F461851

General Info

Members Datasets Scaffolds Average Seq Length
545 276 1090 146

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10501670|Ga0111539_105016704
Length 163
Sequence MTPTSTSSTDKTASSQTDSISFEFDLHHPPEKVWRALTDPALLAEWLLPVLDLPPKLEPGAAFKFKREPMPGWDGAVHCRLLEIEARRKLSYTWVVGDMHTVVTFTLTATGGGADGEVGGAGGTRLSLVQSGFKPDQKQNFGGARYGWRMMGGKLVELLAKIA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
191 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
192 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
193 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
194 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
197 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
239 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
240 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
241 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
242 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
268 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
269 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
276 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.3
Nodule 0
Rhizoplane 2.39
Rhizosphere 92.29
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10501670 3300009094 Bacteria 1413
2 JGI25406J46586_10057853 3300003203 Bacteria 1266
3 Ga0065704_10271550 3300005289 Bacteria 934
4 Ga0065712_10074032 3300005290 Bacteria 4205
5 Ga0065712_10078581 3300005290 Bacteria 3328
6 Ga0065715_10306861 3300005293 Bacteria 1029
7 Ga0065715_10661219 3300005293 Bacteria 673
8 Ga0065707_10004240 3300005295 Bacteria 4441
9 Ga0065707_10087606 3300005295 Bacteria 4953
10 Ga0065707_10105865 3300005295 Bacteria 2625
11 Ga0065707_10710494 3300005295 Bacteria 635
12 Ga0070683_100013805 3300005329 Bacteria 7053
13 Ga0070690_100105683 3300005330 Bacteria 1872
14 Ga0070690_100587770 3300005330 Bacteria 844
15 Ga0070670_100026959 3300005331 Bacteria 4942
16 Ga0070670_100198731 3300005331 Bacteria 1742
17 Ga0070670_100522458 3300005331 Bacteria 1057
18 Ga0070670_100531596 3300005331 Bacteria 1048
19 Ga0068869_100005810 3300005334 Bacteria 7787
20 Ga0068869_100129557 3300005334 Bacteria 1938
21 Ga0070680_100068691 3300005336 Bacteria 2909
22 Ga0070682_100104672 3300005337 Bacteria 1874
23 Ga0070660_100253012 3300005339 Bacteria 1437
24 Ga0070689_100023319 3300005340 Bacteria 4632
25 Ga0070689_100175518 3300005340 Bacteria 1738
26 Ga0070691_10486655 3300005341 Bacteria 711
27 Ga0070687_100368930 3300005343 Bacteria 932
28 Ga0070661_100035080 3300005344 Bacteria 3641
29 Ga0070661_101352475 3300005344 Unclassified 598
30 Ga0070692_10521241 3300005345 Bacteria 774
31 Ga0070668_100046321 3300005347 Bacteria 3339
32 Ga0070668_100128622 3300005347 Bacteria 2031
33 Ga0070669_100019350 3300005353 Bacteria 4863
34 Ga0070669_100407193 3300005353 Bacteria 1114
35 Ga0070669_101269876 3300005353 Bacteria 637
36 Ga0070675_100045210 3300005354 Bacteria 3602
37 Ga0070675_100095928 3300005354 Bacteria 2491
38 Ga0070675_100146688 3300005354 Bacteria 2021
39 Ga0070671_100387379 3300005355 Bacteria 1195
40 Ga0070674_100593913 3300005356 Bacteria 935
41 Ga0070673_100195016 3300005364 Bacteria 1741
42 Ga0070673_100575849 3300005364 Bacteria 1025
43 Ga0070688_100310999 3300005365 Bacteria 1142
44 Ga0070688_100442485 3300005365 Bacteria 970
45 Ga0070659_101790512 3300005366 Bacteria 550
46 Ga0070667_100334458 3300005367 Bacteria 1369
47 Ga0070667_100650580 3300005367 Bacteria 973
48 Ga0070667_101148275 3300005367 Unclassified 726
49 Ga0070667_101889880 3300005367 Bacteria 562
50 Ga0070701_10036795 3300005438 Bacteria 2468
51 Ga0070701_10227582 3300005438 Bacteria 1115
52 Ga0070711_100936668 3300005439 Bacteria 741
53 Ga0070705_100986230 3300005440 Bacteria 683
54 Ga0070705_101278109 3300005440 Bacteria 607
55 Ga0070700_100123126 3300005441 Bacteria 1740
56 Ga0070700_101423262 3300005441 Bacteria 587
57 Ga0070700_101506720 3300005441 Bacteria 572
58 Ga0070694_100014558 3300005444 Bacteria 4924
59 Ga0070694_100055418 3300005444 Bacteria 2689
60 Ga0070708_100286754 3300005445 Bacteria 1550
61 Ga0070678_100090580 3300005456 Bacteria 2345
62 Ga0070678_100813575 3300005456 Bacteria 849
63 Ga0070662_100000644 3300005457 Bacteria 21098
64 Ga0070662_100089915 3300005457 Bacteria 2304
65 Ga0070662_100196330 3300005457 Bacteria 1599
66 Ga0070662_100564478 3300005457 Bacteria 955
67 Ga0070662_101534681 3300005457 Bacteria 575
68 Ga0070681_10239179 3300005458 Bacteria 1729
69 Ga0070681_10633940 3300005458 Bacteria 983
70 Ga0068867_100032347 3300005459 Bacteria 3783
71 Ga0070685_10006490 3300005466 Bacteria 5965
72 Ga0070706_100019276 3300005467 Bacteria 6292
73 Ga0070707_100977230 3300005468 Bacteria 812
74 Ga0070707_101476351 3300005468 Bacteria 647
75 Ga0070698_100133911 3300005471 Bacteria 2433
76 Ga0070698_100188815 3300005471 Bacteria 1998
77 Ga0070679_100021153 3300005530 Bacteria 6347
78 Ga0070679_100072849 3300005530 Bacteria 3427
79 Ga0070684_100773181 3300005535 Bacteria 897
80 Ga0070684_101115927 3300005535 Bacteria 741
81 Ga0070697_100390460 3300005536 Bacteria 1206
82 Ga0068853_100230135 3300005539 Bacteria 1696
83 Ga0070672_100063095 3300005543 Bacteria 2926
84 Ga0070672_101103015 3300005543 Bacteria 705
