F461819

General Info

Members Datasets Scaffolds Average Seq Length
545 298 1090 280

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100105204|Ga0070683_1001052042
Length 292
Sequence MPTITAKDGAHIFYKDWGSGQPVVFSHGWPLNADAWDEQLFLFASNGYRAIAHDRRGHGRSTQTWTGNDMDTYADDLAALTEALNLTNAIHVGHSTGGGEVARYIGRHGTKRVAKAVLVDAVTPGLVKPGGLMIKLFDDMRAGVFADMSQFWEDLSQPFYGANRPGANVPKGILDRFWLLSMQCSLVAAYECIKAFSESEFTDDLKKFDMPTLIIHGDDDQIVPINVGGDRAAKMVEDATYHVYKGAPHGLMSTHQKQFNADLLAFASEKAKSAAPGRRGSAEPASRAASSG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
124 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
125 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
126 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
210 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
211 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
212 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
215 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
216 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
217 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
218 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
291 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
292 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
293 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
294 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
295 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
296 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
297 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
298 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.48
Metatranscriptomes 5.87
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 1.65
Rhizoplane 1.83
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100105204 3300005329 Bacteria 2660
2 Ga0006778J45830_1036295 3300003162 Bacteria 1300
3 Ga0006759J45824_1033679 3300003163 Bacteria 1750
4 JGI25406J46586_10007417 3300003203 Bacteria 5004
5 Ga0006770J48903_1034693 3300003305 Bacteria 1677
6 Ga0007417J51691_1008427 3300003544 Bacteria 1293
7 Ga0007417J51691_1026099 3300003544 Bacteria 1680
8 Ga0007410J51695_1009092 3300003574 Bacteria 1178
9 Ga0007410J51695_1024884 3300003574 Bacteria 1727
10 Ga0007409J51694_1007695 3300003575 Bacteria 1431
11 Ga0007409J51694_1028720 3300003575 Bacteria 1085
12 Ga0007416J51690_1010134 3300003577 Bacteria 1089
13 Ga0007429J51699_1031510 3300003579 Bacteria 1670
14 JGI25404J52841_10028013 3300003659 Bacteria 1210
15 Ga0032354_1032570 3300003693 Bacteria 1803
16 Ga0006780_1017125 3300003735 Bacteria 1665
17 Ga0055533_1001311 3300003756 Bacteria 6759
18 Ga0058862_12837317 3300004803 Bacteria 1368
19 Ga0065704_10008370 3300005289 Bacteria 3206
20 Ga0065715_10098594 3300005293 Bacteria 3525
21 Ga0065707_10205159 3300005295 Bacteria 1292
22 Ga0070683_100007326 3300005329 Bacteria 9317
23 Ga0070690_100005933 3300005330 Bacteria 6895
24 Ga0070690_100050097 3300005330 Bacteria 2664
25 Ga0070670_100006997 3300005331 Bacteria 9560
26 Ga0070670_100010281 3300005331 Bacteria 7987
27 Ga0070670_100022745 3300005331 Bacteria 5394
28 Ga0068869_100026296 3300005334 Bacteria 4050
29 Ga0070680_100005857 3300005336 Bacteria 9324
30 Ga0070680_100012743 3300005336 Bacteria 6537
31 Ga0070680_100076668 3300005336 Bacteria 2752
32 Ga0070680_100150439 3300005336 Bacteria 1954
33 Ga0070680_100309433 3300005336 Bacteria 1340
34 Ga0070682_100009681 3300005337 Bacteria 5456
35 Ga0070682_100095913 3300005337 Bacteria 1948
36 Ga0070682_100174508 3300005337 Bacteria 1496
37 Ga0068868_100004790 3300005338 Bacteria 9498
38 Ga0068868_100005125 3300005338 Bacteria 9202
39 Ga0068868_100081930 3300005338 Bacteria 2587
40 Ga0068868_100102179 3300005338 Bacteria 2321
41 Ga0070660_100138492 3300005339 Bacteria 1951
42 Ga0070660_100183761 3300005339 Bacteria 1692
43 Ga0070689_100020390 3300005340 Bacteria 4917
44 Ga0070687_100003002 3300005343 Bacteria 6484
45 Ga0070661_100005417 3300005344 Bacteria 8802
46 Ga0070661_100009722 3300005344 Bacteria 6670
47 Ga0070661_100134809 3300005344 Bacteria 1857
48 Ga0070692_10014106 3300005345 Bacteria 3742
49 Ga0070668_100216107 3300005347 Bacteria 1579
50 Ga0070668_100515169 3300005347 Bacteria 1037
51 Ga0070675_100017576 3300005354 Bacteria 5684
52 Ga0070675_100018373 3300005354 Bacteria 5564
53 Ga0070673_100679833 3300005364 Bacteria 944
54 Ga0070659_100012551 3300005366 Bacteria 6280
55 Ga0070659_100060976 3300005366 Bacteria 2980
56 Ga0070709_10102380 3300005434 Bacteria 1910
57 Ga0070709_10102815 3300005434 Bacteria 1906
58 Ga0070709_10127902 3300005434 Bacteria 1730
59 Ga0070714_100000548 3300005435 Bacteria 27101
60 Ga0070714_100072376 3300005435 Bacteria 2984
61 Ga0070714_100222284 3300005435 Bacteria 1736
62 Ga0070713_100090289 3300005436 Bacteria 2633
63 Ga0070713_100297496 3300005436 Bacteria 1485
64 Ga0070710_10086136 3300005437 Bacteria 1844
65 Ga0070701_10022096 3300005438 Bacteria 3046
66 Ga0070711_100033636 3300005439 Bacteria 3414
67 Ga0070711_100125124 3300005439 Bacteria 1907
68 Ga0070711_100151759 3300005439 Bacteria 1748
69 Ga0070705_100047985 3300005440 Bacteria 2471
70 Ga0070694_100012848 3300005444 Bacteria 5220
71 Ga0070708_100304267 3300005445 Bacteria 1501
72 Ga0070662_100009715 3300005457 Bacteria 6296
73 Ga0070662_100035619 3300005457 Bacteria 3516
74 Ga0070662_100157353 3300005457 Bacteria 1775
75 Ga0070662_100315237 3300005457 Bacteria 1274
76 Ga0070662_100609294 3300005457 Bacteria 919
77 Ga0070681_10002085 3300005458 Bacteria 18155
78 Ga0070681_10004859 3300005458 Bacteria 12890
79 Ga0070681_10010413 3300005458 Bacteria 9185
80 Ga0070681_10022559 3300005458 Bacteria 6322
81 Ga0068867_100000641 3300005459 Bacteria 23138
82 Ga0068867_100013333 3300005459 Bacteria 5823
83 Ga0070707_100025719 3300005468 Bacteria 5588
84 Ga0070707_100154674 3300005468 Bacteria 2234
85 Ga0070707_100245752 3300005468 Bacteria 1741
