F461681

General Info

Members Datasets Scaffolds Average Seq Length
543 278 1086 159

Family's Representative Sequence

Representative Sequence 3300053177|Ga0500636_0005066|Ga0500636_0005066_1788_2321
Length 177
Sequence MRWRPSKKKWKNLKRSRSMNEAPAIAAVRKSVRVKAPIERAFDLFTSGLTRWWPHSHGVGKKPIQKVLMEPRLGGRWLEISEDGTETSVATITHWQPPHRLVMVWQVNAQWKPDAAMKSEVDVRFSADGADTTLVELLHHKFETMGAEAGASMRRDVDGGWPGLLERFVSEAERGAT

Samples

Sample ID Description Type Environment
1 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
259 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
260 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
261 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
262 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
263 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
264 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
265 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
266 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
267 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
270 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
271 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
272 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
273 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
274 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
275 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
276 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
278 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.74
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.89
Nodule 0
Rhizoplane 5.71
Rhizosphere 82.32
Stem 0
Stem Tuber 0
Unclassified 5.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500636_0005066 3300053177 Bacteria 7480
2 rootL2_10041149 3300003322 Bacteria 1880
3 rootH1_10095701 3300003323 Bacteria 2532
4 rootH1_10162906 3300003323 Bacteria 3146
5 Ga0070658_10621036 3300005327 Bacteria 937
6 Ga0070680_100210527 3300005336 Bacteria 1640
7 Ga0070680_100242430 3300005336 Bacteria 1523
8 Ga0070680_100840220 3300005336 Bacteria 791
9 Ga0070682_100079027 3300005337 Bacteria 2123
10 Ga0070660_100823587 3300005339 Bacteria 781
11 Ga0070691_10075687 3300005341 Bacteria 1640
12 Ga0070691_10389253 3300005341 Bacteria 783
13 Ga0070661_100779612 3300005344 Bacteria 783
14 Ga0070668_100461343 3300005347 Unclassified 1094
15 Ga0070709_10019667 3300005434 Bacteria 3907
16 Ga0070709_10077519 3300005434 Bacteria 2160
17 Ga0070709_11426983 3300005434 Bacteria 561
18 Ga0070714_100006274 3300005435 Bacteria 9161
19 Ga0070714_100022515 3300005435 Bacteria 5167
20 Ga0070714_100042303 3300005435 Bacteria 3848
21 Ga0070714_100554183 3300005435 Bacteria 1101
22 Ga0070714_101113781 3300005435 Bacteria 769
23 Ga0070713_100027078 3300005436 Bacteria 4510
24 Ga0070713_100031799 3300005436 Bacteria 4207
25 Ga0070713_100034141 3300005436 Bacteria 4082
26 Ga0070713_100051342 3300005436 Bacteria 3410
27 Ga0070713_100129688 3300005436 Bacteria 2222