85 Ga0070695_100000771 3300005545 Bacteria 17244
86 Ga0070696_100003850 3300005546 Bacteria 10021
87 Ga0070696_100400291 3300005546 Bacteria 1074
88 Ga0070693_100035712 3300005547 Bacteria 2758
89 Ga0070693_100254796 3300005547 Bacteria 1165
90 Ga0070665_100373412 3300005548 Bacteria 1433
91 Ga0070665_100446336 3300005548 Bacteria 1303
92 Ga0070704_100052274 3300005549 Bacteria 2882
93 Ga0070704_101690047 3300005549 Bacteria 585
94 Ga0068855_100453686 3300005563 Bacteria 1398
95 Ga0070664_100051190 3300005564 Bacteria 3497
96 Ga0068857_100751559 3300005577 Bacteria 929
97 Ga0068856_100383082 3300005614 Bacteria 1425
98 Ga0070702_100009281 3300005615 Bacteria 4809
99 Ga0068852_101573815 3300005616 Bacteria 680
100 Ga0068859_100394870 3300005617 Bacteria 1479
101 Ga0068859_100394978 3300005617 Bacteria 1479
102 Ga0068859_100405110 3300005617 Bacteria 1460
103 Ga0068859_100449719 3300005617 Bacteria 1384
104 Ga0068859_100764612 3300005617 Bacteria 1055
105 Ga0068859_100858242 3300005617 Bacteria 994
106 Ga0068859_101544168 3300005617 Bacteria 733
107 Ga0068859_101886336 3300005617 Unclassified 660
108 Ga0068864_100034018 3300005618 Bacteria 4333
109 Ga0068864_100636216 3300005618 Bacteria 1038
110 Ga0068864_101195119 3300005618 Bacteria 759
111 Ga0068866_10269121 3300005718 Bacteria 1051
112 Ga0068866_10513680 3300005718 Bacteria 795
113 Ga0068851_10099069 3300005834 Bacteria 1544
114 Ga0068870_10041403 3300005840 Bacteria 2393
115 Ga0068870_10491212 3300005840 Bacteria 816
116 Ga0068870_10561580 3300005840 Bacteria 770
117 Ga0068863_100320125 3300005841 Bacteria 1506
118 Ga0068863_101234390 3300005841 Bacteria 754
119 Ga0068863_102099650 3300005841 Unclassified 575
120 Ga0068858_100341228 3300005842 Bacteria 1434
121 Ga0068858_100365996 3300005842 Bacteria 1382
122 Ga0068858_101016212 3300005842 Bacteria 813
123 Ga0068860_100081236 3300005843 Bacteria 3082
124 Ga0068860_100193858 3300005843 Bacteria 1967
125 Ga0068860_101741842 3300005843 Unclassified 645
126 Ga0068862_100051637 3300005844 Bacteria 3517
127 Ga0068862_100646360 3300005844 Bacteria 1020
128 Ga0068862_101593612 3300005844 Bacteria 660
129 Ga0081455_10089696 3300005937 Bacteria 2494
130 Ga0081539_10028083 3300005985 Bacteria 3545
131 Ga0075368_10327560 3300006042 Bacteria 664
132 Ga0075364_10026696 3300006051 Bacteria 3686
133 Ga0075364_10404131 3300006051 Bacteria 932
134 Ga0075432_10146510 3300006058 Bacteria 904
135 Ga0075367_10051727 3300006178 Bacteria 2429
136 Ga0075366_10063000 3300006195 Bacteria 2204
137 Ga0075366_10183554 3300006195 Bacteria 1271
138 Ga0097621_100181084 3300006237 Bacteria 1821
139 Ga0097621_101552014 3300006237 Unclassified 629
140 Ga0068871_100150976 3300006358 Bacteria 1981
141 Ga0068871_100878023 3300006358 Bacteria 830
142 Ga0075428_100003667 3300006844 Bacteria 16839
143 Ga0075428_100004609 3300006844 Bacteria 15243
144 Ga0075428_100023146 3300006844 Bacteria 6872
145 Ga0075428_100036382 3300006844 Bacteria 5422
146 Ga0075428_100045446 3300006844 Bacteria 4825
147 Ga0075428_100117715 3300006844 Bacteria 2894
148 Ga0075428_100382209 3300006844 Bacteria 1509
149 Ga0075428_100416322 3300006844 Bacteria 1440
150 Ga0075428_100547905 3300006844 Bacteria 1236
151 Ga0075428_100735630 3300006844 Bacteria 1050
152 Ga0075428_101798071 3300006844 Bacteria 638
153 Ga0075428_102569124 3300006844 Bacteria 521
154 Ga0075430_100070679 3300006846 Bacteria 2927
155 Ga0075430_100099726 3300006846 Bacteria 2426
156 Ga0075430_100113615 3300006846 Bacteria 2257
157 Ga0075430_100162232 3300006846 Bacteria 1860
158 Ga0075430_100238650 3300006846 Bacteria 1506
159 Ga0075430_100253921 3300006846 Bacteria 1457
160 Ga0075430_100802547 3300006846 Bacteria 776
161 Ga0075431_100019896 3300006847 Bacteria 6854
162 Ga0075431_100069786 3300006847 Bacteria 3625
163 Ga0075431_100092015 3300006847 Bacteria 3130
164 Ga0075431_100152662 3300006847 Bacteria 2378
165 Ga0075431_100175892 3300006847 Bacteria 2199
166 Ga0075431_100354336 3300006847 Bacteria 1475
167 Ga0075431_100406774 3300006847 Bacteria 1361
168 Ga0075433_10338180 3300006852 Bacteria 1331
169 Ga0075434_100170412 3300006871 Bacteria 2197
170 Ga0075434_101269207 3300006871 Bacteria 748
171 Ga0075429_100011017 3300006880 Bacteria 7823
172 Ga0075429_100014064 3300006880 Bacteria 6936
173 Ga0075429_100034903 3300006880 Bacteria 4371
174 Ga0075429_100130794 3300006880 Bacteria 2195
175 Ga0075429_100382733 3300006880 Bacteria 1232
176 Ga0075429_100508441 3300006880 Bacteria 1056
177 Ga0075429_100770527 3300006880 Bacteria 843
178 Ga0075429_101404439 3300006880 Bacteria 608
179 Ga0068865_100301666 3300006881 Bacteria 1282
180 Ga0068865_100533934 3300006881 Bacteria 983
181 Ga0075436_100240964 3300006914 Bacteria 1286
182 Ga0075436_100304097 3300006914 Bacteria 1143
183 Ga0097620_100394844 3300006931 Bacteria 1479
184 Ga0097620_100394988 3300006931 Bacteria 1479
185 Ga0097620_100405106 3300006931 Bacteria 1460
186 Ga0097620_100449720 3300006931 Bacteria 1384
187 Ga0097620_100764603 3300006931 Bacteria 1055
188 Ga0097620_100858184 3300006931 Bacteria 994
189 Ga0097620_101544518 3300006931 Bacteria 733
190 Ga0075435_100206587 3300007076 Bacteria 1665
191 Ga0099794_10369707 3300007265 Bacteria 747
