072 479
526 3300050490 nmdc:mga03n38_9299_c1 nmdc:mga03n38_9299_c1_1028_2656 479
527 3300053107 Ga0500560_000162 Ga0500560_000162_1726_3336 479
528 3300061719 Ga0466962_0010310 Ga0466962_0010310_2586_4196 479
529 iso_pu_bacteria 2867475112 2867477636 479
530 iso_pu_bacteria 2997451912 2997453208 479
531 3300044658 Ga0466972_0009735 Ga0466972_0009735_583_2220 480
532 3300002067 JGI24735J21928_10015630 JGI24735J21928_100156302 482
533 3300006042 Ga0075368_10005467 Ga0075368_100054674 482
534 3300006178 Ga0075367_10003844 Ga0075367_100038443 482
535 3300013105 Ga0157369_10086089 Ga0157369_100860892 482
536 3300014497 Ga0182008_10001039 Ga0182008_1000103916 482
537 3300015262 Ga0182007_10000456 Ga0182007_1000045610 482
538 3300015265 Ga0182005_1010631 Ga0182005_10106311 482
539 3300025904 Ga0207647_10014132 Ga0207647_100141325 482
540 3300027866 Ga0209813_10002304 Ga0209813_100023044 482
541 3300041406 Ga0439439_0011540 Ga0439439_0011540_200_1837 482
542 3300042007 Ga0439449_0003395 Ga0439449_0003395_3713_5332 482
543 3300042014 Ga0439457_000096 Ga0439457_000096_6106_7743 482
544 3300050494 nmdc:mga06z11_6884_c1 nmdc:mga06z11_6884_c1_925_2553 482
545 3300050495 nmdc:mga04h51_2502_c1 nmdc:mga04h51_2502_c1_2525_4153 482

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00474

SSF

Sodium:solute symporter family

55

463

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nv9-assembly1.cif.gz_A substrate-bound outward-open state of a na+-coupled sialic acid symporter reveals a novel na+-site 0.6664 8 422
8hez-assembly1.cif.gz_A structure of human sglt2-map17 complex with dapagliflozin 0.6186 6 417
8hdh-assembly1.cif.gz_A structure of human sglt2-map17 complex with canagliflozin 0.6083 6 417
8fhp-assembly1.cif.gz_A cryo-em structure of human ncc (class 3-1) 0.6065 48 417
8hin-assembly1.cif.gz_A structure of human sglt2-map17 complex with phlorizin 0.5863 8 417
ID Description Score Start End Superfamily
af_P32705_52_542_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.7479 27 421 1.20.1730.10
af_A0A0H2UJX9_34_534_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.7168 37 422 1.20.1730.10
af_Q9W3R0_60_567_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.7029 44 422 1.20.1730.10
af_Q59UP3_34_539_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.6954 35 423 1.20.1730.10
af_A0A1D8PDB5_36_538_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.6927 38 422 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A2W6BI68-F1-model_v4 Sodium:solute symporter 0.9292 10 315 GO:0005886
GO:0022857
AF-A0A2W6BI68-F1-model_v4 Sodium:solute symporter 0.9004 10 315 GO:0005886
GO:0022857
AF-A0A402A2P0-F1-model_v4 Sodium:solute symporter 0.8928 8 422 GO:0005886
GO:0022857
AF-A0A653PZ41-F1-model_v4 Monocarboxylate transport permease protein 0.8921 1 401 GO:0005886
GO:0022857
AF-S3B1B6-F1-model_v4 Solute:sodium symporter (SSS) family transporter 0.8851 1 466 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
69.87 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map