F461847

General Info

Members Datasets Scaffolds Average Seq Length
545 275 545 309

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100322572|Ga0068865_1003225722
Length 360
Sequence MKVHANAPLGPKGRLTMVRRVIDEAWSVTEAAAAAGVSDRTCAKWVARFRAEGEAGLQDRSSAPRAIPHRTPDELVEAIVMLRRLRMTGAEIAFCLAMALSTVSAVLLRVGLGKLSRLGPPEPPNRYERRHPGELIHVDVKKLGRIVDGAGHRIHGNRARQRRQVRAGKRTTGWEYVHVCVDDATRLAYVEVLPDERATTAVGFLHRAVAFYAAHGVSVERVMSDNGACYRSTIHASACRAMGLRHLRTRPYRPRTNGKAERFIRTLLGGWAYGGIYSSSQERAAALDGWIWTYNHRRPHGALAHKPPIARLNELNNLAGPTASGLPRRCRAPRSGTCRPSWPSRRPRCRRVRASAGRRG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
163 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
169 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
170 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 11.74
Rhizosphere 86.24
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10038283 3300003203 Bacteria 1721
2 JGI25160J50197_1035307 3300003354 Bacteria 1228
3 JGI25160J50197_1035329 3300003354 Bacteria 1227
4 JGI25407J50210_10003863 3300003373 Bacteria 3628
5 JGI25407J50210_10044932 3300003373 Bacteria 1127
6 Ga0070658_10346834 3300005327 Bacteria 1270
7 Ga0070683_100046903 3300005329 Bacteria 3992
8 Ga0070683_100291626 3300005329 Bacteria 1552
9 Ga0070683_100512171 3300005329 Bacteria 1147
10 Ga0070670_100334684 3300005331 Bacteria 1328
11 Ga0070680_100398095 3300005336 Bacteria 1174
12 Ga0070682_100074865 3300005337 Bacteria 2176
13 Ga0070682_100083794 3300005337 Bacteria 2070
14 Ga0070682_100130627 3300005337 Bacteria 1699
15 Ga0068868_100305131 3300005338 Bacteria 1353
16 Ga0068868_100364077 3300005338 Bacteria 1241
17 Ga0070660_100291813 3300005339 Bacteria 1336
18 Ga0070660_100412403 3300005339 Bacteria 1118
19 Ga0070674_100262252 3300005356 Bacteria 1362
20 Ga0070673_100395962 3300005364 Bacteria 1234
21 Ga0070659_100286315 3300005366 Bacteria 1371
22 Ga0070714_100357606 3300005435 Bacteria 1372
23 Ga0070714_100482533 3300005435 Bacteria 1180
24 Ga0070713_100472963 3300005436 Bacteria 1180
25 Ga0070710_10237806 3300005437 Bacteria 1166
26 Ga0070694_100135167 3300005444 Bacteria 1786
27 Ga0070663_100319520 3300005455 Bacteria 1248
28 Ga0070663_100440995 3300005455 Bacteria 1071
29 Ga0070678_100335557 3300005456 Bacteria 1295
30 Ga0070681_10228585 3300005458 Bacteria 1775
31 Ga0070681_10274959 3300005458 Bacteria 1595
32 Ga0068867_100217112 3300005459 Bacteria 1539
33 Ga0068867_100230444 3300005459 Bacteria 1497
34 Ga0070685_10191263 3300005466 Bacteria 1324
35 Ga0070685_10240340 3300005466 Bacteria 1195
36 Ga0070707_100558442 3300005468 Bacteria 1107
37 Ga0070699_100552548 3300005518 Bacteria 1048
38 Ga0070679_100068908 3300005530 Bacteria 3529
39 Ga0070679_100204010 3300005530 Bacteria 1942
40 Ga0070679_100222392 3300005530 Bacteria 1849
41 Ga0070684_100073853 3300005535 Bacteria 3006
42 Ga0070684_100095807 3300005535 Plasmid 2645
43 Ga0070684_100425831 3300005535 Bacteria 1225
44 Ga0070697_100313907 3300005536 Bacteria 1349
45 Ga0070697_100437676 3300005536 Bacteria 1138
46 Ga0070695_100242691 3300005545 Bacteria 1308
47 Ga0070696_100240358 3300005546 Bacteria 1365
48 Ga0070693_100139791 3300005547 Bacteria 1523
49 Ga0070693_100160859 3300005547 Bacteria 1430
50 Ga0070665_100353112 3300005548 Bacteria 1476
51 Ga0070704_100268952 3300005549 Bacteria 1407
52 Ga0070704_100324176 3300005549 Bacteria 1292
53 Ga0070664_100207094 3300005564 Bacteria 1752
54 Ga0068857_100320750 3300005577 Bacteria 1431
55 Ga0068854_100169637 3300005578 Bacteria 1697
56 Ga0068854_100179146 3300005578 Bacteria 1654
57 Ga0068854_100404063 3300005578 Bacteria 1131
58 Ga0068856_100328985 3300005614 Bacteria 1546
59 Ga0068856_100639923 3300005614 Bacteria 1084
60 Ga0070702_100118559 3300005615 Bacteria 1653
61 Ga0068852_100255664 3300005616 Bacteria 1680
62 Ga0068852_100471907 3300005616 Bacteria 1245
63 Ga0068861_100315975 3300005719 Bacteria 1359
64 Ga0068851_10179920 3300005834 Bacteria 1171
65 Ga0068870_10179417 3300005840 Bacteria 1270
66 Ga0068858_100475998 3300005842 Bacteria 1205
67 Ga0068860_100515297 3300005843 Bacteria 1195
68 Ga0068862_100548074 3300005844 Bacteria 1104
69 Ga0081455_10016428 3300005937 Bacteria 7148
70 Ga0081538_10001214 3300005981 Bacteria 27055
71 Ga0081538_10004680 3300005981 Bacteria 12540
72 Ga0081538_10021893 3300005981 Bacteria 4649
73 Ga0081538_10038448 3300005981 Bacteria 3087
74 Ga0081538_10048744 3300005981 Bacteria 2579
75 Ga0081538_10073677 3300005981 Bacteria 1864
76 Ga0081538_10091057 3300005981 Bacteria 1576
77 Ga0081538_10113887 3300005981 Bacteria 1319
78 Ga0081539_10001611 3300005985 Bacteria 37114
79 Ga0081539_10082973 3300005985 Bacteria 1679
80 Ga0070717_10011002 3300006028 Bacteria 6852
81 Ga0070717_10025518 3300006028 Bacteria 4702
82 Ga0070717_10181482 3300006028 Bacteria 1835
83 Ga0070717_10451970 3300006028 Bacteria 1158
84 Ga0075432_10085728 3300006058 Bacteria 1147
85 Ga0075432_10099774 3300006058 Bacteria 1072
86 Ga0070712_100336811 3300006175 Bacteria 1231
87 Ga0097621_100499252 3300006237 Bacteria 1102
88 Ga0075428_100137892 3300006844 Bacteria 2652
89 Ga0075428_100526944 3300006844 Bacteria 1263
90 Ga0075428_100543877 3300006844 Bacteria 1241
91 Ga0075430_100238110 3300006846 Bacteria 1508
92 Ga0075430_100291532 3300006846 Bacteria 1350
93 Ga0075431_100448135 3300006847 Bacteria 1287
94 Ga0075431_100730145 3300006847 Bacteria 967
95 Ga0075433_10054797 3300006852 Bacteria 3479
96 Ga0075433_10256870 3300006852 Bacteria 1550
97 Ga0075429_100182150 3300006880 Bacteria 1841
98 Ga0075429_100218513 3300006880 Bacteria 1670
99 Ga0075429_100388111 3300006880 Bacteria 1223
100 Ga0068865_100322572 3300006881 Bacteria 1243
101 Ga0075435_100442169 3300007076 Bacteria 1121
102 Ga0111539_10488813 3300009094 Bacteria 1434
103 Ga0111539_10766752 3300009094 Bacteria 1123
104 Ga0105245_10285143 3300009098 Bacteria 1616
105 Ga0105245_10376601 3300009098 Bacteria 1413
106 Ga0105245_10422662 3300009098 Bacteria 1336
107 Ga0114129_10297844 3300009147 Bacteria 2151
108 Ga0105243_10263761 3300009148 Bacteria 1544
109 Ga0105243_10352015 3300009148 Bacteria 1353
110 Ga0105243_10360552 3300009148 Bacteria 1338
111 Ga0105243_10380298 3300009148 Bacteria 1306
112 Ga0105243_10383469 3300009148 Bacteria 1301
113 Ga0105243_10559152 3300009148 Bacteria 1094
114 Ga0105241_10294028 3300009174 Bacteria 1392
115 Ga0105241_10462028 3300009174 Bacteria 1125
116 Ga0105242_10112227 3300009176 Bacteria 2326
117 Ga0105242_10267422 3300009176 Bacteria 1547
118 Ga0105242_10330120 3300009176 Bacteria 1402
119 Ga0105242_10432676 3300009176 Bacteria 1236
120 Ga0105248_10742886 3300009177 Bacteria 1107
121 Ga0105238_10317042 3300009551 Bacteria 1545
122 Ga0105239_10494805 3300010375 Bacteria 1390
123 Ga0105239_10577188 3300010375 Bacteria 1282
124 Ga0105239_10723795 3300010375 Bacteria 1138
125 Ga0105246_10224793 3300011119 Bacteria 1474
126 Ga0157373_10301452 3300013100 Bacteria 1137
127 Ga0157370_10372254 3300013104 Bacteria 1316
128 Ga0157369_10409635 3300013105 Bacteria 1406
129 Ga0157378_10249432 3300013297 Bacteria 1699
130 Ga0157378_10286069 3300013297 Bacteria 1591
131 Ga0163162_10347892 3300013306 Bacteria 1615
132 Ga0157372_10491022 3300013307 Bacteria 1432
133 Ga0157372_10522754 3300013307 Bacteria 1383
134 Ga0157372_10560368 3300013307 Bacteria 1332
135 Ga0157375_10370514 3300013308 Bacteria 1598
136 Ga0157375_10806456 3300013308 Bacteria 1087
137 Ga0182008_10022269 3300014497 Bacteria 3246
138 Ga0157377_10038775 3300014745 Bacteria 2632
139 Ga0157379_10326480 3300014968 Bacteria 1401
140 Ga0182007_10049864 3300015262 Bacteria 1382
141 Ga0206356_10561245 3300020070 Bacteria 1084
142 Ga0206353_11191657 3300020082 Bacteria 1423
143 Ga0213876_10191525 3300021384 Bacteria 1087
144 Ga0207426_1009498 3300025302 Bacteria 3844
145 Ga0207426_1059974 3300025302 Bacteria 1098
146 Ga0207642_10114063 3300025899 Bacteria 1381
147 Ga0207688_10066914 3300025901 Bacteria 2033
148 Ga0207705_10377762 3300025909 Bacteria 1094
149 Ga0207707_10155184 3300025912 Bacteria 2002
150 Ga0207707_10312710 3300025912 Bacteria 1357
151 Ga0207693_10333652 3300025915 Bacteria 1187
152 Ga0207663_10301638 3300025916 Bacteria 1197
153 Ga0207660_10278303 3300025917 Bacteria 1327
154 Ga0207660_10384314 3300025917 Bacteria 1129
155 Ga0207662_10094984 3300025918 Bacteria 1840
156 Ga0207657_10169611 3300025919 Bacteria 1769
157 Ga0207657_10248494 3300025919 Bacteria 1419
158 Ga0207657_10281527 3300025919 Bacteria 1320
159 Ga0207657_10373491 3300025919 Bacteria 1123
160 Ga0207652_10058796 3300025921 Bacteria 3312
161 Ga0207652_10371512 3300025921 Bacteria 1291
162 Ga0207652_10429163 3300025921 Bacteria 1192
163 Ga0207694_10203750 3300025924 Bacteria 1610