192 Ga0099794_10516836 3300007265 Bacteria 629
193 Ga0105240_11845156 3300009093 Bacteria 630
194 Ga0111539_10008548 3300009094 Bacteria 13002
195 Ga0111539_10011349 3300009094 Bacteria 11187
196 Ga0111539_10016428 3300009094 Bacteria 9176
197 Ga0111539_10190036 3300009094 Bacteria 2396
198 Ga0111539_10397861 3300009094 Bacteria 1604
199 Ga0111539_10609457 3300009094 Bacteria 1271
200 Ga0111539_11115415 3300009094 Bacteria 917
201 Ga0111539_11776136 3300009094 Bacteria 715
202 Ga0105245_10162928 3300009098 Bacteria 2117
203 Ga0105245_11476280 3300009098 Bacteria 730
204 Ga0105245_11643347 3300009098 Bacteria 694
205 Ga0114129_10027998 3300009147 Bacteria 7981
206 Ga0114129_10028869 3300009147 Bacteria 7860
207 Ga0114129_10785462 3300009147 Bacteria 1216
208 Ga0114129_11337576 3300009147 Bacteria 886
209 Ga0114129_12075727 3300009147 Bacteria 686
210 Ga0114129_12775959 3300009147 Bacteria 583
211 Ga0105243_10189602 3300009148 Bacteria 1795
212 Ga0105243_10416742 3300009148 Bacteria 1251
213 Ga0105241_10331021 3300009174 Bacteria 1316
214 Ga0105241_10584535 3300009174 Bacteria 1007
215 Ga0105241_11906641 3300009174 Bacteria 583
216 Ga0105241_12408625 3300009174 Bacteria 526
217 Ga0105242_10067935 3300009176 Bacteria 2948
218 Ga0105242_10421148 3300009176 Bacteria 1251
219 Ga0105242_10955448 3300009176 Bacteria 861
220 Ga0105248_10017545 3300009177 Bacteria 7894
221 Ga0105248_10135375 3300009177 Bacteria 2779
222 Ga0105248_10592977 3300009177 Bacteria 1250
223 Ga0105238_10000081 3300009551 Bacteria 107822
224 Ga0105238_10457706 3300009551 Bacteria 1273
225 Ga0105249_10003661 3300009553 Bacteria 13263
226 Ga0105239_10133221 3300010375 Bacteria 2765
227 Ga0105239_10443373 3300010375 Bacteria 1472
228 Ga0105246_10410027 3300011119 Bacteria 1128
229 Ga0105246_11112936 3300011119 Bacteria 722
230 Ga0157373_10129641 3300013100 Bacteria 1773
231 Ga0157371_10152864 3300013102 Bacteria 1646
232 Ga0157369_10194325 3300013105 Bacteria 2131
233 Ga0157374_10019988 3300013296 Bacteria 5937
234 Ga0163162_10155304 3300013306 Bacteria 2408
235 Ga0163162_10223981 3300013306 Bacteria 2010
236 Ga0163162_11507507 3300013306 Bacteria 766
237 Ga0163162_11535361 3300013306 Bacteria 759
238 Ga0157372_10014898 3300013307 Bacteria 8325
239 Ga0157372_10056125 3300013307 Bacteria 4401
240 Ga0157372_10158354 3300013307 Bacteria 2616
241 Ga0157375_10005091 3300013308 Bacteria 11407
242 Ga0157375_10339333 3300013308 Bacteria 1668
243 Ga0157375_10358127 3300013308 Bacteria 1625
244 Ga0157375_10642976 3300013308 Bacteria 1217
245 Ga0157375_10679825 3300013308 Bacteria 1184
246 Ga0157375_10821843 3300013308 Bacteria 1077
247 Ga0157375_10861927 3300013308 Unclassified 1052
248 Ga0157375_11792523 3300013308 Bacteria 728
249 Ga0163163_10014524 3300014325 Bacteria 7244
250 Ga0163163_10016127 3300014325 Bacteria 6932
251 Ga0163163_10034687 3300014325 Bacteria 4889
252 Ga0163163_10329639 3300014325 Bacteria 1581
253 Ga0157380_10008728 3300014326 Bacteria 7242
254 Ga0157380_10470768 3300014326 Bacteria 1212
255 Ga0157377_10038036 3300014745 Bacteria 2655
256 Ga0157379_10228379 3300014968 Bacteria 1687
257 Ga0157379_10580300 3300014968 Bacteria 1045
258 Ga0157379_10935022 3300014968 Bacteria 824
259 Ga0157376_10070616 3300014969 Bacteria 2965
260 Ga0157376_10171662 3300014969 Bacteria 1975
261 Ga0157376_10505544 3300014969 Bacteria 1188
262 Ga0207656_10102180 3300025321 Bacteria 1315
263 Ga0207653_10236702 3300025885 Bacteria 697
264 Ga0207682_10159244 3300025893 Bacteria 1022
265 Ga0207642_11081140 3300025899 Bacteria 518
266 Ga0207688_10199435 3300025901 Bacteria 1199
267 Ga0207645_10150440 3300025907 Bacteria 1519
268 Ga0207643_10015166 3300025908 Bacteria 4192
269 Ga0207643_10077742 3300025908 Bacteria 1919
270 Ga0207684_10275148 3300025910 Bacteria 1452
271 Ga0207654_10332708 3300025911 Bacteria 1041
272 Ga0207660_10522071 3300025917 Bacteria 964
273 Ga0207660_10599020 3300025917 Bacteria 897
274 Ga0207662_10206985 3300025918 Bacteria 1272
275 Ga0207657_10076734 3300025919 Bacteria 2818
276 Ga0207652_10213928 3300025921 Bacteria 1736
277 Ga0207652_10249624 3300025921 Bacteria 1600
278 Ga0207681_10009558 3300025923 Bacteria 5925
279 Ga0207694_10000074 3300025924 Bacteria 118396
280 Ga0207694_10722248 3300025924 Bacteria 840
281 Ga0207650_10252670 3300025925 Bacteria 1427
282 Ga0207650_10936241 3300025925 Bacteria 736
283 Ga0207659_10739477 3300025926 Bacteria 843
284 Ga0207687_10722891 3300025927 Unclassified 846
285 Ga0207687_11069233 3300025927 Bacteria 693
286 Ga0207687_11526625 3300025927 Bacteria 574
287 Ga0207644_10704384 3300025931 Bacteria 842
288 Ga0207644_11117522 3300025931 Bacteria 662
289 Ga0207690_10436413 3300025932 Bacteria 1050
290 Ga0207690_11161711 3300025932 Bacteria 644
291 Ga0207706_10000106 3300025933 Bacteria 88479
292 Ga0207706_10004475 3300025933 Bacteria 13127
293 Ga0207706_10309705 3300025933 Bacteria 1375
294 Ga0207706_11050621 3300025933 Bacteria 682
295 Ga0207686_10010738 3300025934 Bacteria 4988
296 Ga0207709_10224246 3300025935 Bacteria 1357
297 Ga0207709_10453046 3300025935 Bacteria 992
298 Ga0207709_10576251 3300025935 Bacteria 888
299 Ga0207670_10008264 3300025936 Bacteria 5864
300 Ga0207670_10229131 3300025936 Bacteria 1426