28 Ga0070713_100270925 3300005436 Bacteria 1555
29 Ga0070713_100854452 3300005436 Bacteria 874
30 Ga0070713_100894705 3300005436 Bacteria 854
31 Ga0070710_10001220 3300005437 Bacteria 12167
32 Ga0070710_10003703 3300005437 Bacteria 7229
33 Ga0070710_10067392 3300005437 Bacteria 2054
34 Ga0070710_10407819 3300005437 Bacteria 912
35 Ga0070710_10938196 3300005437 Bacteria 627
36 Ga0070711_100005513 3300005439 Bacteria 7575
37 Ga0070711_100012211 3300005439 Bacteria 5362
38 Ga0070711_100016195 3300005439 Bacteria 4731
39 Ga0070711_100445869 3300005439 Bacteria 1059
40 Ga0070705_101074883 3300005440 Bacteria 657
41 Ga0070708_100054904 3300005445 Bacteria 3541
42 Ga0070708_100064734 3300005445 Bacteria 3276
43 Ga0070708_101569556 3300005445 Bacteria 613
44 Ga0070681_10017772 3300005458 Bacteria 7105
45 Ga0070706_100423594 3300005467 Bacteria 1239
46 Ga0070706_100682287 3300005467 Bacteria 953
47 Ga0070706_100943223 3300005467 Bacteria 796
48 Ga0070706_100966616 3300005467 Bacteria 786
49 Ga0070706_101348837 3300005467 Bacteria 653
50 Ga0070698_100159665 3300005471 Bacteria 2199
51 Ga0070698_100178134 3300005471 Bacteria 2064
52 Ga0070698_100574163 3300005471 Bacteria 1067
53 Ga0070698_100594046 3300005471 Bacteria 1047
54 Ga0070698_100798520 3300005471 Bacteria 888
55 Ga0070699_101491065 3300005518 Bacteria 620
56 Ga0070679_100054934 3300005530 Bacteria 3966
57 Ga0070679_100063387 3300005530 Bacteria 3684
58 Ga0070679_100699570 3300005530 Unclassified 956
59 Ga0070684_100064123 3300005535 Bacteria 3222
60 Ga0070684_100087763 3300005535 Bacteria 2762
61 Ga0070697_100677752 3300005536 Bacteria 909
62 Ga0070697_100709879 3300005536 Bacteria 887
63 Ga0070697_100714626 3300005536 Bacteria 884
64 Ga0070697_101215090 3300005536 Bacteria 672
65 Ga0068853_100952984 3300005539 Bacteria 825
66 Ga0070696_100268365 3300005546 Unclassified 1297
67 Ga0068855_100313604 3300005563 Bacteria 1735
68 Ga0068855_100360713 3300005563 Bacteria 1599
69 Ga0068855_100692105 3300005563 Bacteria 1092
70 Ga0068855_101042154 3300005563 Bacteria 858
71 Ga0068857_101100942 3300005577 Bacteria 767
72 Ga0068854_100086018 3300005578 Bacteria 2330
73 Ga0068854_100496894 3300005578 Bacteria 1027
74 Ga0068856_100092225 3300005614 Bacteria 3014
75 Ga0068852_100517936 3300005616 Bacteria 1190
76 Ga0068852_100948694 3300005616 Bacteria 878
77 Ga0068859_100231083 3300005617 Bacteria 1938
78 Ga0068864_100286916 3300005618 Bacteria 1538
79 Ga0068866_11148754 3300005718 Bacteria 558
80 Ga0081455_10202320 3300005937 Bacteria 1486
81 Ga0081455_10283628 3300005937 Bacteria 1195
82 Ga0081538_10170915 3300005981 Bacteria 948
83 Ga0081540_1023580 3300005983 Bacteria 3594
84 Ga0070717_10001690 3300006028 Bacteria 15361
85 Ga0070717_10011591 3300006028 Bacteria 6701
86 Ga0070717_10045129 3300006028 Bacteria 3602
87 Ga0070717_10750099 3300006028 Bacteria 887
88 Ga0070717_11007186 3300006028 Unclassified 759
89 Ga0075368_10211038 3300006042 Bacteria 823
90 Ga0070715_10000972 3300006163 Bacteria 8002