164 Ga0207659_10370164 3300025926 Bacteria 1193
165 Ga0207687_10241363 3300025927 Bacteria 1432
166 Ga0207700_10066572 3300025928 Bacteria 2754
167 Ga0207700_10135558 3300025928 Bacteria 2016
168 Ga0207664_10383042 3300025929 Bacteria 1249
169 Ga0207664_10407335 3300025929 Bacteria 1210
170 Ga0207690_10226445 3300025932 Bacteria 1433
171 Ga0207706_10222824 3300025933 Bacteria 1651
172 Ga0207686_10351877 3300025934 Bacteria 1109
173 Ga0207709_10215876 3300025935 Bacteria 1380
174 Ga0207709_10226515 3300025935 Bacteria 1352
175 Ga0207709_10285107 3300025935 Bacteria 1221
176 Ga0207709_10357101 3300025935 Bacteria 1105
177 Ga0207669_10159887 3300025937 Bacteria 1590
178 Ga0207704_10340221 3300025938 Bacteria 1164
179 Ga0207704_10456043 3300025938 Bacteria 1021
180 Ga0207711_10346470 3300025941 Bacteria 1375
181 Ga0207689_10370219 3300025942 Bacteria 1192
182 Ga0207661_10079954 3300025944 Bacteria 2696
183 Ga0207661_10439096 3300025944 Bacteria 1187
184 Ga0207679_10262538 3300025945 Bacteria 1473
185 Ga0207640_10194666 3300025981 Bacteria 1531
186 Ga0207640_10435844 3300025981 Bacteria 1076
187 Ga0207658_10412411 3300025986 Bacteria 1189
188 Ga0207677_10426022 3300026023 Bacteria 1131
189 Ga0207703_10120704 3300026035 Bacteria 2250
190 Ga0207703_10595575 3300026035 Bacteria 1045
191 Ga0207639_10221721 3300026041 Bacteria 1634
192 Ga0207678_10275170 3300026067 Bacteria 1444
193 Ga0207708_10483847 3300026075 Bacteria 1035
194 Ga0207648_10259905 3300026089 Bacteria 1549
195 Ga0207648_10306917 3300026089 Bacteria 1424
196 Ga0207675_100270696 3300026118 Bacteria 1648
197 Ga0207675_100423669 3300026118 Bacteria 1315
198 Ga0207698_10392859 3300026142 Bacteria 1323
199 Ga0207428_10161561 3300027907 Bacteria 1701
200 Ga0268266_10220932 3300028379 Bacteria 1742
201 Ga0265319_1068840 3300028563 Bacteria 1136
202 Ga0265318_10071434 3300028577 Bacteria 1286
203 Ga0265338_10172552 3300028800 Bacteria 1656
204 Ga0265327_10103942 3300031251 Bacteria 1366
205 Ga0265316_10341736 3300031344 Bacteria 1085
206 Ga0265314_10136067 3300031711 Unclassified 1525
207 Ga0316576_10213243 3300031727 Bacteria 1453
208 Ga0307405_10127054 3300031731 Bacteria 1755
209 Ga0307413_10329732 3300031824 Bacteria 1169
210 Ga0307413_10329748 3300031824 Bacteria 1169
211 Ga0307410_10323013 3300031852 Bacteria 1225
212 Ga0307410_10458268 3300031852 Bacteria 1041
213 Ga0307406_10012633 3300031901 Bacteria 4816
214 Ga0307406_10202581 3300031901 Bacteria 1462
215 Ga0307409_100277367 3300031995 Bacteria 1547
216 Ga0307409_100327466 3300031995 Bacteria 1436
217 Ga0307409_100355371 3300031995 Bacteria 1384
218 Ga0307409_100371976 3300031995 Bacteria 1355
219 Ga0307409_100431020 3300031995 Bacteria 1267
220 Ga0307416_100030113 3300032002 Bacteria 4069
221 Ga0307416_100211275 3300032002 Bacteria 1851
222 Ga0307416_100491631 3300032002 Bacteria 1289
223 Ga0307416_100566317 3300032002 Bacteria 1211
224 Ga0307414_10057365 3300032004 Bacteria 2737
225 Ga0307411_10122721 3300032005 Bacteria 1883
226 Ga0307411_10217126 3300032005 Bacteria 1481
227 Ga0307415_100124609 3300032126 Bacteria 1939
228 Ga0307415_100313132 3300032126 Bacteria 1305
229 Ga0307415_100357786 3300032126 Bacteria 1231
230 Ga0373934_0126010 3300035086 Bacteria 1043
231 Ga0373936_0077124 3300035113 Bacteria 1382
232 Ga0373953_0058671 3300035117 Bacteria 1569
233 Ga0373954_0048737 3300035118 Bacteria 1985
234 Ga0373956_0086649 3300035119 Bacteria 1441
235 Ga0373957_0071575 3300035120 Bacteria 1357
236 Ga0373957_0090065 3300035120 Bacteria 1218
237 Ga0373943_0139726 3300035170 Bacteria 1304
238 Ga0373946_0095244 3300035171 Bacteria 1326
239 Ga0373955_0177024 3300035172 Bacteria 1264
240 Ga0373955_0206269 3300035172 Bacteria 1171
241 Ga0316574_0237898 3300035398 Bacteria 1164
242 Ga0373924_0055581 3300035410 Bacteria 1647
243 Ga0373935_0323392 3300035692 Bacteria 1095
244 Ga0373933_0075903 3300035724 Bacteria 2052
245 Ga0373933_0212935 3300035724 Bacteria 1238
246 Ga0373933_0334484 3300035724 Bacteria 982
247 Ga0373937_0272929 3300036401 Bacteria 1596
248 Ga0373925_0382252 3300037068 Bacteria 1146
249 Ga0395899_0091770 3300037312 Bacteria 2200
250 Ga0395899_0156758 3300037312 Bacteria 1611
251 Ga0395899_0171171 3300037312 Bacteria 1529
252 Ga0395900_0057057 3300037418 Bacteria 4020
253 Ga0395900_0127484 3300037418 Bacteria 2609
254 Ga0395900_0480947 3300037418 Bacteria 1194
255 Ga0395900_0556916 3300037418 Bacteria 1090
256 Ga0395898_0019064 3300037466 Bacteria 6984
257 Ga0395898_0226476 3300037466 Bacteria 1783
258 Ga0395898_0236445 3300037466 Bacteria 1742
259 Ga0395898_0278250 3300037466 Bacteria 1596
260 Ga0395898_0483370 3300037466 Bacteria 1178
261 Ga0395905_0186998 3300037471 Bacteria 1944
262 Ga0395905_0224839 3300037471 Bacteria 1756
263 Ga0395905_0246812 3300037471 Bacteria 1668
264 Ga0395905_0444852 3300037471 Bacteria 1193
265 Ga0395905_0661961 3300037471 Bacteria 946
266 Ga0436364_1167888 3300037853 Bacteria 1880
267 Ga0395901_0076185 3300038443 Bacteria 3499
268 Ga0395901_0244554 3300038443 Bacteria 1870
269 Ga0395901_0509302 3300038443 Bacteria 1224
270 Ga0436365_0346714 3300039437 Bacteria 3566
271 Ga0436365_0810102 3300039437 Bacteria 1305
272 Ga0436362_0887569 3300039453 Bacteria 1154
273 Ga0439453_0013467 3300041408 Bacteria 1390
274 Ga0439448_0058625 3300042005 Bacteria 1270
275 Ga0439451_025244 3300042009 Bacteria 1197
276 Ga0439454_004945 3300042011 Bacteria 1567
277 Ga0439454_009238 3300042011 Bacteria 1276
278 Ga0439455_0037497 3300042012 Bacteria 1229
279 Ga0439463_023782 3300042016 Bacteria 1534
280 Ga0439458_0015884 3300042157 Bacteria 1709
281 Ga0439458_0077241 3300042157 Bacteria 846
282 Ga0439459_0038471 3300042438 Bacteria 1006
283 Ga0439464_0019557 3300042439 Bacteria 1849
284 Ga0439460_0027532 3300042461 Bacteria 1597
285 Ga0439460_0072923 3300042461 Bacteria 1066
286 Ga0439440_0042748 3300042993 Bacteria 1110
287 Ga0466972_0158558 3300044658 Bacteria 1063
288 Ga0466965_0052653 3300044683 Bacteria 2022
289 Ga0466966_0168170 3300044684 Bacteria 1333
290 Ga0466963_0221676 3300044694 Bacteria 1324
291 Ga0466963_0256929 3300044694 Bacteria 1226
292 Ga0466963_0303763 3300044694 Bacteria 1122
293 Ga0466963_0303922 3300044694 Bacteria 1122
294 Ga0466963_0476289 3300044694 Bacteria 881
295 Ga0466964_0081555 3300044706 Bacteria 1389
296 Ga0466964_0099534 3300044706 Bacteria 1279
297 Ga0466968_0107844 3300044735 Bacteria 1249
298 Ga0466970_0209953 3300044765 Bacteria 1084
299 Ga0466957_0030955 3300044842 Bacteria 3196
300 Ga0466957_0160999 3300044842 Bacteria 1457
301 Ga0466959_0182449 3300045049 Bacteria 1467
302 Ga0466959_0211593 3300045049 Bacteria 1347
303 Ga0466958_0011565 3300045836 Bacteria 4973
304 Ga0466958_0090683 3300045836 Bacteria 1891
305 Ga0466958_0100199 3300045836 Bacteria 1800
306 Ga0466967_0118300 3300045976 Bacteria 2444
307 Ga0466967_0359995 3300045976 Bacteria 1409
308 Ga0466967_0482656 3300045976 Bacteria 1214
309 Ga0466967_0514615 3300045976 Bacteria 1175
310 Ga0466967_0590539 3300045976 Bacteria 1095
311 Ga0495592_0223261 3300046454 Bacteria 1258
312 Ga0495592_0331640 3300046454 Bacteria 980
313 Ga0495603_0207832 3300046455 Bacteria 1131
314 Ga0495629_0332802 3300046459 Bacteria 1037
315 Ga0495641_0098023 3300046461 Bacteria 1308
316 Ga0495641_0128601 3300046461 Bacteria 1130
317 Ga0495651_0022261 3300046462 Bacteria 4926
318 Ga0495651_0143246 3300046462 Bacteria 1730
319 Ga0495651_0145458 3300046462 Bacteria 1714
320 Ga0495651_0211812 3300046462 Bacteria 1348
321 Ga0495651_0227033 3300046462 Bacteria 1288
322 Ga0495651_0289278 3300046462 Bacteria 1103
323 Ga0495653_0048247 3300046463 Bacteria 3288
324 Ga0495653_0258830 3300046463 Bacteria 1151
325 Ga0495653_0259883 3300046463 Bacteria 1148
326 Ga0495662_0115120 3300046476 Bacteria 1318
327 Ga0495594_0054052 3300046499 Bacteria 2213
328 Ga0495596_0118734 3300046500 Bacteria 1027
329 Ga0495608_0000001 3300046511 Bacteria 411278
330 Ga0495608_0090360 3300046511 Bacteria 1981
331 Ga0495608_0145926 3300046511 Bacteria 1509
332 Ga0495608_0213484 3300046511 Bacteria 1212
333 Ga0495608_0214406 3300046511 Bacteria 1209
334 Ga0495618_0134550 3300046514 Bacteria 1581
335 Ga0495618_0217321 3300046514 Bacteria 1207
336 Ga0495618_0220883 3300046514 Bacteria 1195
337 Ga0495618_0236685 3300046514 Bacteria 1148
338 Ga0495628_0230813 3300046516 Unclassified 1387
339 Ga0495628_0278185 3300046516 Bacteria 1243
340 Ga0495630_0106944 3300046517 Bacteria 2119
341 Ga0495630_0162638 3300046517 Bacteria 1699
342 Ga0495643_0134194 3300046522 Bacteria 1240
343 Ga0495652_0104435 3300046529 Bacteria 2291
344 Ga0495652_0143037 3300046529 Bacteria 1879