86 Ga0070698_100016791 3300005471 Bacteria 7722
87 Ga0070698_100049438 3300005471 Bacteria 4291
88 Ga0070698_100257178 3300005471 Bacteria 1678
89 Ga0070699_100009674 3300005518 Bacteria 8347
90 Ga0070699_100046125 3300005518 Bacteria 3772
91 Ga0070699_100123378 3300005518 Bacteria 2279
92 Ga0070699_100158951 3300005518 Bacteria 2000
93 Ga0070699_100422574 3300005518 Bacteria 1206
94 Ga0070679_100004624 3300005530 Bacteria 12705
95 Ga0070679_100008223 3300005530 Bacteria 9809
96 Ga0070679_100060235 3300005530 Bacteria 3783
97 Ga0070684_100044824 3300005535 Bacteria 3827
98 Ga0070684_100050715 3300005535 Bacteria 3605
99 Ga0070684_100066372 3300005535 Bacteria 3167
100 Ga0070684_100176151 3300005535 Bacteria 1943
101 Ga0070697_100043644 3300005536 Bacteria 3631
102 Ga0070697_100151878 3300005536 Bacteria 1952
103 Ga0070672_100028166 3300005543 Bacteria 4199
104 Ga0070686_100024538 3300005544 Bacteria 3615
105 Ga0070695_100018340 3300005545 Bacteria 4250
106 Ga0070693_100005933 3300005547 Bacteria 5908
107 Ga0070693_100020493 3300005547 Bacteria 3488
108 Ga0070704_100000881 3300005549 Bacteria 15018
109 Ga0068855_100000798 3300005563 Bacteria 38977
110 Ga0068855_100009428 3300005563 Bacteria 11792
111 Ga0070664_100000309 3300005564 Bacteria 35583
112 Ga0070664_100211964 3300005564 Bacteria 1731
113 Ga0068857_100000482 3300005577 Bacteria 28486
114 Ga0068857_100030840 3300005577 Bacteria 4736
115 Ga0068857_100106584 3300005577 Bacteria 2517
116 Ga0068856_100000728 3300005614 Bacteria 35665
117 Ga0068856_100000874 3300005614 Bacteria 32282
118 Ga0068856_100310675 3300005614 Bacteria 1594
119 Ga0070702_100003553 3300005615 Bacteria 6992
120 Ga0070702_100018551 3300005615 Bacteria 3611
121 Ga0068859_100005211 3300005617 Bacteria 13210
122 Ga0068859_100005829 3300005617 Bacteria 12509
123 Ga0068859_100014114 3300005617 Bacteria 8012
124 Ga0068859_100025868 3300005617 Bacteria 5888
125 Ga0068859_100036058 3300005617 Bacteria 4963
126 Ga0068864_100003561 3300005618 Bacteria 12872
127 Ga0068864_100005022 3300005618 Bacteria 10835
128 Ga0068864_100015507 3300005618 Bacteria 6336
129 Ga0068864_100129212 3300005618 Bacteria 2268
130 Ga0068864_100313332 3300005618 Bacteria 1472
131 Ga0068866_10059573 3300005718 Bacteria 1976
132 Ga0068861_100004487 3300005719 Bacteria 9369
133 Ga0068870_10015870 3300005840 Bacteria 3585
134 Ga0068870_10023875 3300005840 Bacteria 3021
135 Ga0068870_10032761 3300005840 Bacteria 2646
136 Ga0068870_10174189 3300005840 Bacteria 1286
137 Ga0068863_100015653 3300005841 Bacteria 7282
138 Ga0068863_100092733 3300005841 Bacteria 2866
139 Ga0068858_100004872 3300005842 Bacteria 13165
140 Ga0068858_100024500 3300005842 Bacteria 5621
141 Ga0068858_100028040 3300005842 Bacteria 5232
142 Ga0068858_100031581 3300005842 Bacteria 4920
143 Ga0068860_100020662 3300005843 Bacteria 6378
144 Ga0068860_100023723 3300005843 Bacteria 5930
145 Ga0068860_100470388 3300005843 Bacteria 1252
146 Ga0068862_100002304 3300005844 Bacteria 17047
147 Ga0068862_100837314 3300005844 Bacteria 901
148 Ga0081455_10002304 3300005937 Archaea 22748
149 Ga0081455_10061689 3300005937 Bacteria 3154
150 Ga0081455_10248571 3300005937 Bacteria 1302
151 Ga0081538_10073064 3300005981 Bacteria 1877
152 Ga0081540_1000088 3300005983 Bacteria 98323
153 Ga0081539_10001068 3300005985 Bacteria 50134
154 Ga0081539_10054025 3300005985 Bacteria 2245
155 Ga0070717_10127405 3300006028 Bacteria 2186
156 Ga0070717_10252565 3300006028 Bacteria 1558
157 Ga0070715_10015118 3300006163 Bacteria 2872
158 Ga0070715_10019140 3300006163 Bacteria 2620
159 Ga0070715_10047383 3300006163 Bacteria 1832
160 Ga0070716_100019658 3300006173 Bacteria 3532
161 Ga0070716_100064702 3300006173 Bacteria 2127
162 Ga0070712_100182737 3300006175 Bacteria 1635
163 Ga0097621_100063660 3300006237 Bacteria 3031
164 Ga0068871_100000278 3300006358 Bacteria 35395
165 Ga0068871_100034958 3300006358 Bacteria 3991
166 Ga0068871_100039819 3300006358 Bacteria 3763
167 Ga0075428_100033881 3300006844 Bacteria 5634
168 Ga0075431_100003275 3300006847 Bacteria 15671
169 Ga0075431_100445387 3300006847 Bacteria 1291
170 Ga0075434_100294585 3300006871 Bacteria 1642
171 Ga0075429_100084324 3300006880 Bacteria 2769
172 Ga0068865_100069792 3300006881 Bacteria 2488
173 Ga0068865_100138336 3300006881 Bacteria 1833
174 Ga0068865_100177924 3300006881 Bacteria 1636
175 Ga0097620_100005211 3300006931 Bacteria 13210
176 Ga0097620_100005829 3300006931 Bacteria 12509
177 Ga0097620_100014114 3300006931 Bacteria 8012
178 Ga0097620_100025867 3300006931 Bacteria 5888
179 Ga0097620_100036058 3300006931 Bacteria 4963
180 Ga0075435_100020946 3300007076 Archaea 5021
181 Ga0105240_10125174 3300009093 Bacteria 3090
182 Ga0105240_10213452 3300009093 Bacteria 2253
183 Ga0105240_10696134 3300009093 Bacteria 1110
184 Ga0111539_10068594 3300009094 Bacteria 4187
185 Ga0111539_10077154 3300009094 Bacteria 3922
186 Ga0111539_10079497 3300009094 Bacteria 3857
187 Ga0111539_10239889 3300009094 Bacteria 2110
188 Ga0105245_10010174 3300009098 Bacteria 8191
189 Ga0105245_10184234 3300009098 Bacteria 1996
190 Ga0105245_10190929 3300009098 Bacteria 1962
191 Ga0105247_10277266 3300009101 Bacteria 1155
192 Ga0105243_10132461 3300009148 Bacteria 2117
193 Ga0105241_10113571 3300009174 Bacteria 2171
194 Ga0105241_10373927 3300009174 Bacteria 1243
195 Ga0105248_10007879 3300009177 Bacteria 11701
196 Ga0105248_10015038 3300009177 Bacteria 8520
197 Ga0105248_10045804 3300009177 Bacteria 4904
198 Ga0105248_10055221 3300009177 Bacteria 4454
199 Ga0105237_10057261 3300009545 Bacteria 3901
200 Ga0105238_10091443 3300009551 Bacteria 3030
201 Ga0105238_10353715 3300009551 Bacteria 1458
202 Ga0105249_10009371 3300009553 Bacteria 8566
203 Ga0105239_10071725 3300010375 Bacteria 3805
204 Ga0105239_10109015 3300010375 Bacteria 3068