91 Ga0070715_10037319 3300006163 Unclassified 2010
92 Ga0070715_10131626 3300006163 Bacteria 1205
93 Ga0070716_100025347 3300006173 Bacteria 3164
94 Ga0070716_100065414 3300006173 Bacteria 2117
95 Ga0070716_100168867 3300006173 Bacteria 1426
96 Ga0070716_100244307 3300006173 Bacteria 1219
97 Ga0070716_100278244 3300006173 Unclassified 1153
98 Ga0070716_100332317 3300006173 Bacteria 1069
99 Ga0070712_100016712 3300006175 Bacteria 4742
100 Ga0070712_100025754 3300006175 Bacteria 3913
101 Ga0070712_100215927 3300006175 Bacteria 1515
102 Ga0097621_100080777 3300006237 Bacteria 2705
103 Ga0097621_100146948 3300006237 Bacteria 2019
104 Ga0068871_100501838 3300006358 Bacteria 1094
105 Ga0075428_100175242 3300006844 Bacteria 2323
106 Ga0075430_100005375 3300006846 Bacteria 10811
107 Ga0075431_100007837 3300006847 Bacteria 10643
108 Ga0075433_10129618 3300006852 Bacteria 2241
109 Ga0075433_10645348 3300006852 Unclassified 928
110 Ga0075433_11395936 3300006852 Unclassified 606
111 Ga0075434_100077073 3300006871 Bacteria 3328
112 Ga0075434_100394586 3300006871 Unclassified 1405
113 Ga0075434_100572598 3300006871 Bacteria 1149
114 Ga0075434_101310595 3300006871 Bacteria 735
115 Ga0075436_100019236 3300006914 Bacteria 4679
116 Ga0075436_100268299 3300006914 Bacteria 1218
117 Ga0097620_100231077 3300006931 Bacteria 1938
118 Ga0099794_10062598 3300007265 Bacteria 1810
119 Ga0099794_10105993 3300007265 Bacteria 1406
120 Ga0099795_10056075 3300007788 Bacteria 1448
121 Ga0099795_10078387 3300007788 Bacteria 1260
122 Ga0099795_10100297 3300007788 Bacteria 1135
123 Ga0105240_10011273 3300009093 Bacteria 12463
124 Ga0105240_11422146 3300009093 Bacteria 729
125 Ga0111539_11567797 3300009094 Bacteria 764
126 Ga0105247_10005003 3300009101 Bacteria 8419
127 Ga0114129_10219595 3300009147 Bacteria 2565
128 Ga0105237_10145003 3300009545 Bacteria 2369
129 Ga0105237_10361900 3300009545 Bacteria 1455
130 Ga0105237_10667706 3300009545 Bacteria 1046
131 Ga0105238_10341885 3300009551 Bacteria 1485
132 Ga0105238_10723098 3300009551 Bacteria 1008
133 Ga0105249_11977757 3300009553 Bacteria 656
134 Ga0099796_10004502 3300010159 Bacteria 3381
135 Ga0099796_10018659 3300010159 Bacteria 2088
136 Ga0099796_10034293 3300010159 Bacteria 1675
137 Ga0105239_10117856 3300010375 Bacteria 2947
138 Ga0105239_10433506 3300010375 Bacteria 1490
139 Ga0105239_10460056 3300010375 Bacteria 1444
140 Ga0105239_10529846 3300010375 Bacteria 1341
141 Ga0157369_10012432 3300013105 Bacteria 9662
142 Ga0157369_10020644 3300013105 Bacteria 7366
143 Ga0157369_10081491 3300013105 Bacteria 3463
144 Ga0157374_10088467 3300013296 Bacteria 2950
145 Ga0163162_11973387 3300013306 Unclassified 669
146 Ga0163162_12647887 3300013306 Bacteria 577
147 Ga0157372_10056620 3300013307 Bacteria 4380
148 Ga0157372_10436628 3300013307 Bacteria 1526
149 Ga0157379_10186963 3300014968 Bacteria 1872
150 Ga0206356_11911801 3300020070 Bacteria 1130
151 Ga0206354_10184547 3300020081 Bacteria 1574