301 Ga0207669_10834223 3300025937 Bacteria 766
302 Ga0207704_10668106 3300025938 Bacteria 857
303 Ga0207691_10022076 3300025940 Bacteria 6005
304 Ga0207691_10062156 3300025940 Bacteria 3390
305 Ga0207691_10600177 3300025940 Bacteria 932
306 Ga0207691_10664095 3300025940 Bacteria 880
307 Ga0207691_11092190 3300025940 Bacteria 664
308 Ga0207691_11186068 3300025940 Bacteria 633
309 Ga0207711_10024132 3300025941 Bacteria 5090
310 Ga0207711_10218044 3300025941 Bacteria 1744
311 Ga0207711_10789213 3300025941 Bacteria 885
312 Ga0207689_10001170 3300025942 Bacteria 25266
313 Ga0207689_10612940 3300025942 Bacteria 916
314 Ga0207661_10029710 3300025944 Bacteria 4202
315 Ga0207679_10035599 3300025945 Bacteria 3524
316 Ga0207679_10101987 3300025945 Bacteria 2246
317 Ga0207679_10310258 3300025945 Bacteria 1363
318 Ga0207679_11683878 3300025945 Bacteria 581
319 Ga0207651_10311113 3300025960 Bacteria 1313
320 Ga0207712_10003746 3300025961 Bacteria 9596
321 Ga0207712_10388160 3300025961 Bacteria 1170
322 Ga0207668_10665472 3300025972 Bacteria 912
323 Ga0207640_11810144 3300025981 Bacteria 552
324 Ga0207658_10115209 3300025986 Bacteria 2133
325 Ga0207677_10434784 3300026023 Bacteria 1121
326 Ga0207677_10548195 3300026023 Bacteria 1007
327 Ga0207703_10285923 3300026035 Bacteria 1499
328 Ga0207703_10358586 3300026035 Bacteria 1344
329 Ga0207639_10135061 3300026041 Bacteria 2047
330 Ga0207708_10631619 3300026075 Bacteria 910
331 Ga0207708_10687847 3300026075 Bacteria 873
332 Ga0207708_11016202 3300026075 Bacteria 721
333 Ga0207641_10670989 3300026088 Bacteria 1019
334 Ga0207648_10214711 3300026089 Bacteria 1709
335 Ga0207648_11608954 3300026089 Bacteria 610
336 Ga0207676_10743208 3300026095 Bacteria 953
337 Ga0207676_12100912 3300026095 Bacteria 563
338 Ga0207674_10014174 3300026116 Bacteria 8811
339 Ga0207674_10067736 3300026116 Bacteria 3593
340 Ga0207675_100308714 3300026118 Bacteria 1542
341 Ga0207675_100463651 3300026118 Bacteria 1257
342 Ga0207675_101043301 3300026118 Bacteria 837
343 Ga0207675_101286199 3300026118 Bacteria 752
344 Ga0207683_10108894 3300026121 Bacteria 2479
345 Ga0207698_11074611 3300026142 Bacteria 817
346 Ga0209588_1221013 3300027671 Bacteria 585
347 Ga0209813_10215068 3300027866 Bacteria 717
348 Ga0207428_10021189 3300027907 Bacteria 5505
349 Ga0207428_10090827 3300027907 Bacteria 2371
350 Ga0207428_10170884 3300027907 Bacteria 1646
351 Ga0207428_10211135 3300027907 Bacteria 1458
352 Ga0207428_10283994 3300027907 Bacteria 1228
353 Ga0207428_10336493 3300027907 Bacteria 1112
354 Ga0207428_10367877 3300027907 Bacteria 1056
355 Ga0268266_10087423 3300028379 Bacteria 2727
356 Ga0268266_10294566 3300028379 Bacteria 1512
357 Ga0268265_10084448 3300028380 Bacteria 2516
358 Ga0268264_10108192 3300028381 Bacteria 2430
359 Ga0268264_10396459 3300028381 Bacteria 1325
360 Ga0268264_10450365 3300028381 Bacteria 1247
361 Ga0268264_12274055 3300028381 Bacteria 549
362 Ga0307517_10255149 3300028786 Bacteria 1024
363 Ga0307511_10156656 3300030521 Bacteria 1291
364 Ga0307511_10227710 3300030521 Bacteria 927
365 Ga0307513_10828331 3300031456 Bacteria 632
366 Ga0307509_10000111 3300031507 Bacteria 117078
367 Ga0307408_101143794 3300031548 Bacteria 724
368 Ga0307405_10141003 3300031731 Bacteria 1681
369 Ga0307405_10561783 3300031731 Bacteria 925
370 Ga0307405_10976452 3300031731 Bacteria 721
371 Ga0307410_10124179 3300031852 Bacteria 1887
372 Ga0307410_10795205 3300031852 Bacteria 804
373 Ga0307406_10970501 3300031901 Bacteria 727
374 Ga0307407_10027141 3300031903 Bacteria 3042
375 Ga0307412_10613439 3300031911 Bacteria 923
376 Ga0307412_11089259 3300031911 Bacteria 710
377 Ga0307412_11311610 3300031911 Bacteria 652
378 Ga0307412_12108431 3300031911 Bacteria 523
379 Ga0307409_100041494 3300031995 Bacteria 3438
380 Ga0307409_100918938 3300031995 Bacteria 890
381 Ga0307416_100105393 3300032002 Bacteria 2468
382 Ga0307416_100297551 3300032002 Bacteria 1602
383 Ga0307416_100969303 3300032002 Bacteria 953
384 Ga0307416_102475774 3300032002 Bacteria 618
385 Ga0307414_10286449 3300032004 Bacteria 1387
386 Ga0307414_11720477 3300032004 Bacteria 585
387 Ga0307411_10376427 3300032005 Bacteria 1166
388 Ga0307411_10648520 3300032005 Bacteria 914
389 Ga0307415_100234586 3300032126 Bacteria 1480
390 Ga0373928_0262534 3300035084 Bacteria 518
391 Ga0373932_0252285 3300035112 Bacteria 644
392 Ga0373954_0095424 3300035118 Bacteria 1432
393 Ga0373946_0337847 3300035171 Bacteria 751
394 Ga0373931_0014828 3300035691 Bacteria 3816
395 Ga0373931_0196228 3300035691 Bacteria 1203
396 Ga0373937_0067231 3300036401 Bacteria 3302
397 Ga0373937_0340783 3300036401 Bacteria 1420
398 Ga0395900_0660990 3300037418 Bacteria 981
399 Ga0395898_0690073 3300037466 Bacteria 963
400 Ga0395905_0252604 3300037471 Bacteria 1647
401 Ga0395905_0277166 3300037471 Bacteria 1563
402 Ga0395905_0566788 3300037471 Bacteria 1037
403 Ga0436364_0113153 3300037853 Bacteria 4790
404 Ga0395901_0594849 3300038443 Bacteria 1116
405 Ga0436365_1435256 3300039437 Bacteria 723
406 Ga0451793_0085848 3300041452 Unclassified 516
407 Ga0451798_0405581 3300041458 Bacteria 750
408 Ga0451802_0946939 3300041460 Bacteria 934
409 Ga0451807_1700066 3300041486 Bacteria 557