205 Ga0105246_10010120 3300011119 Bacteria 5824
206 Ga0105246_10246982 3300011119 Bacteria 1414
207 Ga0157373_10034999 3300013100 Bacteria 3607
208 Ga0157371_10007871 3300013102 Bacteria 8556
209 Ga0157370_10066444 3300013104 Bacteria 3410
210 Ga0157370_10546390 3300013104 Bacteria 1062
211 Ga0157369_10043008 3300013105 Bacteria 4925
212 Ga0157369_10235311 3300013105 Bacteria 1914
213 Ga0157374_10000368 3300013296 Bacteria 41541
214 Ga0157374_10003076 3300013296 Bacteria 13994
215 Ga0157374_10020646 3300013296 Bacteria 5849
216 Ga0157374_10033854 3300013296 Bacteria 4664
217 Ga0157374_10164704 3300013296 Bacteria 2160
218 Ga0157378_10000063 3300013297 Bacteria 94379
219 Ga0157378_10001641 3300013297 Bacteria 20222
220 Ga0157378_10040702 3300013297 Bacteria 4122
221 Ga0157378_10091019 3300013297 Bacteria 2773
222 Ga0157378_10218296 3300013297 Bacteria 1812
223 Ga0163162_10058203 3300013306 Bacteria 3893
224 Ga0163162_10137664 3300013306 Bacteria 2553
225 Ga0163162_10494586 3300013306 Bacteria 1354
226 Ga0157372_10002468 3300013307 Bacteria 20047
227 Ga0157372_10003318 3300013307 Bacteria 17387
228 Ga0157372_10025109 3300013307 Bacteria 6476
229 Ga0157375_10003713 3300013308 Bacteria 13252
230 Ga0163163_10056438 3300014325 Bacteria 3882
231 Ga0163163_10279876 3300014325 Bacteria 1720
232 Ga0157380_10236569 3300014326 Bacteria 1644
233 Ga0157377_10018860 3300014745 Bacteria 3594
234 Ga0157379_10008924 3300014968 Bacteria 8742
235 Ga0157376_10062583 3300014969 Bacteria 3131
236 Ga0163161_10186006 3300017792 Bacteria 1594
237 Ga0197907_11075450 3300020069 Bacteria 1027
238 Ga0197907_11172141 3300020069 Bacteria 1543
239 Ga0197907_11258768 3300020069 Bacteria 1495
240 Ga0206356_10132308 3300020070 Bacteria 2502
241 Ga0206349_1241582 3300020075 Bacteria 2149
242 Ga0206351_10135479 3300020077 Bacteria 2204
243 Ga0206350_10164043 3300020080 Bacteria 2245
244 Ga0206354_10880044 3300020081 Unclassified 1576
245 Ga0206353_11636508 3300020082 Bacteria 1689
246 Ga0154015_1674075 3300020610 Bacteria 1775
247 Ga0214544_1020451 3300021320 Bacteria 4689
248 Ga0214542_1020837 3300021321 Bacteria 4688
249 Ga0214545_1020911 3300021324 Bacteria 5070
250 Ga0214543_1019571 3300021327 Bacteria 5778
251 Ga0214543_1028319 3300021327 Bacteria 2676
252 Ga0213875_10088061 3300021388 Bacteria 1448
253 Ga0224712_10026035 3300022467 Bacteria 2063
254 Ga0224712_10181534 3300022467 Bacteria 948
255 Ga0209674_100016 3300025226 Bacteria 696756
256 Ga0207692_10148120 3300025898 Bacteria 1342
257 Ga0207692_10280697 3300025898 Bacteria 1008
258 Ga0207642_10047123 3300025899 Bacteria 1925
259 Ga0207688_10112923 3300025901 Bacteria 1579
260 Ga0207647_10012399 3300025904 Bacteria 5934
261 Ga0207647_10158121 3300025904 Bacteria 1323
262 Ga0207685_10146006 3300025905 Bacteria 1066
263 Ga0207699_10070447 3300025906 Bacteria 2135
264 Ga0207699_10085807 3300025906 Bacteria 1964
265 Ga0207645_10002235 3300025907 Bacteria 15419
266 Ga0207645_10019506 3300025907 Bacteria 4445
267 Ga0207645_10031318 3300025907 Bacteria 3423
268 Ga0207643_10001576 3300025908 Bacteria 12933
269 Ga0207643_10017072 3300025908 Bacteria 3963
270 Ga0207643_10026591 3300025908 Bacteria 3204
271 Ga0207705_10106321 3300025909 Bacteria 2070
272 Ga0207654_10026023 3300025911 Bacteria 3164
273 Ga0207654_10027864 3300025911 Bacteria 3075
274 Ga0207707_10001602 3300025912 Bacteria 20874
275 Ga0207707_10009290 3300025912 Bacteria 8526
276 Ga0207707_10015782 3300025912 Bacteria 6585
277 Ga0207707_10019044 3300025912 Bacteria 5989
278 Ga0207707_10100386 3300025912 Bacteria 2529
279 Ga0207695_10021583 3300025913 Bacteria 7343
280 Ga0207695_10176526 3300025913 Bacteria 2058
281 Ga0207693_10092437 3300025915 Bacteria 2371
282 Ga0207693_10125514 3300025915 Bacteria 2017
283 Ga0207693_10213620 3300025915 Bacteria 1516
284 Ga0207663_10000996 3300025916 Archaea 12937
285 Ga0207663_10010486 3300025916 Archaea 4934
286 Ga0207663_10178859 3300025916 Bacteria 1513
287 Ga0207660_10001588 3300025917 Bacteria 15243
288 Ga0207660_10013354 3300025917 Bacteria 5382
289 Ga0207660_10021992 3300025917 Bacteria 4294
290 Ga0207662_10016465 3300025918 Bacteria 4173
291 Ga0207662_10024074 3300025918 Bacteria 3503
292 Ga0207662_10071270 3300025918 Bacteria 2104
293 Ga0207657_10001060 3300025919 Bacteria 29182
294 Ga0207657_10018749 3300025919 Bacteria 6591
295 Ga0207657_10072636 3300025919 Bacteria 2909
296 Ga0207649_10024901 3300025920 Bacteria 3483
297 Ga0207649_10035931 3300025920 Bacteria 2981
298 Ga0207649_10238594 3300025920 Bacteria 1304
299 Ga0207652_10001060 3300025921 Bacteria 24994
300 Ga0207652_10020101 3300025921 Bacteria 5498
301 Ga0207652_10054091 3300025921 Bacteria 3450
302 Ga0207652_10061337 3300025921 Bacteria 3247
303 Ga0207646_10017331 3300025922 Bacteria 6742
304 Ga0207646_10026816 3300025922 Bacteria 5255
305 Ga0207646_10065205 3300025922 Bacteria 3251
306 Ga0207681_10002362 3300025923 Bacteria 11995
307 Ga0207681_10113204 3300025923 Bacteria 1978
308 Ga0207681_10235083 3300025923 Bacteria 1424
309 Ga0207694_10291459 3300025924 Bacteria 1342
310 Ga0207650_10040511 3300025925 Bacteria 3409
311 Ga0207650_10199661 3300025925 Bacteria 1601
312 Ga0207659_10073005 3300025926 Bacteria 2511
313 Ga0207659_10170917 3300025926 Bacteria 1715
314 Ga0207687_10034544 3300025927 Bacteria 3433
315 Ga0207700_10143664 3300025928 Bacteria 1964
316 Ga0207700_10315115 3300025928 Bacteria 1354
317 Ga0207700_10406509 3300025928 Bacteria 1194
318 Ga0207664_10006078 3300025929 Bacteria 8269
319 Ga0207664_10126786 3300025929 Bacteria 2144
320 Ga0207664_10352091 3300025929 Bacteria 1304
321 Ga0207664_10389367 3300025929 Bacteria 1238
322 Ga0207644_10050091 3300025931 Bacteria 2993
323 Ga0207690_10012359 3300025932 Bacteria 5108
324 Ga0207706_10007841 3300025933 Bacteria 9854
325 Ga0207706_10010911 3300025933 Bacteria 8289