345 Ga0495652_0211367 3300046529 Bacteria 1464
346 Ga0495652_0340671 3300046529 Bacteria 1077
347 Ga0495665_0196536 3300046531 Bacteria 1046
348 Ga0495640_0239748 3300046533 Bacteria 1138
349 Ga0495640_0257869 3300046533 Bacteria 1090
350 Ga0495640_0285040 3300046533 Bacteria 1028
351 Ga0495586_0117966 3300046535 Bacteria 1481
352 Ga0495586_0133110 3300046535 Bacteria 1392
353 Ga0495586_0255618 3300046535 Bacteria 1000
354 Ga0495587_0083745 3300046536 Bacteria 1847
355 Ga0495587_0195527 3300046536 Bacteria 1144
356 Ga0495645_0168236 3300046543 Unclassified 1510
357 Ga0495645_0178072 3300046543 Bacteria 1459
358 Ga0495667_0163036 3300046559 Bacteria 1433
359 Ga0495667_0167456 3300046559 Bacteria 1412
360 Ga0495656_0075340 3300046615 Bacteria 1509
361 Ga0495656_0121182 3300046615 Bacteria 1235
362 Ga0495634_0114857 3300046642 Bacteria 1728
363 Ga0495634_0280877 3300046642 Unclassified 1011
364 Ga0495634_0302535 3300046642 Bacteria 966
365 Ga0495635_0099522 3300046663 Bacteria 1987
366 Ga0495635_0105099 3300046663 Bacteria 1929
367 Ga0495657_0000002 3300046675 Bacteria 411958
368 Ga0495657_0023450 3300046675 Bacteria 4408
369 Ga0495657_0102790 3300046675 Bacteria 1818
370 Ga0495623_0052436 3300046679 Bacteria 2577
371 Ga0495623_0076420 3300046679 Bacteria 2078
372 Ga0495623_0222680 3300046679 Bacteria 1074
373 Ga0495646_0082019 3300046680 Bacteria 1877
374 Ga0495646_0125889 3300046680 Bacteria 1446
375 Ga0495646_0147400 3300046680 Bacteria 1311
376 Ga0495646_0157736 3300046680 Bacteria 1258
377 Ga0495646_0224131 3300046680 Bacteria 1015
378 Ga0495647_0042126 3300046681 Bacteria 1742
379 Ga0495647_0091386 3300046681 Bacteria 1248
380 Ga0495658_0214844 3300046683 Bacteria 1202
381 Ga0495613_0208915 3300046689 Bacteria 1373
382 Ga0495624_0170485 3300046690 Bacteria 1328
383 Ga0495624_0261603 3300046690 Bacteria 1045
384 Ga0495600_0077537 3300046809 Bacteria 2170
385 Ga0495600_0104943 3300046809 Bacteria 1841
386 Ga0495600_0221042 3300046809 Bacteria 1211
387 Ga0495604_0089034 3300047317 Bacteria 2295
388 Ga0495604_0132582 3300047317 Bacteria 1789
389 Ga0495604_0229133 3300047317 Bacteria 1275
390 Ga0495674_0107540 3300047319 Bacteria 2367
391 Ga0495674_0391219 3300047319 Bacteria 1123
392 Ga0495676_0148771 3300047321 Bacteria 1669
393 Ga0495676_0298265 3300047321 Bacteria 1087
394 Ga0495680_0018252 3300047322 Bacteria 5962
395 Ga0495680_0020302 3300047322 Bacteria 5592
396 Ga0495680_0132588 3300047322 Bacteria 1829
397 Ga0495680_0175726 3300047322 Bacteria 1548
398 Ga0495680_0210673 3300047322 Bacteria 1391
399 Ga0495675_0000019 3300047444 Bacteria 113641
400 Ga0495675_0063158 3300047444 Bacteria 2343
401 Ga0495675_0105482 3300047444 Bacteria 1761
402 Ga0495675_0227668 3300047444 Bacteria 1126
403 Ga0495675_0253533 3300047444 Bacteria 1056
404 Ga0495679_027930 3300047446 Bacteria 1855
405 Ga0495684_0193072 3300047471 Bacteria 1504
406 Ga0495684_0211888 3300047471 Bacteria 1424
407 Ga0495684_0225482 3300047471 Bacteria 1372
408 Ga0495684_0287027 3300047471 Bacteria 1185
409 Ga0495593_0140938 3300047673 Bacteria 1221
410 Ga0495593_0184219 3300047673 Bacteria 1051
411 Ga0495602_0194933 3300048088 Bacteria 1550
412 Ga0495602_0295478 3300048088 Bacteria 1187
413 Ga0495602_0314546 3300048088 Bacteria 1141
414 Ga0496100_0301433 3300048903 Bacteria 1199
415 Ga0496100_0506601 3300048903 Bacteria 930
416 Ga0496101_0057774 3300048904 Bacteria 2807
417 Ga0496101_0283378 3300048904 Bacteria 1295
418 Ga0496101_0396231 3300048904 Bacteria 1087
419 Ga0496102_0142233 3300048905 Bacteria 2250
420 Ga0496102_0447937 3300048905 Bacteria 1211
421 Ga0496102_0518670 3300048905 Bacteria 1114
422 Ga0496103_0144922 3300048906 Bacteria 1520
423 Ga0496103_0220344 3300048906 Bacteria 1220
424 Ga0496103_0408227 3300048906 Bacteria 872
425 Ga0496104_0021148 3300048907 Bacteria 5970
426 Ga0496104_0419350 3300048907 Bacteria 1250
427 Ga0496105_0195430 3300048908 Bacteria 1653
428 Ga0496105_0346279 3300048908 Bacteria 1187
429 Ga0496105_0357816 3300048908 Bacteria 1165
430 Ga0496105_0408108 3300048908 Bacteria 1077
431 Ga0496106_0107070 3300048909 Bacteria 2174
432 Ga0496106_0129376 3300048909 Bacteria 1979
433 Ga0496106_0243185 3300048909 Bacteria 1438
434 Ga0496107_0022207 3300048910 Bacteria 4484
435 Ga0496107_0222607 3300048910 Bacteria 1404
436 Ga0496107_0268869 3300048910 Bacteria 1269
437 Ga0496107_0365003 3300048910 Bacteria 1074
438 Ga0496107_0392625 3300048910 Bacteria 1032
439 Ga0496107_0452815 3300048910 Bacteria 953
440 Ga0496108_0075107 3300048911 Bacteria 2855
441 Ga0496108_0094231 3300048911 Bacteria 2549
442 Ga0496108_0176504 3300048911 Bacteria 1849
443 Ga0496108_0307382 3300048911 Bacteria 1381
444 Ga0496108_0498494 3300048911 Bacteria 1063
445 Ga0496108_0627714 3300048911 Bacteria 935
446 Ga0496109_0235420 3300048912 Bacteria 1723
447 Ga0496109_0326471 3300048912 Bacteria 1448
448 Ga0496109_0330357 3300048912 Bacteria 1439
449 Ga0496109_0340021 3300048912 Bacteria 1417
450 Ga0496109_0436151 3300048912 Bacteria 1237
451 Ga0496109_0600713 3300048912 Bacteria 1036
452 Ga0496110_0111856 3300048913 Bacteria 2455
453 Ga0496110_0211694 3300048913 Bacteria 1762
454 Ga0496110_0270401 3300048913 Bacteria 1547
455 Ga0496110_0293448 3300048913 Bacteria 1481
456 Ga0496110_0296041 3300048913 Bacteria 1474
457 Ga0496110_0421038 3300048913 Bacteria 1217
458 Ga0496110_0433975 3300048913 Bacteria 1197
459 Ga0496110_0470911 3300048913 Bacteria 1144
460 Ga0496110_0750965 3300048913 Bacteria 879
461 Ga0496111_0050964 3300048914 Bacteria 2988
462 Ga0496111_0141448 3300048914 Bacteria 1783
463 Ga0496111_0187072 3300048914 Bacteria 1539
464 Ga0496111_0200485 3300048914 Bacteria 1484
465 Ga0496111_0344291 3300048914 Bacteria 1103
466 Ga0496112_0254273 3300048915 Bacteria 1707
467 Ga0496112_0488377 3300048915 Bacteria 1167
468 Ga0496112_0541260 3300048915 Bacteria 1098
469 Ga0496113_0245576 3300048916 Bacteria 1428
470 Ga0496113_0256087 3300048916 Bacteria 1398
471 Ga0496113_0294617 3300048916 Bacteria 1298
472 Ga0496114_0064956 3300048917 Bacteria 3057
473 Ga0496114_0165598 3300048917 Bacteria 1924
474 Ga0496114_0357769 3300048917 Bacteria 1291
475 Ga0496114_0482772 3300048917 Bacteria 1096
476 Ga0496115_0237118 3300048918 Bacteria 1504
477 Ga0496115_0358767 3300048918 Bacteria 1188
478 Ga0496119_0009324 3300048922 Bacteria 8444
479 Ga0496120_0053516 3300048923 Bacteria 2293
480 Ga0496125_0040335 3300048928 Bacteria 4007
481 Ga0501031_0126133 3300049568 Bacteria 1672
482 Ga0501031_0462332 3300049568 Bacteria 819
483 Ga0501034_0455090 3300049571 Bacteria 1197
484 Ga0501034_0532746 3300049571 Bacteria 1085
485 Ga0501034_0609614 3300049571 Bacteria 996
486 Ga0501036_0215668 3300049572 Bacteria 1612
487 Ga0501037_0265270 3300049573 Bacteria 1199
488 Ga0501039_0090962 3300049575 Bacteria 2378
489 Ga0501042_0121779 3300049578 Bacteria 1878
490 Ga0501046_0318071 3300049580 Bacteria 1134
491 Ga0501067_0085472 3300049583 Bacteria 1750
492 Ga0501067_0137113 3300049583 Bacteria 1362
493 Ga0501068_0005598 3300049584 Bacteria 6880
494 Ga0501068_0136832 3300049584 Bacteria 1534
495 Ga0501068_0156387 3300049584 Bacteria 1435
496 Ga0501069_0058736 3300049585 Bacteria 2146
497 Ga0501069_0132152 3300049585 Bacteria 1429
498 Ga0501069_0232039 3300049585 Bacteria 1074
499 Ga0501070_0124202 3300049586 Bacteria 2133
500 Ga0501072_0199674 3300049588 Bacteria 1594
501 Ga0501073_0015369 3300049589 Bacteria 5551
502 Ga0501073_0276603 3300049589 Bacteria 1158
503 Ga0501074_0344033 3300049590 Bacteria 1058
504 Ga0501075_0228593 3300049591 Bacteria 1418
505 Ga0501076_0098427 3300049592 Bacteria 2356
506 Ga0501076_0117491 3300049592 Bacteria 2152
507 Ga0501077_0186363 3300049593 Bacteria 1318
508 Ga0501080_0346757 3300049742 Bacteria 1341
509 Ga0501081_0193749 3300049743 Bacteria 1472
510 Ga0501083_0084840 3300049744 Bacteria 2096
511 Ga0501083_0200643 3300049744 Bacteria 1301
512 Ga0501045_0123768 3300049824 Bacteria 1920
513 nmdc:mga05p37_254895_c1 3300050507 Bacteria 2103
514 nmdc:mga09592_215071_c1 3300050508 Bacteria 1665
515 nmdc:mga09592_260155_c1 3300050508 Bacteria 1505
516 nmdc:mga09592_353810_c1 3300050508 Bacteria 1271
517 nmdc:mga0qj67_275186_c1 3300050509 Bacteria 1365
518 nmdc:mga08y16_459076_c1 3300050511 Bacteria 1298
519 nmdc:mga08y16_674486_c1 3300050511 Bacteria 1036
520 nmdc:mga0n895_444483_c1 3300050512 Bacteria 1309
521 Ga0495601_0105452 3300053077 Bacteria 1822
522 Ga0495601_0133728 3300053077 Bacteria 1616
523 Ga0495601_0257205 3300053077 Bacteria 1140
524 Ga0495601_0282901 3300053077 Bacteria 1081
525 Ga0495612_0012486 3300053078 Bacteria 3424
526 Ga0495612_0106294 3300053078 Bacteria 1198
527 Ga0495612_0109327 3300053078 Bacteria 1182