152 Ga0206354_10653325 3300020081 Bacteria 938
153 Ga0206353_11679581 3300020082 Bacteria 1190
154 Ga0213874_10020243 3300021377 Bacteria 1822
155 Ga0213874_10050428 3300021377 Bacteria 1275
156 Ga0213876_10003089 3300021384 Bacteria 9640
157 Ga0213871_10027488 3300021441 Bacteria 1461
158 Ga0209758_1002267 3300025297 Bacteria 19939
159 Ga0207692_10001610 3300025898 Bacteria 8506
160 Ga0207692_10003099 3300025898 Bacteria 6459
161 Ga0207692_10063800 3300025898 Bacteria 1916
162 Ga0207692_10070017 3300025898 Unclassified 1845
163 Ga0207692_10149382 3300025898 Bacteria 1337
164 Ga0207710_10004687 3300025900 Bacteria 5933
165 Ga0207647_10089460 3300025904 Bacteria 1838
166 Ga0207685_10012061 3300025905 Bacteria 2625
167 Ga0207685_10015207 3300025905 Bacteria 2433
168 Ga0207685_10384530 3300025905 Unclassified 716
169 Ga0207699_10000343 3300025906 Bacteria 24716
170 Ga0207699_10002520 3300025906 Bacteria 8644
171 Ga0207699_10950250 3300025906 Unclassified 635
172 Ga0207705_10505217 3300025909 Bacteria 939
173 Ga0207684_10072207 3300025910 Bacteria 2931
174 Ga0207684_10123524 3300025910 Bacteria 2220
175 Ga0207684_10289188 3300025910 Bacteria 1413
176 Ga0207684_10449682 3300025910 Bacteria 1106
177 Ga0207684_11361424 3300025910 Bacteria 582
178 Ga0207654_10087581 3300025911 Bacteria 1890
179 Ga0207707_10022850 3300025912 Bacteria 5469
180 Ga0207695_10029734 3300025913 Bacteria 6028
181 Ga0207695_10086026 3300025913 Bacteria 3171
182 Ga0207695_10300679 3300025913 Bacteria 1496
183 Ga0207671_10369138 3300025914 Bacteria 1139
184 Ga0207693_10012311 3300025915 Bacteria 6914
185 Ga0207693_10024588 3300025915 Bacteria 4777
186 Ga0207693_10028686 3300025915 Bacteria 4398
187 Ga0207693_10050892 3300025915 Bacteria 3252
188 Ga0207693_10158735 3300025915 Bacteria 1779
189 Ga0207693_11012924 3300025915 Bacteria 634
190 Ga0207663_10002302 3300025916 Bacteria 9151
191 Ga0207663_10009267 3300025916 Bacteria 5193
192 Ga0207663_10046625 3300025916 Bacteria 2671
193 Ga0207663_10142410 3300025916 Bacteria 1672
194 Ga0207663_10449379 3300025916 Bacteria 994
195 Ga0207663_10911356 3300025916 Bacteria 703
196 Ga0207660_10033845 3300025917 Bacteria 3538
197 Ga0207652_10013773 3300025921 Bacteria 6540
198 Ga0207652_10793707 3300025921 Unclassified 841
199 Ga0207646_10802478 3300025922 Bacteria 838
200 Ga0207694_10229089 3300025924 Bacteria 1517
201 Ga0207694_10247541 3300025924 Bacteria 1458
202 Ga0207700_10004606 3300025928 Bacteria 8162
203 Ga0207700_10007192 3300025928 Bacteria 6788
204 Ga0207700_10023271 3300025928 Bacteria 4268
205 Ga0207700_10062187 3300025928 Bacteria 2835
206 Ga0207700_10219225 3300025928 Bacteria 1612
207 Ga0207700_10320571 3300025928 Bacteria 1343
208 Ga0207700_10470796 3300025928 Bacteria 1109
209 Ga0207700_10835016 3300025928 Unclassified 824
210 Ga0207700_11028037 3300025928 Bacteria 737
211 Ga0207664_10004683 3300025929 Bacteria 9280
212 Ga0207664_10005855 3300025929 Bacteria 8408