326 Ga0207706_10190377 3300025933 Bacteria 1801
327 Ga0207706_10334476 3300025933 Bacteria 1317
328 Ga0207686_10200858 3300025934 Bacteria 1428
329 Ga0207670_10033191 3300025936 Bacteria 3324
330 Ga0207670_10244632 3300025936 Bacteria 1383
331 Ga0207704_10104168 3300025938 Bacteria 1900
332 Ga0207704_10313686 3300025938 Bacteria 1207
333 Ga0207665_10091172 3300025939 Bacteria 2113
334 Ga0207665_10121441 3300025939 Bacteria 1846
335 Ga0207665_10177385 3300025939 Bacteria 1542
336 Ga0207691_10028742 3300025940 Bacteria 5204
337 Ga0207691_10029078 3300025940 Bacteria 5169
338 Ga0207691_10037722 3300025940 Bacteria 4474
339 Ga0207711_10016389 3300025941 Bacteria 6160
340 Ga0207711_10036465 3300025941 Bacteria 4172
341 Ga0207711_10102641 3300025941 Bacteria 2532
342 Ga0207689_10000962 3300025942 Bacteria 27679
343 Ga0207689_10002714 3300025942 Bacteria 16374
344 Ga0207689_10117641 3300025942 Bacteria 2185
345 Ga0207689_10532787 3300025942 Bacteria 985
346 Ga0207661_10001653 3300025944 Bacteria 15199
347 Ga0207679_10005541 3300025945 Bacteria 7912
348 Ga0207679_10012755 3300025945 Bacteria 5490
349 Ga0207679_10127395 3300025945 Bacteria 2037
350 Ga0207679_10422126 3300025945 Bacteria 1177
351 Ga0207667_10029028 3300025949 Bacteria 6003
352 Ga0207667_10050326 3300025949 Bacteria 4397
353 Ga0207667_10066157 3300025949 Bacteria 3768
354 Ga0207651_10145724 3300025960 Bacteria 1836
355 Ga0207668_10006991 3300025972 Bacteria 6692
356 Ga0207668_10008948 3300025972 Bacteria 5989
357 Ga0207668_10255816 3300025972 Bacteria 1425
358 Ga0207677_10016607 3300026023 Bacteria 4365
359 Ga0207677_10134875 3300026023 Bacteria 1880
360 Ga0207703_10005276 3300026035 Bacteria 10417
361 Ga0207703_10034301 3300026035 Bacteria 4027
362 Ga0207703_10050680 3300026035 Bacteria 3361
363 Ga0207703_10249687 3300026035 Bacteria 1598
364 Ga0207703_10261631 3300026035 Bacteria 1564
365 Ga0207703_10281981 3300026035 Bacteria 1509
366 Ga0207639_10013576 3300026041 Bacteria 5706
367 Ga0207639_10109878 3300026041 Bacteria 2245
368 Ga0207678_10007495 3300026067 Bacteria 9646
369 Ga0207678_10147957 3300026067 Bacteria 2005
370 Ga0207702_10002964 3300026078 Bacteria 15824
371 Ga0207702_10067072 3300026078 Bacteria 3078
372 Ga0207702_10111116 3300026078 Bacteria 2437
373 Ga0207641_10042574 3300026088 Bacteria 3810
374 Ga0207641_10056163 3300026088 Bacteria 3345
375 Ga0207641_10095036 3300026088 Bacteria 2615
376 Ga0207641_10479966 3300026088 Bacteria 1205
377 Ga0207648_10005695 3300026089 Bacteria 12497
378 Ga0207648_10017520 3300026089 Bacteria 6513
379 Ga0207648_10175315 3300026089 Bacteria 1896
380 Ga0207676_10001813 3300026095 Bacteria 15660
381 Ga0207676_10010121 3300026095 Bacteria 6711
382 Ga0207676_10111435 3300026095 Bacteria 2290
383 Ga0207676_10420637 3300026095 Bacteria 1253
384 Ga0207676_10543392 3300026095 Bacteria 1109
385 Ga0207674_10000468 3300026116 Bacteria 52966
386 Ga0207674_10002521 3300026116 Bacteria 23093
387 Ga0207674_10021459 3300026116 Bacteria 6953
388 Ga0207674_10054343 3300026116 Bacteria 4077
389 Ga0207675_100003146 3300026118 Bacteria 16185
390 Ga0207675_100017457 3300026118 Bacteria 6698
391 Ga0207428_10002153 3300027907 Bacteria 19788
392 Ga0207428_10043705 3300027907 Bacteria 3618
393 Ga0207428_10352496 3300027907 Bacteria 1083
394 Ga0268265_10002661 3300028380 Bacteria 13248
395 Ga0268264_10023255 3300028381 Bacteria 5056
396 Ga0268264_10072550 3300028381 Bacteria 2919
397 Ga0268264_10455962 3300028381 Bacteria 1240
398 Ga0307509_10000021 3300031507 Bacteria 250589
399 Ga0307408_100147802 3300031548 Bacteria 1852
400 Ga0307514_10179086 3300031649 Bacteria 1370
401 Ga0307413_10208910 3300031824 Bacteria 1416
402 Ga0307406_10182181 3300031901 Bacteria 1530
403 Ga0307409_100316196 3300031995 Bacteria 1459
404 Ga0307416_100459254 3300032002 Bacteria 1328
405 Ga0307416_100707981 3300032002 Bacteria 1097
406 Ga0307411_10031370 3300032005 Bacteria 3269
407 Ga0307411_10210265 3300032005 Bacteria 1502
408 Ga0373949_0004099 3300035090 Bacteria 3372
409 Ga0373949_0041485 3300035090 Bacteria 1133
410 Ga0373936_0002743 3300035113 Bacteria 6559
411 Ga0373960_0005265 3300035121 Bacteria 2990
412 Ga0373960_0045835 3300035121 Bacteria 1281
413 Ga0373943_0136678 3300035170 Bacteria 1317
414 Ga0373942_0018141 3300035207 Bacteria 1743
415 Ga0373961_0004998 3300035241 Bacteria 3186
416 Ga0373931_0002844 3300035691 Bacteria 7716
417 Ga0373931_0115661 3300035691 Unclassified 1527
418 Ga0373931_0126952 3300035691 Bacteria 1464
419 Ga0373937_0022850 3300036401 Bacteria 5625
420 Ga0373937_0140818 3300036401 Bacteria 2257
421 Ga0373925_0092540 3300037068 Bacteria 2313
422 Ga0395899_0408402 3300037312 Bacteria 897
423 Ga0395898_0113326 3300037466 Bacteria 2599
424 Ga0395905_0414910 3300037471 Bacteria 1242
425 Ga0395905_0526212 3300037471 Bacteria 1083
426 Ga0436364_1412076 3300037853 Bacteria 2555
427 Ga0395901_0046159 3300038443 Bacteria 4524
428 Ga0439461_0000021 3300041410 Bacteria 20230
429 Ga0439465_0000265 3300041413 Bacteria 14556
430 Ga0439431_0000073 3300041997 Bacteria 16202
431 Ga0439437_007830 3300042000 Bacteria 1197
432 Ga0439442_002022 3300042002 Bacteria 3985
433 Ga0439443_022621 3300042003 Bacteria 999
434 Ga0439448_0076029 3300042005 Bacteria 1123
435 Ga0439432_000505 3300042006 Bacteria 14481
436 Ga0439449_0035439 3300042007 Bacteria 1858
437 Ga0439462_0000473 3300042015 Bacteria 7884
438 Ga0439446_0046966 3300042156 Bacteria 1283
439 Ga0439434_0000298 3300042435 Bacteria 14232
440 Ga0466959_0289226 3300045049 Bacteria 1124
441 Ga0451576_0144068 3300045051 Bacteria 2484
442 Ga0466958_0166733 3300045836 Bacteria 1394
443 Ga0495651_0003450 3300046462 Bacteria 12118
444 Ga0495651_0030140 3300046462 Bacteria 4230
445 Ga0495653_0002738 3300046463 Bacteria 14043
446 Ga0495594_0020718 3300046499 Bacteria 3504