528 Ga0495612_0157163 3300053078 Bacteria 991
529 Ga0495595_0000001 3300053084 Bacteria 495226
530 Ga0495595_0100566 3300053084 Bacteria 1395
531 Ga0495595_0161859 3300053084 Bacteria 1104
532 Ga0495595_0163417 3300053084 Bacteria 1099
533 Ga0495595_0179839 3300053084 Bacteria 1048
534 Ga0495619_0000168 3300053085 Bacteria 47895
535 Ga0495619_0038084 3300053085 Bacteria 3135
536 Ga0495619_0052451 3300053085 Bacteria 2696
537 Ga0495619_0160121 3300053085 Bacteria 1554
538 Ga0495619_0289099 3300053085 Bacteria 1135
539 Ga0495619_0394053 3300053085 Bacteria 956
540 Ga0501084_0253792 3300054114 Bacteria 1484
541 Ga0501082_0403926 3300060353 Bacteria 1192
542 Ga0466962_0134384 3300061719 Bacteria 1196
543 Ga0466962_0164428 3300061719 Bacteria 1079
544 Ga0466962_0192576 3300061719 Bacteria 995
545 Ga0530510_0323374 3300061734 Bacteria 1156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100730145 Ga0075431_1007301452 238
2 3300044694 Ga0466963_0476289 Ga0466963_0476289_81_824 240
3 3300049568 Ga0501031_0462332 Ga0501031_0462332_11_796 244
4 3300049571 Ga0501034_0609614 Ga0501034_0609614_107_868 249
5 3300053085 Ga0495619_0394053 Ga0495619_0394053_121_879 249
6 3300014497 Ga0182008_10022269 Ga0182008_100222694 255
7 3300035398 Ga0316574_0237898 Ga0316574_0237898_319_1104 258
8 3300047322 Ga0495680_0210673 Ga0495680_0210673_586_1371 258
9 3300050508 nmdc:mga09592_353810_c1 nmdc:mga09592_353810_c1_232_1035 262
10 3300042157 Ga0439458_0077241 Ga0439458_0077241_12_809 265
11 3300044658 Ga0466972_0158558 Ga0466972_0158558_24_827 266
12 3300048906 Ga0496103_0408227 Ga0496103_0408227_61_861 266
13 3300035086 Ga0373934_0126010 Ga0373934_0126010_35_910 268
14 3300046459 Ga0495629_0332802 Ga0495629_0332802_117_992 268
15 3300046642 Ga0495634_0302535 Ga0495634_0302535_40_915 268
16 3300048904 Ga0496101_0057774 Ga0496101_0057774_71_877 268
17 3300048905 Ga0496102_0518670 Ga0496102_0518670_147_953 268
18 3300048906 Ga0496103_0144922 Ga0496103_0144922_586_1392 268
19 3300048909 Ga0496106_0107070 Ga0496106_0107070_855_1661 268
20 3300048910 Ga0496107_0022207 Ga0496107_0022207_288_1094 268
21 3300048911 Ga0496108_0176504 Ga0496108_0176504_585_1391 268
22 3300048913 Ga0496110_0470911 Ga0496110_0470911_319_1125 268
23 3300048914 Ga0496111_0050964 Ga0496111_0050964_88_894 268
24 3300048915 Ga0496112_0488377 Ga0496112_0488377_270_1076 268
25 3300048916 Ga0496113_0294617 Ga0496113_0294617_371_1177 268
26 3300048917 Ga0496114_0482772 Ga0496114_0482772_273_1079 268
27 3300048918 Ga0496115_0237118 Ga0496115_0237118_342_1148 268
28 3300048903 Ga0496100_0506601 Ga0496100_0506601_95_910 270
29 3300048910 Ga0496107_0452815 Ga0496107_0452815_87_902 270
30 3300048913 Ga0496110_0750965 Ga0496110_0750965_23_856 271
31 3300005459 Ga0068867_100230444 Ga0068867_1002304442 273
32 3300009098 Ga0105245_10422662 Ga0105245_104226621 273
33 3300009148 Ga0105243_10352015 Ga0105243_103520151 273
34 3300009174 Ga0105241_10294028 Ga0105241_102940281 273
35 3300009176 Ga0105242_10330120 Ga0105242_103301201 273
36 3300009551 Ga0105238_10317042 Ga0105238_103170422 273
37 3300010375 Ga0105239_10494805 Ga0105239_104948052 273
38 3300011119 Ga0105246_10224793 Ga0105246_102247932 273
39 3300013105 Ga0157369_10409635 Ga0157369_104096352 273
40 3300013297 Ga0157378_10249432 Ga0157378_102494322 273
41 3300013307 Ga0157372_10560368 Ga0157372_105603682 273
42 3300013308 Ga0157375_10370514 Ga0157375_103705142 273
43 3300048903 Ga0496100_0301433 Ga0496100_0301433_44_904 273
44 3300048905 Ga0496102_0142233 Ga0496102_0142233_499_1359 273
45 3300048909 Ga0496106_0243185 Ga0496106_0243185_453_1313 273
46 3300048910 Ga0496107_0222607 Ga0496107_0222607_476_1336 273
47 3300048917 Ga0496114_0165598 Ga0496114_0165598_655_1515 273
48 3300046516 Ga0495628_0230813 Ga0495628_0230813_525_1370 274
49 3300046642 Ga0495634_0280877 Ga0495634_0280877_108_953 274
50 3300046680 Ga0495646_0224131 Ga0495646_0224131_41_886 274
51 3300053078 Ga0495612_0157163 Ga0495612_0157163_72_917 274
52 3300037471 Ga0395905_0661961 Ga0395905_0661961_79_915 277
53 3300039453 Ga0436362_0887569 Ga0436362_0887569_290_1126 277
54 3300048911 Ga0496108_0627714 Ga0496108_0627714_54_911 277
55 3300014745 Ga0157377_10038775 Ga0157377_100387752 279
56 3300046535 Ga0495586_0117966 Ga0495586_0117966_146_1006 279
57 3300009148 Ga0105243_10559152 Ga0105243_105591521 282
58 3300046615 Ga0495656_0075340 Ga0495656_0075340_176_1027 282
59 3300035117 Ga0373953_0058671 Ga0373953_0058671_486_1409 284
60 3300035118 Ga0373954_0048737 Ga0373954_0048737_769_1692 284
61 3300035120 Ga0373957_0090065 Ga0373957_0090065_260_1183 284
62 3300035172 Ga0373955_0177024 Ga0373955_0177024_311_1234 284
63 3300035724 Ga0373933_0334484 Ga0373933_0334484_35_958 284
64 3300037312 Ga0395899_0156758 Ga0395899_0156758_310_1206 284
65 3300037466 Ga0395898_0019064 Ga0395898_0019064_80_976 284
66 3300038443 Ga0395901_0509302 Ga0395901_0509302_130_1026 284
67 3300046461 Ga0495641_0098023 Ga0495641_0098023_309_1232 284
68 3300046462 Ga0495651_0022261 Ga0495651_0022261_71_994 284
69 3300046463 Ga0495653_0048247 Ga0495653_0048247_252_1175 284
70 3300046511 Ga0495608_0214406 Ga0495608_0214406_35_958 284
71 3300046514 Ga0495618_0220883 Ga0495618_0220883_201_1124 284
72 3300046529 Ga0495652_0104435 Ga0495652_0104435_802_1725 284
73 3300046536 Ga0495587_0083745 Ga0495587_0083745_857_1780 284
74 3300046559 Ga0495667_0163036 Ga0495667_0163036_162_1085 284
75 3300046663 Ga0495635_0099522 Ga0495635_0099522_33_956 284
76 3300046675 Ga0495657_0102790 Ga0495657_0102790_794_1717 284
77 3300046679 Ga0495623_0052436 Ga0495623_0052436_1613_2536 284
78 3300046809 Ga0495600_0104943 Ga0495600_0104943_815_1738 284
79 3300047317 Ga0495604_0089034 Ga0495604_0089034_36_959 284
80 3300047322 Ga0495680_0018252 Ga0495680_0018252_21_944 284
81 3300047444 Ga0495675_0063158 Ga0495675_0063158_172_1095 284
82 3300047471 Ga0495684_0211888 Ga0495684_0211888_35_958 284
83 3300047673 Ga0495593_0184219 Ga0495593_0184219_35_958 284
84 3300048088 Ga0495602_0295478 Ga0495602_0295478_81_1004 284
85 3300053084 Ga0495595_0179839 Ga0495595_0179839_97_1020 284
86 3300053085 Ga0495619_0038084 Ga0495619_0038084_2031_2954 284
87 3300031251 Ga0265327_10103942 Ga0265327_101039422 285
88 3300049584 Ga0501068_0156387 Ga0501068_0156387_122_991 286
89 3300049585 Ga0501069_0058736 Ga0501069_0058736_1202_2071 286
90 3300009176 Ga0105242_10432676 Ga0105242_104326761 287
91 3300048908 Ga0496105_0195430 Ga0496105_0195430_229_1182 287
92 3300050508 nmdc:mga09592_260155_c1 nmdc:mga09592_260155_c1_293_1174 287
93 3300050509 nmdc:mga0qj67_275186_c1 nmdc:mga0qj67_275186_c1_301_1182 287
94 3300053084 Ga0495595_0100566 Ga0495595_0100566_401_1267 287
95 3300053085 Ga0495619_0052451 Ga0495619_0052451_1458_2324 287
96 3300005456 Ga0070678_100335557 Ga0070678_1003355571 288
97 3300005545 Ga0070695_100242691 Ga0070695_1002426911 288
98 3300013308 Ga0157375_10806456 Ga0157375_108064561 289
99 3300005337 Ga0070682_100130627 Ga0070682_1001306272 291
100 3300010375 Ga0105239_10723795 Ga0105239_107237951 291
101 3300049583 Ga0501067_0085472 Ga0501067_0085472_306_1190 292
102 3300005536 Ga0070697_100313907 Ga0070697_1003139071 293
103 3300044706 Ga0466964_0081555 Ga0466964_0081555_209_1171 293
104 3300045976 Ga0466967_0590539 Ga0466967_0590539_39_1001 293
105 3300026118 Ga0207675_100270696 Ga0207675_1002706962 294
106 3300042438 Ga0439459_0038471 Ga0439459_0038471_52_969 294
107 3300042005 Ga0439448_0058625 Ga0439448_0058625_141_1067 295
108 3300042012 Ga0439455_0037497 Ga0439455_0037497_85_1011 295
109 3300042016 Ga0439463_023782 Ga0439463_023782_185_1111 295
110 3300042157 Ga0439458_0015884 Ga0439458_0015884_448_1374 295
111 3300042439 Ga0439464_0019557 Ga0439464_0019557_808_1734 295
112 3300042461 Ga0439460_0027532 Ga0439460_0027532_449_1375 295
113 3300045976 Ga0466967_0514615 Ga0466967_0514615_219_1127 295
114 3300046455 Ga0495603_0207832 Ga0495603_0207832_179_1084 295
115 3300049571 Ga0501034_0455090 Ga0501034_0455090_214_1122 295
116 3300049586 Ga0501070_0124202 Ga0501070_0124202_507_1415 295
117 3300049589 Ga0501073_0276603 Ga0501073_0276603_104_1012 295
118 3300048906 Ga0496103_0220344 Ga0496103_0220344_314_1204 296
119 3300048913 Ga0496110_0211694 Ga0496110_0211694_33_923 296
120 3300032126 Ga0307415_100313132 Ga0307415_1003131322 297
121 3300049572 Ga0501036_0215668 Ga0501036_0215668_345_1319 297
122 3300005535 Ga0070684_100095807 Ga0070684_1000958074 298
123 3300044694 Ga0466963_0303922 Ga0466963_0303922_37_954 298
124 3300045836 Ga0466958_0090683 Ga0466958_0090683_383_1330 298
125 3300061719 Ga0466962_0192576 Ga0466962_0192576_12_929 298