213 Ga0207664_10034629 3300025929 Bacteria 3890
214 Ga0207664_11322831 3300025929 Bacteria 640
215 Ga0207704_10515795 3300025938 Bacteria 966
216 Ga0207665_10000992 3300025939 Bacteria 19173
217 Ga0207665_10006120 3300025939 Bacteria 7990
218 Ga0207665_10015095 3300025939 Bacteria 5072
219 Ga0207665_10050681 3300025939 Bacteria 2792
220 Ga0207665_10143847 3300025939 Bacteria 1703
221 Ga0207665_10156653 3300025939 Bacteria 1635
222 Ga0207665_10215713 3300025939 Bacteria 1404
223 Ga0207665_10413048 3300025939 Bacteria 1030
224 Ga0207665_10714611 3300025939 Bacteria 788
225 Ga0207661_10045709 3300025944 Bacteria 3467
226 Ga0207661_10168984 3300025944 Bacteria 1902
227 Ga0207679_10783164 3300025945 Bacteria 869
228 Ga0207667_10075239 3300025949 Bacteria 3507
229 Ga0207667_10445281 3300025949 Bacteria 1317
230 Ga0207667_10866785 3300025949 Bacteria 896
231 Ga0207667_11492756 3300025949 Bacteria 647
232 Ga0207640_10086110 3300025981 Bacteria 2162
233 Ga0207639_10270999 3300026041 Bacteria 1489
234 Ga0207639_10380456 3300026041 Bacteria 1267
235 Ga0207676_11126204 3300026095 Bacteria 776
236 Ga0207698_10024283 3300026142 Bacteria 4252
237 Ga0207698_10538375 3300026142 Bacteria 1142
238 Ga0209588_1062251 3300027671 Bacteria 1206
239 Ga0207428_10709029 3300027907 Bacteria 719
240 Ga0268266_11856365 3300028379 Bacteria 577
241 Ga0268264_10000035 3300028381 Bacteria 398196
242 Ga0265326_10006064 3300028558 Bacteria 3779
243 Ga0265319_1011902 3300028563 Bacteria 3539
244 Ga0265334_10002814 3300028573 Bacteria 8023
245 Ga0265323_10001095 3300028653 Bacteria 14016
246 Ga0265336_10000233 3300028666 Bacteria 39706
247 Ga0265338_10000090 3300028800 Bacteria 171540
248 Ga0307511_10059249 3300030521 Bacteria 2947
249 Ga0265320_10001310 3300031240 Bacteria 18189
250 Ga0265325_10020382 3300031241 Bacteria 3655
251 Ga0265340_10181950 3300031247 Bacteria 950
252 Ga0265339_10141802 3300031249 Bacteria 1222
253 Ga0307509_10228496 3300031507 Bacteria 1666
254 Ga0265313_10112784 3300031595 Bacteria 1194
255 Ga0307508_10034106 3300031616 Bacteria 4590
256 Ga0307508_10227139 3300031616 Bacteria 1465
257 Ga0265314_10006452 3300031711 Bacteria 10384
258 Ga0265314_10317743 3300031711 Bacteria 867
259 Ga0307516_10000729 3300031730 Bacteria 44867
260 Ga0307516_10024016 3300031730 Bacteria 6235
261 Ga0307507_10058583 3300033179 Bacteria 3614
262 Ga0307510_10006633 3300033180 Bacteria 13810
263 Ga0373926_0035806 3300035083 Bacteria 1762
264 Ga0373926_0134700 3300035083 Bacteria 937
265 Ga0373923_0031924 3300035111 Bacteria 2125
266 Ga0373923_0088047 3300035111 Bacteria 1355
267 Ga0373936_0312508 3300035113 Bacteria 711
268 Ga0373936_0628044 3300035113 Bacteria 505
269 Ga0373945_0006320 3300035116 Bacteria 3817
270 Ga0373953_0007363 3300035117 Bacteria 3683
271 Ga0373953_0090561 3300035117 Bacteria 1279
272 Ga0373953_0333299 3300035117 Unclassified 664
273 Ga0373954_0006887 3300035118 Bacteria 4961
274 Ga0373954_0067938 3300035118 Bacteria 1690