447 Ga0495606_0005758 3300046507 Bacteria 11714
448 Ga0495608_0001682 3300046511 Bacteria 15896
449 Ga0495652_0322642 3300046529 Bacteria 1115
450 Ga0495633_0076476 3300046558 Bacteria 1559
451 Ga0495667_0006292 3300046559 Bacteria 8054
452 Ga0495667_0010152 3300046559 Bacteria 6375
453 Ga0495635_0006112 3300046663 Bacteria 8396
454 Ga0495659_0076676 3300046664 Bacteria 1261
455 Ga0495657_0021125 3300046675 Bacteria 4673
456 Ga0495599_0298317 3300046678 Bacteria 973
457 Ga0495669_0053210 3300046684 Bacteria 1820
458 Ga0495589_0188673 3300046794 Bacteria 976
459 Ga0495600_0066296 3300046809 Bacteria 2360
460 Ga0495672_0027443 3300047320 Bacteria 3618
461 Ga0495680_0011379 3300047322 Bacteria 7876
462 Ga0495680_0085908 3300047322 Bacteria 2368
463 Ga0495675_0061949 3300047444 Bacteria 2369
464 Ga0495675_0068491 3300047444 Bacteria 2242
465 Ga0495684_0039108 3300047471 Bacteria 3636
466 Ga0495602_0108059 3300048088 Bacteria 2266
467 Ga0495602_0176366 3300048088 Bacteria 1653
468 Ga0496102_0267902 3300048905 Bacteria 1610
469 Ga0496104_0110536 3300048907 Bacteria 2635
470 Ga0496105_0201253 3300048908 Bacteria 1626
471 Ga0496106_0204186 3300048909 Bacteria 1573
472 Ga0496108_0061470 3300048911 Bacteria 3161
473 Ga0496109_0168114 3300048912 Bacteria 2057
474 Ga0496110_0427424 3300048913 Bacteria 1207
475 Ga0496112_0019535 3300048915 Bacteria 6397
476 Ga0496112_0336749 3300048915 Bacteria 1452
477 Ga0496115_0001762 3300048918 Bacteria 15505
478 Ga0496121_0033283 3300048924 Bacteria 4668
479 Ga0496126_0019462 3300048929 Bacteria 6686
480 Ga0501298_024766 3300049521 Bacteria 1145
481 Ga0501038_0087932 3300049574 Bacteria 2609
482 Ga0501040_0080763 3300049576 Bacteria 2253
483 Ga0501040_0183022 3300049576 Bacteria 1486
484 Ga0501041_0109165 3300049577 Bacteria 1716
485 Ga0501042_0029162 3300049578 Bacteria 3891
486 Ga0501042_0090167 3300049578 Bacteria 2200
487 Ga0501043_0220944 3300049579 Bacteria 1466
488 Ga0501043_0470422 3300049579 Bacteria 942
489 Ga0501048_0006828 3300049582 Bacteria 8670
490 Ga0501048_0294062 3300049582 Bacteria 1155
491 Ga0501068_0212865 3300049584 Bacteria 1228
492 Ga0501070_0245883 3300049586 Bacteria 1464
493 Ga0501072_0001482 3300049588 Bacteria 17598
494 Ga0501072_0143623 3300049588 Bacteria 1903
495 Ga0501075_0008343 3300049591 Bacteria 7223
496 Ga0501075_0190992 3300049591 Bacteria 1562
497 Ga0501075_0302682 3300049591 Bacteria 1218
498 Ga0501075_0363233 3300049591 Bacteria 1104
499 Ga0501076_0002262 3300049592 Bacteria 13173
500 Ga0501076_0041925 3300049592 Bacteria 3604
501 Ga0501077_0140254 3300049593 Bacteria 1533
502 Ga0501202_036745 3300049652 Bacteria 1044
503 Ga0501079_0126438 3300049741 Bacteria 1989
504 Ga0501079_0166043 3300049741 Bacteria 1722
505 Ga0501081_0032673 3300049743 Bacteria 3531
506 Ga0501035_0213590 3300049822 Bacteria 1650
507 Ga0501045_0157215 3300049824 Bacteria 1691
508 nmdc:mga05p37_11799_c1 3300050507 Bacteria 10415
509 nmdc:mga05p37_33245_c1 3300050507 Bacteria 6316
510 nmdc:mga05p37_3358_c1 3300050507 Bacteria 18673
511 nmdc:mga0qj67_171114_c1 3300050509 Bacteria 1764
512 nmdc:mga0qj67_85924_c1 3300050509 Bacteria 2523
513 nmdc:mga06r32_2260_c1 3300050510 Bacteria 17239
514 nmdc:mga06r32_630_c1 3300050510 Bacteria 30687
515 nmdc:mga08y16_196885_c1 3300050511 Bacteria 2089
516 nmdc:mga08y16_2653_c1 3300050511 Bacteria 18388
517 nmdc:mga08y16_96653_c1 3300050511 Bacteria 3076
518 nmdc:mga0n895_422830_c1 3300050512 Bacteria 1347
519 nmdc:mga0rr50_304883_c1 3300050513 Bacteria 1333
520 nmdc:mga08x19_244939_c1 3300050514 Bacteria 1236
521 nmdc:mga08x19_61140_c1 3300050514 Bacteria 2441
522 nmdc:mga0a205_155796_c1 3300050515 Bacteria 2183
523 nmdc:mga0a205_182741_c1 3300050515 Bacteria 1991
524 Ga0495619_0044565 3300053085 Bacteria 2912
525 Ga0500560_111541 3300053107 Bacteria 918
526 Ga0501084_0040627 3300054114 Bacteria 3892
527 Ga0587073_0006887 3300059492 Bacteria 1771
528 Ga0587090_012588 3300059510 Bacteria 1209
529 Ga0587091_003776 3300059511 Bacteria 1934
530 Ga0587092_000982 3300059512 Bacteria 2615
531 Ga0587114_000860 3300059655 Bacteria 2289
532 Ga0587111_0006512 3300060346 Bacteria 1856
533 Ga0501082_0047156 3300060353 Bacteria 3713
534 Ga0501082_0540564 3300060353 Bacteria 1019
535 Ga0530510_0002220 3300061734 Bacteria 13335
536 Ga0530510_0047497 3300061734 Bacteria 3102
537 2617375526 2617270741 Bacteria 8201522
538 2644196819 2643221634 Bacteria 6705461
539 2824733307 2824732956 Bacteria 7810675
540 2824746565 2824746037 Bacteria 7911610
541 2831936794 2831935698 Bacteria 5963223
542 2838034439 2838029111 Bacteria 6603031
543 2842481186 2842475841 Bacteria 6603183
544 2842507899 2842502639 Bacteria 6604161
545 2908780409 2908775508 Bacteria 8092255
546 Ga0070683_100105204
547 Ga0006778J45830_1036295
548 Ga0006759J45824_1033679
549 JGI25406J46586_10007417
550 Ga0006770J48903_1034693
551 Ga0007417J51691_1008427
552 Ga0007417J51691_1026099
553 Ga0007410J51695_1009092
554 Ga0007410J51695_1024884
555 Ga0007409J51694_1007695
556 Ga0007409J51694_1028720
557 Ga0007416J51690_1010134
558 Ga0007429J51699_1031510
559 JGI25404J52841_10028013
560 Ga0032354_1032570
561 Ga0006780_1017125
562 Ga0055533_1001311
563 Ga0058862_12837317
564 Ga0065704_10008370
565 Ga0065715_10098594
566 Ga0065707_10205159
567 Ga0070683_100007326
568 Ga0070690_100005933
569 Ga0070690_100050097
570 Ga0070670_100006997
571 Ga0070670_100010281
572 Ga0070670_100022745
573 Ga0068869_100026296
574 Ga0070680_100005857
575 Ga0070680_100012743
576 Ga0070680_100076668
577 Ga0070680_100150439
578 Ga0070680_100309433
579 Ga0070682_100009681
580 Ga0070682_100095913
581 Ga0070682_100174508
582 Ga0068868_100004790
583 Ga0068868_100005125
584 Ga0068868_100081930
585 Ga0068868_100102179
586 Ga0070660_100138492
587 Ga0070660_100183761
588 Ga0070689_100020390
589 Ga0070687_100003002
590 Ga0070661_100005417