410 Ga0451807_2604428 3300041486 Bacteria 1199
411 Ga0451849_0994085 3300041505 Bacteria 2523
412 Ga0451853_3516985 3300041512 Bacteria 1577
413 Ga0439455_0187314 3300042012 Bacteria 597
414 Ga0450908_057027 3300042184 Bacteria 683
415 Ga0451577_0081854 3300042876 Bacteria 2880
416 Ga0466972_0059817 3300044658 Bacteria 1828
417 Ga0466965_0264240 3300044683 Bacteria 926
418 Ga0466961_0308638 3300044693 Bacteria 966
419 Ga0466960_0368568 3300044901 Bacteria 822
420 Ga0451576_0034656 3300045051 Bacteria 5360
421 Ga0451576_0096004 3300045051 Bacteria 3083
422 Ga0451576_0320543 3300045051 Bacteria 1622
423 Ga0451576_0621607 3300045051 Bacteria 1135
424 Ga0495592_0074020 3300046454 Bacteria 2475
425 Ga0495638_0217017 3300046460 Bacteria 1071
426 Ga0495582_0165344 3300046473 Bacteria 1259
427 Ga0495628_0009662 3300046516 Bacteria 8231
428 Ga0495598_0034462 3300046537 Bacteria 1444
429 Ga0495645_0309372 3300046543 Bacteria 1029
430 Ga0495633_0352264 3300046558 Bacteria 667
431 Ga0495667_0773594 3300046559 Bacteria 593
432 Ga0495658_0027254 3300046683 Bacteria 3072
433 Ga0495581_0009709 3300047315 Bacteria 5571
434 Ga0495672_0191207 3300047320 Bacteria 1029
435 Ga0495615_0178507 3300048090 Bacteria 646
436 Ga0496100_0100242 3300048903 Bacteria 1995
437 Ga0496105_0979236 3300048908 Bacteria 634
438 Ga0496108_0092824 3300048911 Bacteria 2567
439 Ga0496109_0084925 3300048912 Bacteria 2921
440 Ga0496110_0141907 3300048913 Bacteria 2172
441 Ga0496112_0041460 3300048915 Bacteria 4504
442 Ga0496113_0016458 3300048916 Bacteria 5109
443 Ga0496115_0121320 3300048918 Bacteria 2151
444 Ga0496126_0456212 3300048929 Bacteria 1028
445 Ga0501031_0262948 3300049568 Bacteria 1121
446 Ga0501034_0534979 3300049571 Bacteria 1082
447 Ga0501039_0784315 3300049575 Bacteria 744
448 Ga0501041_0063250 3300049577 Bacteria 2266
449 Ga0501047_0598014 3300049581 Bacteria 925
450 Ga0501067_0143343 3300049583 Bacteria 1331
451 Ga0501068_0295899 3300049584 Bacteria 1036
452 Ga0501068_1204677 3300049584 Bacteria 502
453 Ga0501069_0427450 3300049585 Bacteria 786
454 Ga0501071_0084699 3300049587 Bacteria 2324
455 Ga0501072_0256615 3300049588 Bacteria 1392
456 Ga0501074_1229410 3300049590 Bacteria 525
457 Ga0501076_0137529 3300049592 Bacteria 1984
458 Ga0501076_0348179 3300049592 Bacteria 1216
459 Ga0501076_0690435 3300049592 Bacteria 843
460 Ga0501077_0042310 3300049593 Bacteria 2897
461 Ga0501077_0541625 3300049593 Bacteria 747
462 Ga0501217_064871 3300049661 Bacteria 983
463 Ga0501224_016608 3300049664 Bacteria 1092
464 Ga0501233_076604 3300049668 Bacteria 855
465 Ga0501242_006975 3300049674 Bacteria 1297
466 Ga0501248_006137 3300049678 Bacteria 968
467 Ga0501249_046847 3300049679 Bacteria 988
468 Ga0501253_058198 3300049683 Bacteria 826
469 Ga0501079_0061210 3300049741 Bacteria 2904
470 Ga0501079_0191344 3300049741 Bacteria 1597
471 Ga0501079_0222729 3300049741 Bacteria 1474
472 Ga0501079_0331874 3300049741 Bacteria 1191
473 Ga0501079_0924920 3300049741 Unclassified 687
474 Ga0501080_0305944 3300049742 Bacteria 1441
475 Ga0501081_0063200 3300049743 Bacteria 2569
476 Ga0501081_0106881 3300049743 Bacteria 1984
477 Ga0501083_0346460 3300049744 Unclassified 966
478 Ga0501283_015749 3300049779 Bacteria 1167
479 Ga0501044_0261665 3300049823 Bacteria 1668
480 Ga0501045_0680660 3300049824 Bacteria 759
481 nmdc:mga00v17_53577_c1 3300050491 Bacteria 2459
482 nmdc:mga00v17_82821_c1 3300050491 Bacteria 1634
483 nmdc:mga0k408_93437_c1 3300050493 Bacteria 1768
484 nmdc:mga06z11_210138_c1 3300050494 Bacteria 1134
485 nmdc:mga04h51_132031_c1 3300050495 Bacteria 940
486 nmdc:mga07m45_608322_c1 3300050496 Bacteria 631
487 nmdc:mga05p37_1143502_c1 3300050507 Bacteria 810
488 nmdc:mga05p37_1390103_c1 3300050507 Bacteria 708
489 nmdc:mga05p37_1521239_c1 3300050507 Bacteria 665
490 nmdc:mga05p37_282166_c1 3300050507 Bacteria 1980
491 nmdc:mga05p37_48_c1 3300050507 Bacteria 104863
492 nmdc:mga05p37_535541_c1 3300050507 Bacteria 1336
493 nmdc:mga05p37_6863_c1 3300050507 Bacteria 13419
494 nmdc:mga05p37_786515_c1 3300050507 Bacteria 1043
495 nmdc:mga09592_11275_c1 3300050508 Bacteria 7273
496 nmdc:mga09592_23871_c1 3300050508 Bacteria 5054
497 nmdc:mga09592_364673_c1 3300050508 Bacteria 1250
498 nmdc:mga09592_530569_c1 3300050508 Bacteria 1012
499 nmdc:mga09592_57185_c1 3300050508 Bacteria 3296
500 nmdc:mga09592_790197_c1 3300050508 Bacteria 803
501 nmdc:mga0qj67_137563_c1 3300050509 Bacteria 1979
502 nmdc:mga0qj67_15164_c1 3300050509 Bacteria 5831
503 nmdc:mga0qj67_230545_c1 3300050509 Bacteria 1503
504 nmdc:mga0qj67_35469_c1 3300050509 Bacteria 3900
505 nmdc:mga0qj67_48641_c1 3300050509 Bacteria 3350
506 nmdc:mga0qj67_62795_c1 3300050509 Bacteria 2952
507 nmdc:mga06r32_122924_c1 3300050510 Bacteria 2561
508 nmdc:mga06r32_1317267_c1 3300050510 Bacteria 666
509 nmdc:mga06r32_1448423_c1 3300050510 Bacteria 628
510 nmdc:mga06r32_258157_c1 3300050510 Bacteria 1730
511 nmdc:mga06r32_281268_c1 3300050510 Bacteria 1651
512 nmdc:mga06r32_44952_c1 3300050510 Bacteria 4208
513 nmdc:mga06r32_47451_c1 3300050510 Bacteria 4102
514 nmdc:mga08y16_11406_c1 3300050511 Bacteria 9339
515 nmdc:mga08y16_1274552_c1 3300050511 Bacteria 703
516 nmdc:mga08y16_135625_c1 3300050511 Bacteria 2558