275 Ga0373956_0008411 3300035119 Bacteria 4177
276 Ga0373957_0040418 3300035120 Bacteria 1753
277 Ga0373943_0004369 3300035170 Bacteria 6408
278 Ga0373943_0039841 3300035170 Bacteria 2266
279 Ga0373943_0105055 3300035170 Bacteria 1482
280 Ga0373943_0206864 3300035170 Bacteria 1088
281 Ga0373946_0013212 3300035171 Bacteria 3100
282 Ga0373955_0003130 3300035172 Bacteria 7242
283 Ga0373955_0050123 3300035172 Bacteria 2269
284 Ga0373961_0146498 3300035241 Bacteria 801
285 Ga0373924_0002448 3300035410 Bacteria 6247
286 Ga0373924_0137955 3300035410 Bacteria 1063
287 Ga0373931_0232626 3300035691 Bacteria 1114
288 Ga0373931_0278615 3300035691 Bacteria 1026
289 Ga0373935_0000150 3300035692 Bacteria 32035
290 Ga0373935_0267001 3300035692 Bacteria 1201
291 Ga0373935_1150851 3300035692 Unclassified 578
292 Ga0373927_0000849 3300035695 Bacteria 23310
293 Ga0373927_0044228 3300035695 Bacteria 2881
294 Ga0373927_0046294 3300035695 Bacteria 2814
295 Ga0373927_0074448 3300035695 Bacteria 2199
296 Ga0373927_0082798 3300035695 Bacteria 2080
297 Ga0373927_0129429 3300035695 Bacteria 1648
298 Ga0373927_0313786 3300035695 Bacteria 1032
299 Ga0373927_0443715 3300035695 Bacteria 857
300 Ga0373933_0004866 3300035724 Bacteria 7328
301 Ga0373947_0001298 3300035725 Bacteria 15370
302 Ga0373947_0061633 3300035725 Bacteria 2280
303 Ga0373947_0065320 3300035725 Bacteria 2219
304 Ga0373947_0166753 3300035725 Bacteria 1427
305 Ga0373947_0360841 3300035725 Unclassified 976
306 Ga0373947_0833854 3300035725 Bacteria 629
307 Ga0373937_0008184 3300036401 Bacteria 9082
308 Ga0373937_0133874 3300036401 Bacteria 2316
309 Ga0373937_1260928 3300036401 Unclassified 687
310 Ga0373925_0051869 3300037068 Bacteria 3063
311 Ga0373925_0155718 3300037068 Bacteria 1797
312 Ga0373925_0161617 3300037068 Bacteria 1764
313 Ga0373925_0318345 3300037068 Bacteria 1258
314 Ga0373925_0323087 3300037068 Unclassified 1249
315 Ga0373925_0554869 3300037068 Bacteria 945
316 Ga0373925_0633738 3300037068 Bacteria 881
317 Ga0395899_0307481 3300037312 Bacteria 1071
318 Ga0395900_0018508 3300037418 Bacteria 7104
319 Ga0395898_0052034 3300037466 Bacteria 4002
320 Ga0395898_0404663 3300037466 Bacteria 1301
321 Ga0395905_1270932 3300037471 Bacteria 640
322 Ga0436364_0945662 3300037853 Bacteria 1675
323 Ga0395901_0594542 3300038443 Bacteria 1116
324 Ga0436365_0675790 3300039437 Bacteria 17254
325 Ga0436365_0810644 3300039437 Bacteria 1420
326 Ga0436365_1373403 3300039437 Bacteria 2468
327 Ga0436360_0599669 3300039438 Bacteria 1068
328 Ga0436360_1203927 3300039438 Bacteria 1704
329 Ga0436361_0288205 3300039447 Bacteria 2645
330 Ga0436361_1043816 3300039447 Bacteria 2770
331 Ga0436363_0022005 3300039450 Bacteria 566
332 Ga0436363_0058465 3300039450 Bacteria 813
333 Ga0436363_0297222 3300039450 Bacteria 3726
334 Ga0436363_0644604 3300039450 Bacteria 3594
335 Ga0436362_0381540 3300039453 Bacteria 5193
336 Ga0451804_1013000 3300041463 Bacteria 982
337 Ga0451807_0528095 3300041486 Bacteria 790