126 3300009147 Ga0114129_10297844 Ga0114129_102978443 299
127 3300049568 Ga0501031_0126133 Ga0501031_0126133_63_1043 299
128 3300049575 Ga0501039_0090962 Ga0501039_0090962_861_1841 299
129 3300049578 Ga0501042_0121779 Ga0501042_0121779_371_1351 299
130 3300049580 Ga0501046_0318071 Ga0501046_0318071_20_1000 299
131 3300049584 Ga0501068_0136832 Ga0501068_0136832_194_1174 299
132 3300049585 Ga0501069_0232039 Ga0501069_0232039_64_1044 299
133 3300049588 Ga0501072_0199674 Ga0501072_0199674_520_1500 299
134 3300049590 Ga0501074_0344033 Ga0501074_0344033_58_1038 299
135 3300049591 Ga0501075_0228593 Ga0501075_0228593_140_1120 299
136 3300049592 Ga0501076_0098427 Ga0501076_0098427_299_1279 299
137 3300049743 Ga0501081_0193749 Ga0501081_0193749_39_1019 299
138 3300049744 Ga0501083_0200643 Ga0501083_0200643_309_1289 299
139 3300049824 Ga0501045_0123768 Ga0501045_0123768_793_1773 299
140 3300050507 nmdc:mga05p37_254895_c1 nmdc:mga05p37_254895_c1_365_1336 299
141 3300054114 Ga0501084_0253792 Ga0501084_0253792_50_1030 299
142 3300061734 Ga0530510_0323374 Ga0530510_0323374_87_1067 299
143 3300005466 Ga0070685_10191263 Ga0070685_101912632 300
144 3300009177 Ga0105248_10742886 Ga0105248_107428861 300
145 3300013104 Ga0157370_10372254 Ga0157370_103722541 300
146 3300045836 Ga0466958_0011565 Ga0466958_0011565_2222_3193 300
147 3300047446 Ga0495679_027930 Ga0495679_027930_679_1650 300
148 3300053078 Ga0495612_0106294 Ga0495612_0106294_229_1155 300
149 3300010375 Ga0105239_10577188 Ga0105239_105771881 302
150 3300014968 Ga0157379_10326480 Ga0157379_103264801 302
151 3300025901 Ga0207688_10066914 Ga0207688_100669143 302
152 3300037312 Ga0395899_0171171 Ga0395899_0171171_117_1028 302
153 3300037418 Ga0395900_0127484 Ga0395900_0127484_1674_2585 302
154 3300046500 Ga0495596_0118734 Ga0495596_0118734_60_986 302
155 3300048910 Ga0496107_0365003 Ga0496107_0365003_40_966 302
156 3300048914 Ga0496111_0141448 Ga0496111_0141448_349_1275 302
157 3300005339 Ga0070660_100412403 Ga0070660_1004124031 303
158 3300005468 Ga0070707_100558442 Ga0070707_1005584421 303
159 3300006844 Ga0075428_100137892 Ga0075428_1001378922 303
160 3300006846 Ga0075430_100291532 Ga0075430_1002915322 303
161 3300006880 Ga0075429_100182150 Ga0075429_1001821502 303
162 3300006880 Ga0075429_100218513 Ga0075429_1002185132 303
163 3300031727 Ga0316576_10213243 Ga0316576_102132431 303
164 3300035113 Ga0373936_0077124 Ga0373936_0077124_422_1342 303
165 3300035120 Ga0373957_0071575 Ga0373957_0071575_150_1070 303
166 3300035170 Ga0373943_0139726 Ga0373943_0139726_341_1261 303
167 3300035172 Ga0373955_0206269 Ga0373955_0206269_188_1108 303
168 3300035692 Ga0373935_0323392 Ga0373935_0323392_122_1042 303
169 3300035724 Ga0373933_0212935 Ga0373933_0212935_149_1069 303
170 3300036401 Ga0373937_0272929 Ga0373937_0272929_227_1147 303
171 3300046454 Ga0495592_0331640 Ga0495592_0331640_28_948 303
172 3300046462 Ga0495651_0211812 Ga0495651_0211812_170_1090 303
173 3300046462 Ga0495651_0227033 Ga0495651_0227033_104_1024 303
174 3300046463 Ga0495653_0259883 Ga0495653_0259883_68_988 303
175 3300046511 Ga0495608_0090360 Ga0495608_0090360_332_1252 303
176 3300046511 Ga0495608_0145926 Ga0495608_0145926_492_1412 303
177 3300046514 Ga0495618_0217321 Ga0495618_0217321_174_1094 303
178 3300046517 Ga0495630_0106944 Ga0495630_0106944_78_998 303
179 3300046529 Ga0495652_0340671 Ga0495652_0340671_111_1031 303
180 3300046533 Ga0495640_0285040 Ga0495640_0285040_45_965 303
181 3300046535 Ga0495586_0255618 Ga0495586_0255618_70_990 303
182 3300046536 Ga0495587_0195527 Ga0495587_0195527_106_1026 303
183 3300046543 Ga0495645_0168236 Ga0495645_0168236_503_1423 303
184 3300046559 Ga0495667_0167456 Ga0495667_0167456_447_1367 303
185 3300046679 Ga0495623_0222680 Ga0495623_0222680_40_960 303
186 3300046680 Ga0495646_0147400 Ga0495646_0147400_78_998 303
187 3300046690 Ga0495624_0170485 Ga0495624_0170485_304_1224 303
188 3300046809 Ga0495600_0077537 Ga0495600_0077537_913_1833 303
189 3300047317 Ga0495604_0229133 Ga0495604_0229133_301_1221 303
190 3300047319 Ga0495674_0391219 Ga0495674_0391219_181_1101 303
191 3300047322 Ga0495680_0175726 Ga0495680_0175726_473_1408 303
192 3300047444 Ga0495675_0253533 Ga0495675_0253533_55_975 303
193 3300047471 Ga0495684_0225482 Ga0495684_0225482_302_1222 303
194 3300048088 Ga0495602_0314546 Ga0495602_0314546_121_1041 303
195 3300049573 Ga0501037_0265270 Ga0501037_0265270_126_1049 303
196 3300049583 Ga0501067_0137113 Ga0501067_0137113_54_977 303
197 3300049584 Ga0501068_0005598 Ga0501068_0005598_273_1196 303
198 3300049589 Ga0501073_0015369 Ga0501073_0015369_135_1058 303
199 3300049592 Ga0501076_0117491 Ga0501076_0117491_205_1128 303
200 3300049742 Ga0501080_0346757 Ga0501080_0346757_281_1204 303
201 3300053077 Ga0495601_0105452 Ga0495601_0105452_30_950 303
202 3300053077 Ga0495601_0282901 Ga0495601_0282901_81_1001 303
203 3300053084 Ga0495595_0163417 Ga0495595_0163417_136_1056 303
204 3300005331 Ga0070670_100334684 Ga0070670_1003346842 304
205 3300005455 Ga0070663_100319520 Ga0070663_1003195201 304
206 3300005459 Ga0068867_100217112 Ga0068867_1002171122 304
207 3300005547 Ga0070693_100160859 Ga0070693_1001608592 304
208 3300005577 Ga0068857_100320750 Ga0068857_1003207502 304
209 3300005578 Ga0068854_100179146 Ga0068854_1001791463 304
210 3300005616 Ga0068852_100255664 Ga0068852_1002556642 304
211 3300005840 Ga0068870_10179417 Ga0068870_101794173 304
212 3300009148 Ga0105243_10360552 Ga0105243_103605522 304
213 3300009174 Ga0105241_10462028 Ga0105241_104620281 304
214 3300025919 Ga0207657_10248494 Ga0207657_102484942 304
215 3300025921 Ga0207652_10429163 Ga0207652_104291631 304
216 3300025942 Ga0207689_10370219 Ga0207689_103702192 304
217 3300026089 Ga0207648_10306917 Ga0207648_103069173 304
218 3300048911 Ga0496108_0094231 Ga0496108_0094231_38_967 304
219 3300005336 Ga0070680_100398095 Ga0070680_1003980951 305
220 3300005337 Ga0070682_100083794 Ga0070682_1000837942 305
221 3300005338 Ga0068868_100364077 Ga0068868_1003640771 305
222 3300005364 Ga0070673_100395962 Ga0070673_1003959621 305
223 3300005366 Ga0070659_100286315 Ga0070659_1002863152 305
224 3300005455 Ga0070663_100440995 Ga0070663_1004409951 305
225 3300005458 Ga0070681_10228585 Ga0070681_102285852 305
226 3300005530 Ga0070679_100204010 Ga0070679_1002040102 305
227 3300005547 Ga0070693_100139791 Ga0070693_1001397912 305
228 3300005578 Ga0068854_100404063 Ga0068854_1004040631 305
229 3300005616 Ga0068852_100471907 Ga0068852_1004719071 305
230 3300005842 Ga0068858_100475998 Ga0068858_1004759981 305
231 3300005843 Ga0068860_100515297 Ga0068860_1005152971 305
232 3300005844 Ga0068862_100548074 Ga0068862_1005480741 305
233 3300005981 Ga0081538_10038448 Ga0081538_100384483 305
234 3300006237 Ga0097621_100499252 Ga0097621_1004992521 305
235 3300025912 Ga0207707_10312710 Ga0207707_103127101 305
236 3300025918 Ga0207662_10094984 Ga0207662_100949841 305
237 3300025919 Ga0207657_10281527 Ga0207657_102815272 305
238 3300025921 Ga0207652_10371512 Ga0207652_103715121 305
239 3300025924 Ga0207694_10203750 Ga0207694_102037503 305
240 3300025926 Ga0207659_10370164 Ga0207659_103701642 305
241 3300025927 Ga0207687_10241363 Ga0207687_102413632 305
242 3300025932 Ga0207690_10226445 Ga0207690_102264452 305
243 3300025933 Ga0207706_10222824 Ga0207706_102228242 305
244 3300025941 Ga0207711_10346470 Ga0207711_103464702 305
245 3300025981 Ga0207640_10435844 Ga0207640_104358441 305
246 3300026023 Ga0207677_10426022 Ga0207677_104260221 305
247 3300026035 Ga0207703_10120704 Ga0207703_101207041 305
248 3300026067 Ga0207678_10275170 Ga0207678_102751701 305
249 3300026089 Ga0207648_10259905 Ga0207648_102599052 305
250 3300026142 Ga0207698_10392859 Ga0207698_103928592 305
251 3300037418 Ga0395900_0057057 Ga0395900_0057057_1115_2083 305
252 3300042461 Ga0439460_0072923 Ga0439460_0072923_46_969 305
253 3300005549 Ga0070704_100324176 Ga0070704_1003241761 306
254 3300025917 Ga0207660_10384314 Ga0207660_103843141 306
255 3300046511 Ga0495608_0000001 Ga0495608_0000001_40048_41076 306
256 3300046675 Ga0495657_0000002 Ga0495657_0000002_40728_41756 306
257 3300047444 Ga0495675_0000019 Ga0495675_0000019_71886_72914 306
258 3300048928 Ga0496125_0040335 Ga0496125_0040335_1379_2323 306
259 3300053084 Ga0495595_0000001 Ga0495595_0000001_370203_371231 306
260 3300053085 Ga0495619_0000168 Ga0495619_0000168_40027_41055 306
261 3300005444 Ga0070694_100135167 Ga0070694_1001351672 307
262 3300005719 Ga0068861_100315975 Ga0068861_1003159752 307
263 3300009094 Ga0111539_10766752 Ga0111539_107667521 307
264 3300009098 Ga0105245_10376601 Ga0105245_103766011 307
265 3300025935 Ga0207709_10285107 Ga0207709_102851072 307
266 3300026118 Ga0207675_100423669 Ga0207675_1004236692 307