517 nmdc:mga08y16_30780_c1 3300050511 Bacteria 5644
518 nmdc:mga08y16_32982_c1 3300050511 Bacteria 5442
519 nmdc:mga08y16_34854_c1 3300050511 Bacteria 5288
520 nmdc:mga08y16_399124_c1 3300050511 Bacteria 1408
521 nmdc:mga08y16_666_c1 3300050511 Bacteria 32415
522 nmdc:mga0n895_1152402_c1 3300050512 Bacteria 751
523 nmdc:mga0n895_1316094_c1 3300050512 Bacteria 693
524 nmdc:mga0n895_615371_c1 3300050512 Bacteria 1087
525 nmdc:mga0n895_843700_c1 3300050512 Bacteria 904
526 nmdc:mga0rr50_340668_c1 3300050513 Bacteria 1260
527 nmdc:mga08x19_192208_c1 3300050514 Bacteria 1397
528 nmdc:mga08x19_254692_c1 3300050514 Bacteria 1212
529 nmdc:mga0a205_149869_c1 3300050515 Bacteria 2232
530 nmdc:mga0a205_286618_c1 3300050515 Bacteria 1522
531 Ga0495601_0023191 3300053077 Bacteria 3813
532 Ga0500651_0375166 3300053093 Bacteria 803
533 Ga0500566_0217209 3300053094 Bacteria 953
534 Ga0500555_021684 3300053103 Bacteria 1850
535 Ga0500568_0002087 3300053139 Bacteria 12112
536 Ga0500616_0000313 3300053153 Bacteria 69646
537 Ga0501084_0002328 3300054114 Bacteria 15262
538 Ga0501084_0192637 3300054114 Bacteria 1720
539 Ga0501084_0334628 3300054114 Bacteria 1279
540 Ga0590071_096438 3300059421 Bacteria 743
541 Ga0501082_0119910 3300060353 Bacteria 2280
542 Ga0501082_0350312 3300060353 Bacteria 1287
543 Ga0501082_0478518 3300060353 Bacteria 1088
544 Ga0530510_0132786 3300061734 Bacteria 1832
545 2688069886 2687453257 Bacteria 6784659
546 Ga0111539_10501670
547 JGI25406J46586_10057853
548 Ga0065704_10271550
549 Ga0065712_10074032
550 Ga0065712_10078581
551 Ga0065715_10306861
552 Ga0065715_10661219
553 Ga0065707_10004240
554 Ga0065707_10087606
555 Ga0065707_10105865
556 Ga0065707_10710494
557 Ga0070683_100013805
558 Ga0070690_100105683
559 Ga0070690_100587770
560 Ga0070670_100026959
561 Ga0070670_100198731
562 Ga0070670_100522458
563 Ga0070670_100531596
564 Ga0068869_100005810
565 Ga0068869_100129557
566 Ga0070680_100068691
567 Ga0070682_100104672
568 Ga0070660_100253012
569 Ga0070689_100023319
570 Ga0070689_100175518
571 Ga0070691_10486655
572 Ga0070687_100368930
573 Ga0070661_100035080
574 Ga0070661_101352475
575 Ga0070692_10521241
576 Ga0070668_100046321
577 Ga0070668_100128622
578 Ga0070669_100019350
579 Ga0070669_100407193
580 Ga0070669_101269876
581 Ga0070675_100045210
582 Ga0070675_100095928
583 Ga0070675_100146688
584 Ga0070671_100387379
585 Ga0070674_100593913
586 Ga0070673_100195016
587 Ga0070673_100575849
588 Ga0070688_100310999
589 Ga0070688_100442485
590 Ga0070659_101790512
591 Ga0070667_100334458
592 Ga0070667_100650580
593 Ga0070667_101148275
594 Ga0070667_101889880
595 Ga0070701_10036795
596 Ga0070701_10227582
597 Ga0070711_100936668
598 Ga0070705_100986230
599 Ga0070705_101278109
600 Ga0070700_100123126
601 Ga0070700_101423262
602 Ga0070700_101506720
603 Ga0070694_100014558
604 Ga0070694_100055418
605 Ga0070708_100286754
606 Ga0070678_100090580
607 Ga0070678_100813575
608 Ga0070662_100000644
609 Ga0070662_100089915
610 Ga0070662_100196330
611 Ga0070662_100564478
612 Ga0070662_101534681
613 Ga0070681_10239179
614 Ga0070681_10633940
615 Ga0068867_100032347
616 Ga0070685_10006490
617 Ga0070706_100019276
618 Ga0070707_100977230
619 Ga0070707_101476351
620 Ga0070698_100133911
621 Ga0070698_100188815
622 Ga0070679_100021153
623 Ga0070679_100072849
624 Ga0070684_100773181
625 Ga0070684_101115927
626 Ga0070697_100390460
627 Ga0068853_100230135
628 Ga0070672_100063095
629 Ga0070672_101103015
630 Ga0070695_100000771
631 Ga0070696_100003850
632 Ga0070696_100400291
633 Ga0070693_100035712
634 Ga0070693_100254796
635 Ga0070665_100373412
636 Ga0070665_100446336
637 Ga0070704_100052274
638 Ga0070704_101690047
639 Ga0068855_100453686
640 Ga0070664_100051190
641 Ga0068857_100751559
642 Ga0068856_100383082
643 Ga0070702_100009281
644 Ga0068852_101573815
645 Ga0068859_100394870
646 Ga0068859_100394978
647 Ga0068859_100405110
648 Ga0068859_100449719
649 Ga0068859_100764612
650 Ga0068859_100858242
651 Ga0068859_101544168
652 Ga0068859_101886336
653 Ga0068864_100034018
654 Ga0068864_100636216
655 Ga0068864_101195119
656 Ga0068866_10269121
657 Ga0068866_10513680
658 Ga0068851_10099069
659 Ga0068870_10041403
660 Ga0068870_10491212
661 Ga0068870_10561580
662 Ga0068863_100320125
663 Ga0068863_101234390
664 Ga0068863_102099650
665 Ga0068858_100341228
666 Ga0068858_100365996
667 Ga0068858_101016212
668 Ga0068860_100081236
669 Ga0068860_100193858
670 Ga0068860_101741842
671 Ga0068862_100051637
672 Ga0068862_100646360
673 Ga0068862_101593612
674 Ga0081455_10089696
675 Ga0081539_10028083
676 Ga0075368_10327560
677 Ga0075364_10026696
678 Ga0075364_10404131
679 Ga0075432_10146510
680 Ga0075367_10051727
681 Ga0075366_10063000
682 Ga0075366_10183554
683 Ga0097621_100181084
684 Ga0097621_101552014
685 Ga0068871_100150976
686 Ga0068871_100878023
687 Ga0075428_100003667
688 Ga0075428_100004609
689 Ga0075428_100023146
690 Ga0075428_100036382
691 Ga0075428_100045446
692 Ga0075428_100117715
693 Ga0075428_100382209
694 Ga0075428_100416322
695 Ga0075428_100547905
696 Ga0075428_100735630
697 Ga0075428_101798071
698 Ga0075428_102569124
699 Ga0075430_100070679
700 Ga0075430_100099726
701 Ga0075430_100113615
702 Ga0075430_100162232
703 Ga0075430_100238650