591 Ga0070661_100009722
592 Ga0070661_100134809
593 Ga0070692_10014106
594 Ga0070668_100216107
595 Ga0070668_100515169
596 Ga0070675_100017576
597 Ga0070675_100018373
598 Ga0070673_100679833
599 Ga0070659_100012551
600 Ga0070659_100060976
601 Ga0070709_10102380
602 Ga0070709_10102815
603 Ga0070709_10127902
604 Ga0070714_100000548
605 Ga0070714_100072376
606 Ga0070714_100222284
607 Ga0070713_100090289
608 Ga0070713_100297496
609 Ga0070710_10086136
610 Ga0070701_10022096
611 Ga0070711_100033636
612 Ga0070711_100125124
613 Ga0070711_100151759
614 Ga0070705_100047985
615 Ga0070694_100012848
616 Ga0070708_100304267
617 Ga0070662_100009715
618 Ga0070662_100035619
619 Ga0070662_100157353
620 Ga0070662_100315237
621 Ga0070662_100609294
622 Ga0070681_10002085
623 Ga0070681_10004859
624 Ga0070681_10010413
625 Ga0070681_10022559
626 Ga0068867_100000641
627 Ga0068867_100013333
628 Ga0070707_100025719
629 Ga0070707_100154674
630 Ga0070707_100245752
631 Ga0070698_100016791
632 Ga0070698_100049438
633 Ga0070698_100257178
634 Ga0070699_100009674
635 Ga0070699_100046125
636 Ga0070699_100123378
637 Ga0070699_100158951
638 Ga0070699_100422574
639 Ga0070679_100004624
640 Ga0070679_100008223
641 Ga0070679_100060235
642 Ga0070684_100044824
643 Ga0070684_100050715
644 Ga0070684_100066372
645 Ga0070684_100176151
646 Ga0070697_100043644
647 Ga0070697_100151878
648 Ga0070672_100028166
649 Ga0070686_100024538
650 Ga0070695_100018340
651 Ga0070693_100005933
652 Ga0070693_100020493
653 Ga0070704_100000881
654 Ga0068855_100000798
655 Ga0068855_100009428
656 Ga0070664_100000309
657 Ga0070664_100211964
658 Ga0068857_100000482
659 Ga0068857_100030840
660 Ga0068857_100106584
661 Ga0068856_100000728
662 Ga0068856_100000874
663 Ga0068856_100310675
664 Ga0070702_100003553
665 Ga0070702_100018551
666 Ga0068859_100005211
667 Ga0068859_100005829
668 Ga0068859_100014114
669 Ga0068859_100025868
670 Ga0068859_100036058
671 Ga0068864_100003561
672 Ga0068864_100005022
673 Ga0068864_100015507
674 Ga0068864_100129212
675 Ga0068864_100313332
676 Ga0068866_10059573
677 Ga0068861_100004487
678 Ga0068870_10015870
679 Ga0068870_10023875
680 Ga0068870_10032761
681 Ga0068870_10174189
682 Ga0068863_100015653
683 Ga0068863_100092733
684 Ga0068858_100004872
685 Ga0068858_100024500
686 Ga0068858_100028040
687 Ga0068858_100031581
688 Ga0068860_100020662
689 Ga0068860_100023723
690 Ga0068860_100470388
691 Ga0068862_100002304
692 Ga0068862_100837314
693 Ga0081455_10002304
694 Ga0081455_10061689
695 Ga0081455_10248571
696 Ga0081538_10073064
697 Ga0081540_1000088
698 Ga0081539_10001068
699 Ga0081539_10054025
700 Ga0070717_10127405
701 Ga0070717_10252565
702 Ga0070715_10015118
703 Ga0070715_10019140
704 Ga0070715_10047383
705 Ga0070716_100019658
706 Ga0070716_100064702
707 Ga0070712_100182737
708 Ga0097621_100063660
709 Ga0068871_100000278
710 Ga0068871_100034958
711 Ga0068871_100039819
712 Ga0075428_100033881
713 Ga0075431_100003275
714 Ga0075431_100445387
715 Ga0075434_100294585
716 Ga0075429_100084324
717 Ga0068865_100069792
718 Ga0068865_100138336
719 Ga0068865_100177924
720 Ga0097620_100005211
721 Ga0097620_100005829
722 Ga0097620_100014114
723 Ga0097620_100025867
724 Ga0097620_100036058
725 Ga0075435_100020946
726 Ga0105240_10125174
727 Ga0105240_10213452
728 Ga0105240_10696134
729 Ga0111539_10068594
730 Ga0111539_10077154
731 Ga0111539_10079497
732 Ga0111539_10239889
733 Ga0105245_10010174
734 Ga0105245_10184234
735 Ga0105245_10190929
736 Ga0105247_10277266
737 Ga0105243_10132461
738 Ga0105241_10113571
739 Ga0105241_10373927
740 Ga0105248_10007879
741 Ga0105248_10015038
742 Ga0105248_10045804
743 Ga0105248_10055221
744 Ga0105237_10057261
745 Ga0105238_10091443
746 Ga0105238_10353715
747 Ga0105249_10009371
748 Ga0105239_10071725
749 Ga0105239_10109015
750 Ga0105246_10010120
751 Ga0105246_10246982
752 Ga0157373_10034999
753 Ga0157371_10007871
754 Ga0157370_10066444
755 Ga0157370_10546390
756 Ga0157369_10043008
757 Ga0157369_10235311
758 Ga0157374_10000368
759 Ga0157374_10003076
760 Ga0157374_10020646
761 Ga0157374_10033854
762 Ga0157374_10164704
763 Ga0157378_10000063
764 Ga0157378_10001641
765 Ga0157378_10040702
766 Ga0157378_10091019
767 Ga0157378_10218296
768 Ga0163162_10058203
769 Ga0163162_10137664
770 Ga0163162_10494586
771 Ga0157372_10002468
772 Ga0157372_10003318
773 Ga0157372_10025109
774 Ga0157375_10003713
775 Ga0163163_10056438
776 Ga0163163_10279876
777 Ga0157380_10236569
778 Ga0157377_10018860
779 Ga0157379_10008924
780 Ga0157376_10062583
781 Ga0163161_10186006
782 Ga0197907_11075450
783 Ga0197907_11172141
784 Ga0197907_11258768
785 Ga0206356_10132308
786 Ga0206349_1241582
787 Ga0206351_10135479
788 Ga0206350_10164043
789 Ga0206354_10880044
790 Ga0206353_11636508
791 Ga0154015_1674075
792 Ga0214544_1020451
793 Ga0214542_1020837
794 Ga0214545_1020911
795 Ga0214543_1019571
796 Ga0214543_1028319
797 Ga0213875_10088061
798 Ga0224712_10026035
799 Ga0224712_10181534
800 Ga0209674_100016
801 Ga0207692_10148120
802 Ga0207692_10280697
803 Ga0207642_10047123
804 Ga0207688_10112923
805 Ga0207647_10012399
806 Ga0207647_10158121
807 Ga0207685_10146006
808 Ga0207699_10070447
809 Ga0207699_10085807
810 Ga0207645_10002235
811 Ga0207645_10019506
812 Ga0207645_10031318
813 Ga0207643_10001576
814 Ga0207643_10017072
815 Ga0207643_10026591
816 Ga0207705_10106321
817 Ga0207654_10026023
818 Ga0207654_10027864
819 Ga0207707_10001602
820 Ga0207707_10009290
821 Ga0207707_10015782
822 Ga0207707_10019044
823 Ga0207707_10100386
824 Ga0207695_10021583
825 Ga0207695_10176526
826 Ga0207693_10092437
827 Ga0207693_10125514
828 Ga0207693_10213620
829 Ga0207663_10000996
830 Ga0207663_10010486
831 Ga0207663_10178859
832 Ga0207660_10001588
833 Ga0207660_10013354
834 Ga0207660_10021992
835 Ga0207662_10016465
836 Ga0207662_10024074
837 Ga0207662_10071270
838 Ga0207657_10001060