267 3300045049 Ga0466959_0211593 Ga0466959_0211593_299_1285 307
268 3300046522 Ga0495643_0134194 Ga0495643_0134194_133_1056 307
269 3300048904 Ga0496101_0283378 Ga0496101_0283378_83_1009 307
270 3300048908 Ga0496105_0346279 Ga0496105_0346279_25_951 307
271 3300048909 Ga0496106_0129376 Ga0496106_0129376_693_1619 307
272 3300048911 Ga0496108_0075107 Ga0496108_0075107_411_1337 307
273 3300048911 Ga0496108_0307382 Ga0496108_0307382_226_1152 307
274 3300048912 Ga0496109_0326471 Ga0496109_0326471_293_1219 307
275 3300048912 Ga0496109_0330357 Ga0496109_0330357_311_1237 307
276 3300048912 Ga0496109_0600713 Ga0496109_0600713_16_939 307
277 3300048913 Ga0496110_0111856 Ga0496110_0111856_650_1576 307
278 3300048913 Ga0496110_0421038 Ga0496110_0421038_111_1037 307
279 3300048914 Ga0496111_0187072 Ga0496111_0187072_73_999 307
280 3300048914 Ga0496111_0344291 Ga0496111_0344291_135_1061 307
281 3300048915 Ga0496112_0254273 Ga0496112_0254273_378_1304 307
282 3300048917 Ga0496114_0357769 Ga0496114_0357769_100_1026 307
283 3300050508 nmdc:mga09592_215071_c1 nmdc:mga09592_215071_c1_447_1373 307
284 3300050511 nmdc:mga08y16_674486_c1 nmdc:mga08y16_674486_c1_63_989 307
285 3300005329 Ga0070683_100046903 Ga0070683_1000469033 310
286 3300020070 Ga0206356_10561245 Ga0206356_105612451 310
287 3300020082 Ga0206353_11191657 Ga0206353_111916572 310
288 3300031731 Ga0307405_10127054 Ga0307405_101270543 310
289 3300031824 Ga0307413_10329732 Ga0307413_103297322 310
290 3300031852 Ga0307410_10323013 Ga0307410_103230131 310
291 3300031901 Ga0307406_10202581 Ga0307406_102025812 310
292 3300031995 Ga0307409_100277367 Ga0307409_1002773672 310
293 3300031995 Ga0307409_100431020 Ga0307409_1004310203 310
294 3300032002 Ga0307416_100030113 Ga0307416_1000301134 310
295 3300032005 Ga0307411_10217126 Ga0307411_102171262 310
296 3300032126 Ga0307415_100124609 Ga0307415_1001246092 310
297 3300032126 Ga0307415_100357786 Ga0307415_1003577861 310
298 3300037068 Ga0373925_0382252 Ga0373925_0382252_125_1078 310
299 3300042011 Ga0439454_009238 Ga0439454_009238_101_1066 310
300 3300047321 Ga0495676_0148771 Ga0495676_0148771_429_1382 310
301 3300049571 Ga0501034_0532746 Ga0501034_0532746_74_1048 310
302 3300049593 Ga0501077_0186363 Ga0501077_0186363_138_1091 310
303 3300005549 Ga0070704_100268952 Ga0070704_1002689522 311
304 3300005981 Ga0081538_10113887 Ga0081538_101138871 311
305 3300009148 Ga0105243_10263761 Ga0105243_102637612 311
306 3300025919 Ga0207657_10373491 Ga0207657_103734911 311
307 3300025935 Ga0207709_10215876 Ga0207709_102158762 311
308 3300026041 Ga0207639_10221721 Ga0207639_102217211 311
309 3300048910 Ga0496107_0268869 Ga0496107_0268869_34_984 311
310 3300050511 nmdc:mga08y16_459076_c1 nmdc:mga08y16_459076_c1_324_1265 312
311 3300013307 Ga0157372_10522754 Ga0157372_105227541 313
312 3300015262 Ga0182007_10049864 Ga0182007_100498642 313
313 3300031824 Ga0307413_10329748 Ga0307413_103297482 313
314 3300031852 Ga0307410_10458268 Ga0307410_104582681 313
315 3300031901 Ga0307406_10012633 Ga0307406_100126334 313
316 3300031995 Ga0307409_100327466 Ga0307409_1003274662 313
317 3300031995 Ga0307409_100371976 Ga0307409_1003719762 313
318 3300032002 Ga0307416_100566317 Ga0307416_1005663171 313
319 3300032004 Ga0307414_10057365 Ga0307414_100573654 313
320 3300032005 Ga0307411_10122721 Ga0307411_101227212 313
321 3300005614 Ga0068856_100639923 Ga0068856_1006399231 315
322 3300009094 Ga0111539_10488813 Ga0111539_104888131 315
323 3300035171 Ga0373946_0095244 Ga0373946_0095244_111_1082 315
324 3300037471 Ga0395905_0224839 Ga0395905_0224839_421_1389 315
325 3300038443 Ga0395901_0244554 Ga0395901_0244554_623_1591 315
326 3300046681 Ga0495647_0042126 Ga0495647_0042126_297_1268 315
327 3300005981 Ga0081538_10048744 Ga0081538_100487443 316
328 3300037466 Ga0395898_0278250 Ga0395898_0278250_225_1181 316
329 3300037471 Ga0395905_0186998 Ga0395905_0186998_629_1585 316
330 3300048905 Ga0496102_0447937 Ga0496102_0447937_116_1087 316
331 3300048907 Ga0496104_0419350 Ga0496104_0419350_74_1045 316
332 3300048908 Ga0496105_0408108 Ga0496105_0408108_14_985 316
333 3300048912 Ga0496109_0436151 Ga0496109_0436151_75_1046 316
334 3300048913 Ga0496110_0270401 Ga0496110_0270401_217_1188 316
335 3300048914 Ga0496111_0200485 Ga0496111_0200485_175_1143 316
336 3300048915 Ga0496112_0541260 Ga0496112_0541260_110_1081 316
337 3300048917 Ga0496114_0064956 Ga0496114_0064956_817_1788 316
338 3300048918 Ga0496115_0358767 Ga0496115_0358767_112_1080 316
339 3300060353 Ga0501082_0403926 Ga0501082_0403926_136_1110 316
340 3300005518 Ga0070699_100552548 Ga0070699_1005525481 317
341 3300005536 Ga0070697_100437676 Ga0070697_1004376761 317
342 3300005981 Ga0081538_10004680 Ga0081538_100046809 317
343 3300005981 Ga0081538_10021893 Ga0081538_100218932 317
344 3300026035 Ga0207703_10595575 Ga0207703_105955751 317
345 3300048913 Ga0496110_0296041 Ga0496110_0296041_117_1073 317
346 3300049744 Ga0501083_0084840 Ga0501083_0084840_543_1499 317
347 3300005356 Ga0070674_100262252 Ga0070674_1002622522 318
348 3300005578 Ga0068854_100169637 Ga0068854_1001696372 318
349 3300005981 Ga0081538_10001214 Ga0081538_100012142 318
350 3300006881 Ga0068865_100322572 Ga0068865_1003225722 318
351 3300009148 Ga0105243_10380298 Ga0105243_103802981 318
352 3300009176 Ga0105242_10267422 Ga0105242_102674222 318
353 3300013297 Ga0157378_10286069 Ga0157378_102860691 318
354 3300013306 Ga0163162_10347892 Ga0163162_103478921 318
355 3300025899 Ga0207642_10114063 Ga0207642_101140632 318
356 3300025934 Ga0207686_10351877 Ga0207686_103518771 318
357 3300025935 Ga0207709_10226515 Ga0207709_102265151 318
358 3300025937 Ga0207669_10159887 Ga0207669_101598872 318
359 3300025938 Ga0207704_10456043 Ga0207704_104560431 318
360 3300025981 Ga0207640_10194666 Ga0207640_101946661 318
361 3300032002 Ga0307416_100491631 Ga0307416_1004916311 318
362 3300041408 Ga0439453_0013467 Ga0439453_0013467_101_1081 318
363 3300042009 Ga0439451_025244 Ga0439451_025244_113_1093 318
364 3300042011 Ga0439454_004945 Ga0439454_004945_380_1360 318
365 3300048904 Ga0496101_0396231 Ga0496101_0396231_27_998 318
366 3300048913 Ga0496110_0293448 Ga0496110_0293448_162_1133 318
367 3300007076 Ga0075435_100442169 Ga0075435_1004421691 319
368 3300053077 Ga0495601_0133728 Ga0495601_0133728_627_1601 319
369 3300053078 Ga0495612_0109327 Ga0495612_0109327_191_1165 319
370 3300053085 Ga0495619_0289099 Ga0495619_0289099_149_1123 319
371 3300003373 JGI25407J50210_10044932 JGI25407J50210_100449321 320
372 3300005466 Ga0070685_10240340 Ga0070685_102403401 320
373 3300005981 Ga0081538_10073677 Ga0081538_100736772 320
374 3300032002 Ga0307416_100211275 Ga0307416_1002112753 320
375 3300037466 Ga0395898_0236445 Ga0395898_0236445_134_1114 320
376 3300037471 Ga0395905_0246812 Ga0395905_0246812_580_1560 320
377 3300038443 Ga0395901_0076185 Ga0395901_0076185_2170_3150 320
378 3300044694 Ga0466963_0256929 Ga0466963_0256929_242_1207 320
379 3300048913 Ga0496110_0433975 Ga0496110_0433975_172_1149 320
380 3300048916 Ga0496113_0256087 Ga0496113_0256087_390_1367 320
381 3300005327 Ga0070658_10346834 Ga0070658_103468341 321
382 3300005329 Ga0070683_100291626 Ga0070683_1002916262 321
383 3300005435 Ga0070714_100357606 Ga0070714_1003576061 321
384 3300005436 Ga0070713_100472963 Ga0070713_1004729631 321
385 3300005530 Ga0070679_100222392 Ga0070679_1002223921 321
386 3300005535 Ga0070684_100073853 Ga0070684_1000738531 321
387 3300006028 Ga0070717_10025518 Ga0070717_100255183 321
388 3300006028 Ga0070717_10181482 Ga0070717_101814822 321
389 3300006058 Ga0075432_10085728 Ga0075432_100857281 321
390 3300006852 Ga0075433_10054797 Ga0075433_100547972 321
391 3300009098 Ga0105245_10285143 Ga0105245_102851432 321
392 3300025909 Ga0207705_10377762 Ga0207705_103777621 321
393 3300025916 Ga0207663_10301638 Ga0207663_103016381 321
394 3300025917 Ga0207660_10278303 Ga0207660_102783032 321
395 3300025928 Ga0207700_10135558 Ga0207700_101355582 321
396 3300025929 Ga0207664_10383042 Ga0207664_103830422 321
397 3300025944 Ga0207661_10439096 Ga0207661_104390961 321
398 3300027907 Ga0207428_10161561 Ga0207428_101615611 321
399 3300031995 Ga0307409_100355371 Ga0307409_1003553712 321
400 3300035119 Ga0373956_0086649 Ga0373956_0086649_47_1012 321
401 3300035410 Ga0373924_0055581 Ga0373924_0055581_47_1012 321
402 3300035724 Ga0373933_0075903 Ga0373933_0075903_851_1816 321
403 3300037466 Ga0395898_0483370 Ga0395898_0483370_27_995 321
404 3300037471 Ga0395905_0444852 Ga0395905_0444852_124_1089 321
405 3300044684 Ga0466966_0168170 Ga0466966_0168170_164_1141 321
406 3300045049 Ga0466959_0182449 Ga0466959_0182449_139_1116 321