704 Ga0075430_100253921
705 Ga0075430_100802547
706 Ga0075431_100019896
707 Ga0075431_100069786
708 Ga0075431_100092015
709 Ga0075431_100152662
710 Ga0075431_100175892
711 Ga0075431_100354336
712 Ga0075431_100406774
713 Ga0075433_10338180
714 Ga0075434_100170412
715 Ga0075434_101269207
716 Ga0075429_100011017
717 Ga0075429_100014064
718 Ga0075429_100034903
719 Ga0075429_100130794
720 Ga0075429_100382733
721 Ga0075429_100508441
722 Ga0075429_100770527
723 Ga0075429_101404439
724 Ga0068865_100301666
725 Ga0068865_100533934
726 Ga0075436_100240964
727 Ga0075436_100304097
728 Ga0097620_100394844
729 Ga0097620_100394988
730 Ga0097620_100405106
731 Ga0097620_100449720
732 Ga0097620_100764603
733 Ga0097620_100858184
734 Ga0097620_101544518
735 Ga0075435_100206587
736 Ga0099794_10369707
737 Ga0099794_10516836
738 Ga0105240_11845156
739 Ga0111539_10008548
740 Ga0111539_10011349
741 Ga0111539_10016428
742 Ga0111539_10190036
743 Ga0111539_10397861
744 Ga0111539_10609457
745 Ga0111539_11115415
746 Ga0111539_11776136
747 Ga0105245_10162928
748 Ga0105245_11476280
749 Ga0105245_11643347
750 Ga0114129_10027998
751 Ga0114129_10028869
752 Ga0114129_10785462
753 Ga0114129_11337576
754 Ga0114129_12075727
755 Ga0114129_12775959
756 Ga0105243_10189602
757 Ga0105243_10416742
758 Ga0105241_10331021
759 Ga0105241_10584535
760 Ga0105241_11906641
761 Ga0105241_12408625
762 Ga0105242_10067935
763 Ga0105242_10421148
764 Ga0105242_10955448
765 Ga0105248_10017545
766 Ga0105248_10135375
767 Ga0105248_10592977
768 Ga0105238_10000081
769 Ga0105238_10457706
770 Ga0105249_10003661
771 Ga0105239_10133221
772 Ga0105239_10443373
773 Ga0105246_10410027
774 Ga0105246_11112936
775 Ga0157373_10129641
776 Ga0157371_10152864
777 Ga0157369_10194325
778 Ga0157374_10019988
779 Ga0163162_10155304
780 Ga0163162_10223981
781 Ga0163162_11507507
782 Ga0163162_11535361
783 Ga0157372_10014898
784 Ga0157372_10056125
785 Ga0157372_10158354
786 Ga0157375_10005091
787 Ga0157375_10339333
788 Ga0157375_10358127
789 Ga0157375_10642976
790 Ga0157375_10679825
791 Ga0157375_10821843
792 Ga0157375_10861927
793 Ga0157375_11792523
794 Ga0163163_10014524
795 Ga0163163_10016127
796 Ga0163163_10034687
797 Ga0163163_10329639
798 Ga0157380_10008728
799 Ga0157380_10470768
800 Ga0157377_10038036
801 Ga0157379_10228379
802 Ga0157379_10580300
803 Ga0157379_10935022
804 Ga0157376_10070616
805 Ga0157376_10171662
806 Ga0157376_10505544
807 Ga0207656_10102180
808 Ga0207653_10236702
809 Ga0207682_10159244
810 Ga0207642_11081140
811 Ga0207688_10199435
812 Ga0207645_10150440
813 Ga0207643_10015166
814 Ga0207643_10077742
815 Ga0207684_10275148
816 Ga0207654_10332708
817 Ga0207660_10522071
818 Ga0207660_10599020
819 Ga0207662_10206985
820 Ga0207657_10076734
821 Ga0207652_10213928
822 Ga0207652_10249624
823 Ga0207681_10009558
824 Ga0207694_10000074
825 Ga0207694_10722248
826 Ga0207650_10252670
827 Ga0207650_10936241
828 Ga0207659_10739477
829 Ga0207687_10722891
830 Ga0207687_11069233
831 Ga0207687_11526625
832 Ga0207644_10704384
833 Ga0207644_11117522
834 Ga0207690_10436413
835 Ga0207690_11161711
836 Ga0207706_10000106
837 Ga0207706_10004475
838 Ga0207706_10309705
839 Ga0207706_11050621
840 Ga0207686_10010738
841 Ga0207709_10224246
842 Ga0207709_10453046
843 Ga0207709_10576251
844 Ga0207670_10008264
845 Ga0207670_10229131
846 Ga0207669_10834223
847 Ga0207704_10668106
848 Ga0207691_10022076
849 Ga0207691_10062156
850 Ga0207691_10600177
851 Ga0207691_10664095
852 Ga0207691_11092190
853 Ga0207691_11186068
854 Ga0207711_10024132
855 Ga0207711_10218044
856 Ga0207711_10789213
857 Ga0207689_10001170
858 Ga0207689_10612940
859 Ga0207661_10029710
860 Ga0207679_10035599
861 Ga0207679_10101987
862 Ga0207679_10310258
863 Ga0207679_11683878
864 Ga0207651_10311113
865 Ga0207712_10003746
866 Ga0207712_10388160
867 Ga0207668_10665472
868 Ga0207640_11810144
869 Ga0207658_10115209
870 Ga0207677_10434784
871 Ga0207677_10548195
872 Ga0207703_10285923
873 Ga0207703_10358586
874 Ga0207639_10135061
875 Ga0207708_10631619
876 Ga0207708_10687847
877 Ga0207708_11016202
878 Ga0207641_10670989
879 Ga0207648_10214711
880 Ga0207648_11608954
881 Ga0207676_10743208
882 Ga0207676_12100912
883 Ga0207674_10014174
884 Ga0207674_10067736
885 Ga0207675_100308714
886 Ga0207675_100463651
887 Ga0207675_101043301
888 Ga0207675_101286199
889 Ga0207683_10108894
890 Ga0207698_11074611
891 Ga0209588_1221013
892 Ga0209813_10215068
893 Ga0207428_10021189
894 Ga0207428_10090827
895 Ga0207428_10170884
896 Ga0207428_10211135
897 Ga0207428_10283994
898 Ga0207428_10336493
899 Ga0207428_10367877
900 Ga0268266_10087423
901 Ga0268266_10294566
902 Ga0268265_10084448
903 Ga0268264_10108192
904 Ga0268264_10396459
905 Ga0268264_10450365
906 Ga0268264_12274055
907 Ga0307517_10255149
908 Ga0307511_10156656
909 Ga0307511_10227710
910 Ga0307513_10828331
911 Ga0307509_10000111
912 Ga0307408_101143794
913 Ga0307405_10141003
914 Ga0307405_10561783
915 Ga0307405_10976452
916 Ga0307410_10124179
917 Ga0307410_10795205
918 Ga0307406_10970501
919 Ga0307407_10027141
920 Ga0307412_10613439
921 Ga0307412_11089259
922 Ga0307412_11311610
923 Ga0307412_12108431
924 Ga0307409_100041494
925 Ga0307409_100918938
926 Ga0307416_100105393
927 Ga0307416_100297551