839 Ga0207657_10018749
840 Ga0207657_10072636
841 Ga0207649_10024901
842 Ga0207649_10035931
843 Ga0207649_10238594
844 Ga0207652_10001060
845 Ga0207652_10020101
846 Ga0207652_10054091
847 Ga0207652_10061337
848 Ga0207646_10017331
849 Ga0207646_10026816
850 Ga0207646_10065205
851 Ga0207681_10002362
852 Ga0207681_10113204
853 Ga0207681_10235083
854 Ga0207694_10291459
855 Ga0207650_10040511
856 Ga0207650_10199661
857 Ga0207659_10073005
858 Ga0207659_10170917
859 Ga0207687_10034544
860 Ga0207700_10143664
861 Ga0207700_10315115
862 Ga0207700_10406509
863 Ga0207664_10006078
864 Ga0207664_10126786
865 Ga0207664_10352091
866 Ga0207664_10389367
867 Ga0207644_10050091
868 Ga0207690_10012359
869 Ga0207706_10007841
870 Ga0207706_10010911
871 Ga0207706_10190377
872 Ga0207706_10334476
873 Ga0207686_10200858
874 Ga0207670_10033191
875 Ga0207670_10244632
876 Ga0207704_10104168
877 Ga0207704_10313686
878 Ga0207665_10091172
879 Ga0207665_10121441
880 Ga0207665_10177385
881 Ga0207691_10028742
882 Ga0207691_10029078
883 Ga0207691_10037722
884 Ga0207711_10016389
885 Ga0207711_10036465
886 Ga0207711_10102641
887 Ga0207689_10000962
888 Ga0207689_10002714
889 Ga0207689_10117641
890 Ga0207689_10532787
891 Ga0207661_10001653
892 Ga0207679_10005541
893 Ga0207679_10012755
894 Ga0207679_10127395
895 Ga0207679_10422126
896 Ga0207667_10029028
897 Ga0207667_10050326
898 Ga0207667_10066157
899 Ga0207651_10145724
900 Ga0207668_10006991
901 Ga0207668_10008948
902 Ga0207668_10255816
903 Ga0207677_10016607
904 Ga0207677_10134875
905 Ga0207703_10005276
906 Ga0207703_10034301
907 Ga0207703_10050680
908 Ga0207703_10249687
909 Ga0207703_10261631
910 Ga0207703_10281981
911 Ga0207639_10013576
912 Ga0207639_10109878
913 Ga0207678_10007495
914 Ga0207678_10147957
915 Ga0207702_10002964
916 Ga0207702_10067072
917 Ga0207702_10111116
918 Ga0207641_10042574
919 Ga0207641_10056163
920 Ga0207641_10095036
921 Ga0207641_10479966
922 Ga0207648_10005695
923 Ga0207648_10017520
924 Ga0207648_10175315
925 Ga0207676_10001813
926 Ga0207676_10010121
927 Ga0207676_10111435
928 Ga0207676_10420637
929 Ga0207676_10543392
930 Ga0207674_10000468
931 Ga0207674_10002521
932 Ga0207674_10021459
933 Ga0207674_10054343
934 Ga0207675_100003146
935 Ga0207675_100017457
936 Ga0207428_10002153
937 Ga0207428_10043705
938 Ga0207428_10352496
939 Ga0268265_10002661
940 Ga0268264_10023255
941 Ga0268264_10072550
942 Ga0268264_10455962
943 Ga0307509_10000021
944 Ga0307408_100147802
945 Ga0307514_10179086
946 Ga0307413_10208910
947 Ga0307406_10182181
948 Ga0307409_100316196
949 Ga0307416_100459254
950 Ga0307416_100707981
951 Ga0307411_10031370
952 Ga0307411_10210265
953 Ga0373949_0004099
954 Ga0373949_0041485
955 Ga0373936_0002743
956 Ga0373960_0005265
957 Ga0373960_0045835
958 Ga0373943_0136678
959 Ga0373942_0018141
960 Ga0373961_0004998
961 Ga0373931_0002844
962 Ga0373931_0115661
963 Ga0373931_0126952
964 Ga0373937_0022850
965 Ga0373937_0140818
966 Ga0373925_0092540
967 Ga0395899_0408402
968 Ga0395898_0113326
969 Ga0395905_0414910
970 Ga0395905_0526212
971 Ga0436364_1412076
972 Ga0395901_0046159
973 Ga0439461_0000021
974 Ga0439465_0000265
975 Ga0439431_0000073
976 Ga0439437_007830
977 Ga0439442_002022
978 Ga0439443_022621
979 Ga0439448_0076029
980 Ga0439432_000505
981 Ga0439449_0035439
982 Ga0439462_0000473
983 Ga0439446_0046966
984 Ga0439434_0000298
985 Ga0466959_0289226
986 Ga0451576_0144068
987 Ga0466958_0166733
988 Ga0495651_0003450
989 Ga0495651_0030140
990 Ga0495653_0002738
991 Ga0495594_0020718
992 Ga0495606_0005758
993 Ga0495608_0001682
994 Ga0495652_0322642
995 Ga0495633_0076476
996 Ga0495667_0006292
997 Ga0495667_0010152
998 Ga0495635_0006112
999 Ga0495659_0076676
1000 Ga0495657_0021125
1001 Ga0495599_0298317
1002 Ga0495669_0053210
1003 Ga0495589_0188673
1004 Ga0495600_0066296
1005 Ga0495672_0027443
1006 Ga0495680_0011379
1007 Ga0495680_0085908
1008 Ga0495675_0061949
1009 Ga0495675_0068491
1010 Ga0495684_0039108
1011 Ga0495602_0108059
1012 Ga0495602_0176366
1013 Ga0496102_0267902
1014 Ga0496104_0110536
1015 Ga0496105_0201253
1016 Ga0496106_0204186
1017 Ga0496108_0061470
1018 Ga0496109_0168114
1019 Ga0496110_0427424
1020 Ga0496112_0019535
1021 Ga0496112_0336749
1022 Ga0496115_0001762
1023 Ga0496121_0033283
1024 Ga0496126_0019462
1025 Ga0501298_024766
1026 Ga0501038_0087932
1027 Ga0501040_0080763
1028 Ga0501040_0183022
1029 Ga0501041_0109165
1030 Ga0501042_0029162
1031 Ga0501042_0090167
1032 Ga0501043_0220944
1033 Ga0501043_0470422
1034 Ga0501048_0006828
1035 Ga0501048_0294062
1036 Ga0501068_0212865
1037 Ga0501070_0245883
1038 Ga0501072_0001482
1039 Ga0501072_0143623
1040 Ga0501075_0008343
1041 Ga0501075_0190992
1042 Ga0501075_0302682
1043 Ga0501075_0363233
1044 Ga0501076_0002262
1045 Ga0501076_0041925
1046 Ga0501077_0140254
1047 Ga0501202_036745
1048 Ga0501079_0126438
1049 Ga0501079_0166043
1050 Ga0501081_0032673
1051 Ga0501035_0213590
1052 Ga0501045_0157215
1053 nmdc:mga05p37_11799_c1
1054 nmdc:mga05p37_33245_c1
1055 nmdc:mga05p37_3358_c1
1056 nmdc:mga0qj67_171114_c1
1057 nmdc:mga0qj67_85924_c1
1058 nmdc:mga06r32_2260_c1
1059 nmdc:mga06r32_630_c1
1060 nmdc:mga08y16_196885_c1
1061 nmdc:mga08y16_2653_c1
1062 nmdc:mga08y16_96653_c1
1063 nmdc:mga0n895_422830_c1
1064 nmdc:mga0rr50_304883_c1
1065 nmdc:mga08x19_244939_c1
1066 nmdc:mga08x19_61140_c1
1067 nmdc:mga0a205_155796_c1
1068 nmdc:mga0a205_182741_c1
1069 Ga0495619_0044565
1070 Ga0500560_111541
1071 Ga0501084_0040627
1072 Ga0587073_0006887
1073 Ga0587090_012588
1074 Ga0587091_003776
1075 Ga0587092_000982
1076 Ga0587114_000860
1077 Ga0587111_0006512
1078 Ga0501082_0047156
1079 Ga0501082_0540564
1080 Ga0530510_0002220
1081 Ga0530510_0047497
1082 2617375526
1083 2644196819
1084 2824733307
1085 2824746565
1086 2831936794
1087 2838034439
1088 2842481186
1089 2842507899
1090 2908780409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