407 3300045976 Ga0466967_0482656 Ga0466967_0482656_99_1067 321
408 3300046462 Ga0495651_0143246 Ga0495651_0143246_35_1000 321
409 3300046514 Ga0495618_0134550 Ga0495618_0134550_289_1254 321
410 3300046680 Ga0495646_0125889 Ga0495646_0125889_190_1155 321
411 3300047322 Ga0495680_0020302 Ga0495680_0020302_3643_4608 321
412 3300047444 Ga0495675_0105482 Ga0495675_0105482_198_1163 321
413 3300047471 Ga0495684_0287027 Ga0495684_0287027_122_1087 321
414 3300049585 Ga0501069_0132152 Ga0501069_0132152_396_1385 321
415 3300050512 nmdc:mga0n895_444483_c1 nmdc:mga0n895_444483_c1_314_1282 321
416 3300003373 JGI25407J50210_10003863 JGI25407J50210_100038632 322
417 3300005337 Ga0070682_100074865 Ga0070682_1000748651 322
418 3300005339 Ga0070660_100291813 Ga0070660_1002918132 322
419 3300005458 Ga0070681_10274959 Ga0070681_102749592 322
420 3300005530 Ga0070679_100068908 Ga0070679_1000689082 322
421 3300005546 Ga0070696_100240358 Ga0070696_1002403582 322
422 3300005985 Ga0081539_10082973 Ga0081539_100829733 322
423 3300009176 Ga0105242_10112227 Ga0105242_101122272 322
424 3300013100 Ga0157373_10301452 Ga0157373_103014522 322
425 3300013307 Ga0157372_10491022 Ga0157372_104910221 322
426 3300021384 Ga0213876_10191525 Ga0213876_101915251 322
427 3300025912 Ga0207707_10155184 Ga0207707_101551841 322
428 3300025919 Ga0207657_10169611 Ga0207657_101696112 322
429 3300025921 Ga0207652_10058796 Ga0207652_100587962 322
430 3300028563 Ga0265319_1068840 Ga0265319_10688401 322
431 3300028577 Ga0265318_10071434 Ga0265318_100714341 322
432 3300028800 Ga0265338_10172552 Ga0265338_101725521 322
433 3300031344 Ga0265316_10341736 Ga0265316_103417361 322
434 3300031711 Ga0265314_10136067 Ga0265314_101360671 322
435 3300037312 Ga0395899_0091770 Ga0395899_0091770_815_1786 322
436 3300037418 Ga0395900_0556916 Ga0395900_0556916_107_1078 322
437 3300037853 Ga0436364_1167888 Ga0436364_1167888_676_1653 322
438 3300039437 Ga0436365_0346714 Ga0436365_0346714_2284_3264 322
439 3300042993 Ga0439440_0042748 Ga0439440_0042748_75_1049 322
440 3300044683 Ga0466965_0052653 Ga0466965_0052653_972_1943 322
441 3300044694 Ga0466963_0221676 Ga0466963_0221676_115_1086 322
442 3300044694 Ga0466963_0303763 Ga0466963_0303763_17_988 322
443 3300044706 Ga0466964_0099534 Ga0466964_0099534_210_1181 322
444 3300044735 Ga0466968_0107844 Ga0466968_0107844_157_1128 322
445 3300044765 Ga0466970_0209953 Ga0466970_0209953_11_982 322
446 3300044842 Ga0466957_0030955 Ga0466957_0030955_2121_3092 322
447 3300044842 Ga0466957_0160999 Ga0466957_0160999_18_989 322
448 3300045836 Ga0466958_0100199 Ga0466958_0100199_811_1782 322
449 3300045976 Ga0466967_0118300 Ga0466967_0118300_499_1470 322
450 3300045976 Ga0466967_0359995 Ga0466967_0359995_16_987 322
451 3300046454 Ga0495592_0223261 Ga0495592_0223261_74_1045 322
452 3300046461 Ga0495641_0128601 Ga0495641_0128601_61_1032 322
453 3300046462 Ga0495651_0289278 Ga0495651_0289278_109_1080 322
454 3300046463 Ga0495653_0258830 Ga0495653_0258830_39_1010 322
455 3300046476 Ga0495662_0115120 Ga0495662_0115120_140_1111 322
456 3300046499 Ga0495594_0054052 Ga0495594_0054052_156_1127 322
457 3300046511 Ga0495608_0213484 Ga0495608_0213484_184_1155 322
458 3300046514 Ga0495618_0236685 Ga0495618_0236685_42_1013 322
459 3300046516 Ga0495628_0278185 Ga0495628_0278185_212_1183 322
460 3300046517 Ga0495630_0162638 Ga0495630_0162638_319_1290 322
461 3300046529 Ga0495652_0143037 Ga0495652_0143037_132_1100 322
462 3300046529 Ga0495652_0211367 Ga0495652_0211367_96_1067 322
463 3300046531 Ga0495665_0196536 Ga0495665_0196536_49_1020 322
464 3300046533 Ga0495640_0239748 Ga0495640_0239748_150_1121 322
465 3300046533 Ga0495640_0257869 Ga0495640_0257869_17_985 322
466 3300046535 Ga0495586_0133110 Ga0495586_0133110_87_1058 322
467 3300046543 Ga0495645_0178072 Ga0495645_0178072_436_1404 322
468 3300046615 Ga0495656_0121182 Ga0495656_0121182_175_1143 322
469 3300046642 Ga0495634_0114857 Ga0495634_0114857_621_1592 322
470 3300046663 Ga0495635_0105099 Ga0495635_0105099_93_1064 322
471 3300046675 Ga0495657_0023450 Ga0495657_0023450_3010_3981 322
472 3300046679 Ga0495623_0076420 Ga0495623_0076420_147_1118 322
473 3300046680 Ga0495646_0157736 Ga0495646_0157736_272_1243 322
474 3300046681 Ga0495647_0091386 Ga0495647_0091386_244_1215 322
475 3300046683 Ga0495658_0214844 Ga0495658_0214844_110_1081 322
476 3300046689 Ga0495613_0208915 Ga0495613_0208915_236_1207 322
477 3300046690 Ga0495624_0261603 Ga0495624_0261603_20_991 322
478 3300046809 Ga0495600_0221042 Ga0495600_0221042_66_1037 322
479 3300047317 Ga0495604_0132582 Ga0495604_0132582_259_1230 322
480 3300047319 Ga0495674_0107540 Ga0495674_0107540_1384_2355 322
481 3300047321 Ga0495676_0298265 Ga0495676_0298265_74_1045 322
482 3300047322 Ga0495680_0132588 Ga0495680_0132588_697_1668 322
483 3300047444 Ga0495675_0227668 Ga0495675_0227668_64_1035 322
484 3300047471 Ga0495684_0193072 Ga0495684_0193072_301_1272 322
485 3300047673 Ga0495593_0140938 Ga0495593_0140938_135_1106 322
486 3300048088 Ga0495602_0194933 Ga0495602_0194933_365_1336 322
487 3300048907 Ga0496104_0021148 Ga0496104_0021148_2498_3490 322
488 3300048912 Ga0496109_0235420 Ga0496109_0235420_112_1104 322
489 3300048912 Ga0496109_0340021 Ga0496109_0340021_319_1302 322
490 3300048922 Ga0496119_0009324 Ga0496119_0009324_7367_8359 322
491 3300048923 Ga0496120_0053516 Ga0496120_0053516_409_1401 322
492 3300053077 Ga0495601_0257205 Ga0495601_0257205_111_1079 322
493 3300053084 Ga0495595_0161859 Ga0495595_0161859_22_993 322
494 3300061719 Ga0466962_0134384 Ga0466962_0134384_26_997 322
495 3300061719 Ga0466962_0164428 Ga0466962_0164428_88_1059 322
496 3300003203 JGI25406J46586_10038283 JGI25406J46586_100382831 323
497 3300003354 JGI25160J50197_1035307 JGI25160J50197_10353071 323
498 3300003354 JGI25160J50197_1035329 JGI25160J50197_10353291 323
499 3300005329 Ga0070683_100512171 Ga0070683_1005121711 323
500 3300005338 Ga0068868_100305131 Ga0068868_1003051311 323
501 3300005435 Ga0070714_100482533 Ga0070714_1004825331 323
502 3300005437 Ga0070710_10237806 Ga0070710_102378061 323
503 3300005535 Ga0070684_100425831 Ga0070684_1004258312 323
504 3300005548 Ga0070665_100353112 Ga0070665_1003531121 323
505 3300005564 Ga0070664_100207094 Ga0070664_1002070942 323
506 3300005614 Ga0068856_100328985 Ga0068856_1003289852 323
507 3300005615 Ga0070702_100118559 Ga0070702_1001185592 323
508 3300005834 Ga0068851_10179920 Ga0068851_101799201 323
509 3300005937 Ga0081455_10016428 Ga0081455_100164286 323
510 3300005981 Ga0081538_10091057 Ga0081538_100910572 323
511 3300005985 Ga0081539_10001611 Ga0081539_1000161129 323
512 3300006028 Ga0070717_10011002 Ga0070717_100110026 323
513 3300006028 Ga0070717_10451970 Ga0070717_104519701 323
514 3300006058 Ga0075432_10099774 Ga0075432_100997742 323
515 3300006175 Ga0070712_100336811 Ga0070712_1003368111 323
516 3300006844 Ga0075428_100526944 Ga0075428_1005269442 323
517 3300006844 Ga0075428_100543877 Ga0075428_1005438772 323
518 3300006846 Ga0075430_100238110 Ga0075430_1002381102 323
519 3300006847 Ga0075431_100448135 Ga0075431_1004481351 323
520 3300006852 Ga0075433_10256870 Ga0075433_102568702 323
521 3300006880 Ga0075429_100388111 Ga0075429_1003881111 323
522 3300009148 Ga0105243_10383469 Ga0105243_103834692 323
523 3300025302 Ga0207426_1009498 Ga0207426_10094984 323
524 3300025302 Ga0207426_1059974 Ga0207426_10599741 323
525 3300025915 Ga0207693_10333652 Ga0207693_103336521 323
526 3300025928 Ga0207700_10066572 Ga0207700_100665722 323
527 3300025929 Ga0207664_10407335 Ga0207664_104073351 323
528 3300025935 Ga0207709_10357101 Ga0207709_103571011 323
529 3300025938 Ga0207704_10340221 Ga0207704_103402211 323
530 3300025944 Ga0207661_10079954 Ga0207661_100799543 323
531 3300025945 Ga0207679_10262538 Ga0207679_102625382 323
532 3300025986 Ga0207658_10412411 Ga0207658_104124112 323
533 3300026075 Ga0207708_10483847 Ga0207708_104838471 323
534 3300028379 Ga0268266_10220932 Ga0268266_102209322 323
535 3300037418 Ga0395900_0480947 Ga0395900_0480947_66_1049 323
536 3300037466 Ga0395898_0226476 Ga0395898_0226476_87_1070 323
537 3300039437 Ga0436365_0810102 Ga0436365_0810102_174_1157 323
538 3300046462 Ga0495651_0145458 Ga0495651_0145458_327_1322 323
539 3300046680 Ga0495646_0082019 Ga0495646_0082019_122_1102 323
540 3300048908 Ga0496105_0357816 Ga0496105_0357816_68_1039 323
541 3300048910 Ga0496107_0392625 Ga0496107_0392625_44_1015 323
542 3300048911 Ga0496108_0498494 Ga0496108_0498494_61_1032 323
543 3300048916 Ga0496113_0245576 Ga0496113_0245576_102_1073 323
544 3300053078 Ga0495612_0012486 Ga0495612_0012486_1888_2880 323
545 3300053085 Ga0495619_0160121 Ga0495619_0160121_541_1533 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