928 Ga0307416_100969303
929 Ga0307416_102475774
930 Ga0307414_10286449
931 Ga0307414_11720477
932 Ga0307411_10376427
933 Ga0307411_10648520
934 Ga0307415_100234586
935 Ga0373928_0262534
936 Ga0373932_0252285
937 Ga0373954_0095424
938 Ga0373946_0337847
939 Ga0373931_0014828
940 Ga0373931_0196228
941 Ga0373937_0067231
942 Ga0373937_0340783
943 Ga0395900_0660990
944 Ga0395898_0690073
945 Ga0395905_0252604
946 Ga0395905_0277166
947 Ga0395905_0566788
948 Ga0436364_0113153
949 Ga0395901_0594849
950 Ga0436365_1435256
951 Ga0451793_0085848
952 Ga0451798_0405581
953 Ga0451802_0946939
954 Ga0451807_1700066
955 Ga0451807_2604428
956 Ga0451849_0994085
957 Ga0451853_3516985
958 Ga0439455_0187314
959 Ga0450908_057027
960 Ga0451577_0081854
961 Ga0466972_0059817
962 Ga0466965_0264240
963 Ga0466961_0308638
964 Ga0466960_0368568
965 Ga0451576_0034656
966 Ga0451576_0096004
967 Ga0451576_0320543
968 Ga0451576_0621607
969 Ga0495592_0074020
970 Ga0495638_0217017
971 Ga0495582_0165344
972 Ga0495628_0009662
973 Ga0495598_0034462
974 Ga0495645_0309372
975 Ga0495633_0352264
976 Ga0495667_0773594
977 Ga0495658_0027254
978 Ga0495581_0009709
979 Ga0495672_0191207
980 Ga0495615_0178507
981 Ga0496100_0100242
982 Ga0496105_0979236
983 Ga0496108_0092824
984 Ga0496109_0084925
985 Ga0496110_0141907
986 Ga0496112_0041460
987 Ga0496113_0016458
988 Ga0496115_0121320
989 Ga0496126_0456212
990 Ga0501031_0262948
991 Ga0501034_0534979
992 Ga0501039_0784315
993 Ga0501041_0063250
994 Ga0501047_0598014
995 Ga0501067_0143343
996 Ga0501068_0295899
997 Ga0501068_1204677
998 Ga0501069_0427450
999 Ga0501071_0084699
1000 Ga0501072_0256615
1001 Ga0501074_1229410
1002 Ga0501076_0137529
1003 Ga0501076_0348179
1004 Ga0501076_0690435
1005 Ga0501077_0042310
1006 Ga0501077_0541625
1007 Ga0501217_064871
1008 Ga0501224_016608
1009 Ga0501233_076604
1010 Ga0501242_006975
1011 Ga0501248_006137
1012 Ga0501249_046847
1013 Ga0501253_058198
1014 Ga0501079_0061210
1015 Ga0501079_0191344
1016 Ga0501079_0222729
1017 Ga0501079_0331874
1018 Ga0501079_0924920
1019 Ga0501080_0305944
1020 Ga0501081_0063200
1021 Ga0501081_0106881
1022 Ga0501083_0346460
1023 Ga0501283_015749
1024 Ga0501044_0261665
1025 Ga0501045_0680660
1026 nmdc:mga00v17_53577_c1
1027 nmdc:mga00v17_82821_c1
1028 nmdc:mga0k408_93437_c1
1029 nmdc:mga06z11_210138_c1
1030 nmdc:mga04h51_132031_c1
1031 nmdc:mga07m45_608322_c1
1032 nmdc:mga05p37_1143502_c1
1033 nmdc:mga05p37_1390103_c1
1034 nmdc:mga05p37_1521239_c1
1035 nmdc:mga05p37_282166_c1
1036 nmdc:mga05p37_48_c1
1037 nmdc:mga05p37_535541_c1
1038 nmdc:mga05p37_6863_c1
1039 nmdc:mga05p37_786515_c1
1040 nmdc:mga09592_11275_c1
1041 nmdc:mga09592_23871_c1
1042 nmdc:mga09592_364673_c1
1043 nmdc:mga09592_530569_c1
1044 nmdc:mga09592_57185_c1
1045 nmdc:mga09592_790197_c1
1046 nmdc:mga0qj67_137563_c1
1047 nmdc:mga0qj67_15164_c1
1048 nmdc:mga0qj67_230545_c1
1049 nmdc:mga0qj67_35469_c1
1050 nmdc:mga0qj67_48641_c1
1051 nmdc:mga0qj67_62795_c1
1052 nmdc:mga06r32_122924_c1
1053 nmdc:mga06r32_1317267_c1
1054 nmdc:mga06r32_1448423_c1
1055 nmdc:mga06r32_258157_c1
1056 nmdc:mga06r32_281268_c1
1057 nmdc:mga06r32_44952_c1
1058 nmdc:mga06r32_47451_c1
1059 nmdc:mga08y16_11406_c1
1060 nmdc:mga08y16_1274552_c1
1061 nmdc:mga08y16_135625_c1
1062 nmdc:mga08y16_30780_c1
1063 nmdc:mga08y16_32982_c1
1064 nmdc:mga08y16_34854_c1
1065 nmdc:mga08y16_399124_c1
1066 nmdc:mga08y16_666_c1
1067 nmdc:mga0n895_1152402_c1
1068 nmdc:mga0n895_1316094_c1
1069 nmdc:mga0n895_615371_c1
1070 nmdc:mga0n895_843700_c1
1071 nmdc:mga0rr50_340668_c1
1072 nmdc:mga08x19_192208_c1
1073 nmdc:mga08x19_254692_c1
1074 nmdc:mga0a205_149869_c1
1075 nmdc:mga0a205_286618_c1
1076 Ga0495601_0023191
1077 Ga0500651_0375166
1078 Ga0500566_0217209
1079 Ga0500555_021684
1080 Ga0500568_0002087
1081 Ga0500616_0000313
1082 Ga0501084_0002328
1083 Ga0501084_0192637
1084 Ga0501084_0334628
1085 Ga0590071_096438
1086 Ga0501082_0119910
1087 Ga0501082_0350312
1088 Ga0501082_0478518
1089 Ga0530510_0132786
1090 2688069886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

27

160

0.86

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

17

157

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.9065 14 146
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8806 14 146
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8629 11 144
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8436 5 144
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8349 14 144
ID Description Score Start End Superfamily
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8672 11 146 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8549 11 146 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8436 16 144 3.30.530.20
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8261 14 143 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8248 5 142 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A849ZK23-F1-model_v4 SRPBCC domain-containing protein 0.9807 1 146
AF-A0A0G2ZD18-F1-model_v4 deleted 0.9747 21 146
AF-A0A0G2ZD18-F1-model_v4 deleted 0.9597 21 146
AF-A0A285CGU8-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.9559 11 145 GO:0003677
GO:0003700
AF-A0A1Q8CPW5-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9531 14 145

Map