21

256

0.88

PF12146

Hydrolase_4

Serine aminopeptidase, S33

20

256

0.85

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

23

262

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hea-assembly1.cif.gz_A the l29p/l124i mutation of pseudomonas fluorescens esterase 0.9741 4 275
3t4u-assembly1.cif.gz_A l29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity 0.9739 4 275
3ia2-assembly2.cif.gz_D pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog 0.9737 4 275
3hi4-assembly2.cif.gz_D switching catalysis from hydrolysis to perhydrolysis in p. fluorescens esterase 0.9737 4 275
8pi1-assembly1.cif.gz_B bicyclic incypro pseudomonas fluorescens esterase 0.9729 4 275
ID Description Score Start End Superfamily
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9733 4 275 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9698 4 275 3.40.50.1820
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9695 2 275 3.40.50.1820
1a8qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9672 4 275 3.40.50.1820
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9626 2 275 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A533WKT1-F1-model_v4 Alpha/beta hydrolase 0.9798 4 218 GO:0016787
AF-E6PXJ0-F1-model_v4 Putative peroxidase/hydrolase 0.9794 4 275 GO:0004601
GO:0016787
AF-A0A087NKY4-F1-model_v4 deleted 0.978 4 275
AF-A0A377RRQ0-F1-model_v4 Non-heme chloroperoxidase (EC 1.11.1.10) 0.9772 5 275 GO:0016691
AF-A0A7W7ZIG4-F1-model_v4 Non-heme chloroperoxidase (EC 1.11.1.10) 0.9751 2 275 GO:0016691

Map