242

308

0.97

PF13384

HTH_23

Homeodomain-like domain

14

58

0.96

PF13518

HTH_28

Helix-turn-helix domain

14

65

0.95

PF13011

LZ_Tnp_IS481

leucine-zipper of insertion element IS481

1

85

0.94

PF00665

rve

Integrase core domain

129

254

0.88

PF13551

HTH_29

Winged helix-turn helix

14

78

0.86

PF13565

HTH_32

Homeodomain-like domain

41

107

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5clv-assembly4.cif.gz_N crystal structure of kora-operator dna complex (kora-oa) 0.8812 12 51
3vfz-assembly3.cif.gz_B crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.8188 12 57
6u8q-assembly1.cif.gz_L cryoem structure of hiv-1 cleaved synaptic complex (csc) intasome 0.8128 132 319
3wng-assembly1.cif.gz_A cyclic hexapeptide pkidnp in complex with hiv-1 integrase 0.8128 178 317
7ue1-assembly1.cif.gz_B hiv-1 integrase catalytic core domain mutant (kgd) in complex with inhibitor grl-142 0.81 132 319
ID Description Score Start End Superfamily
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8803 128 316 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8625 128 313 3.30.420.10
af_P0CF56_119_291_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8623 125 316 3.30.420.10
4a12C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8546 76 118 1.10.10.10
af_I6YC39_133_303_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8521 128 311 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A6N3S505-F1-model_v4 deleted 0.9724 177 316
AF-A0A482Z320-F1-model_v4 Mobile element protein 0.933 201 318 GO:0003676
GO:0015074
AF-A0A171JX23-F1-model_v4 deleted 0.929 204 319
AF-A0A6N3S2H1-F1-model_v4 deleted 0.9219 138 316
AF-A0A5C5ZVI5-F1-model_v4 IS2 transposase TnpB 0.9216 184 316 GO:0003676
GO:0015074

Feature Viewer

pLDDT pTM Quality
84 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map