338 Ga0451853_0077130 3300041512 Bacteria 606
339 Ga0466966_0178432 3300044684 Bacteria 1289
340 Ga0466963_0083174 3300044694 Bacteria 2171
341 Ga0466963_1038459 3300044694 Unclassified 577
342 Ga0466958_0377777 3300045836 Unclassified 913
343 Ga0466967_0347981 3300045976 Bacteria 1434
344 Ga0495617_132221 3300046452 Bacteria 800
345 Ga0495592_0001539 3300046454 Bacteria 16097
346 Ga0495592_0008829 3300046454 Bacteria 7571
347 Ga0495603_0001784 3300046455 Bacteria 12697
348 Ga0495603_0001788 3300046455 Bacteria 12687
349 Ga0495603_0010803 3300046455 Bacteria 5540
350 Ga0495603_0046765 3300046455 Bacteria 2578
351 Ga0495603_0711546 3300046455 Bacteria 574
352 Ga0495629_0000338 3300046459 Bacteria 40007
353 Ga0495629_0001699 3300046459 Bacteria 17299
354 Ga0495641_0001278 3300046461 Bacteria 21607
355 Ga0495651_0076027 3300046462 Bacteria 2544
356 Ga0495653_0257157 3300046463 Bacteria 1156
357 Ga0495580_0000235 3300046472 Bacteria 43597
358 Ga0495582_0000524 3300046473 Bacteria 21158
359 Ga0495639_0000039 3300046475 Bacteria 57380
360 Ga0495639_0044717 3300046475 Bacteria 2002
361 Ga0495662_0000109 3300046476 Bacteria 30711
362 Ga0495664_0026355 3300046477 Bacteria 3385
363 Ga0495664_0087045 3300046477 Bacteria 1877
364 Ga0495664_0133184 3300046477 Bacteria 1506
365 Ga0495664_0206279 3300046477 Bacteria 1191
366 Ga0495584_0029891 3300046491 Bacteria 2761
367 Ga0495584_0506701 3300046491 Bacteria 615
368 Ga0495594_0000190 3300046499 Bacteria 29942
369 Ga0495594_0111491 3300046499 Bacteria 1543
370 Ga0495594_0134800 3300046499 Bacteria 1399
371 Ga0495607_0302667 3300046501 Unclassified 752
372 Ga0495618_0126306 3300046514 Bacteria 1638
373 Ga0495618_0355713 3300046514 Bacteria 902
374 Ga0495628_0017134 3300046516 Bacteria 6036
375 Ga0495628_0026035 3300046516 Bacteria 4775
376 Ga0495630_0004917 3300046517 Bacteria 9394
377 Ga0495630_0403905 3300046517 Bacteria 1047
378 Ga0495644_0302107 3300046523 Bacteria 626
379 Ga0495666_0012001 3300046526 Bacteria 4324
380 Ga0495666_0105198 3300046526 Bacteria 1328
381 Ga0495652_0015285 3300046529 Bacteria 6868
382 Ga0495652_0121995 3300046529 Bacteria 2076
383 Ga0495665_0000082 3300046531 Bacteria 41861
384 Ga0495665_0170302 3300046531 Bacteria 1134
385 Ga0495665_0367276 3300046531 Bacteria 732
386 Ga0495640_0000178 3300046533 Bacteria 41951
387 Ga0495640_0463217 3300046533 Bacteria 773
388 Ga0495586_0272652 3300046535 Bacteria 967
389 Ga0495587_0032679 3300046536 Bacteria 3144
390 Ga0495587_0064098 3300046536 Bacteria 2148
391 Ga0495645_0046691 3300046543 Bacteria 3156
392 Ga0495645_0116615 3300046543 Bacteria 1884
393 Ga0495622_0001232 3300046557 Bacteria 13133
394 Ga0495622_0073851 3300046557 Bacteria 1573
395 Ga0495667_0001807 3300046559 Bacteria 14207
396 Ga0495667_0021352 3300046559 Bacteria 4369
397 Ga0495667_0109373 3300046559 Bacteria 1786
398 Ga0495656_0045670 3300046615 Bacteria 1850
399 Ga0495634_0006281 3300046642 Bacteria 9051
400 Ga0495634_0008726 3300046642 Bacteria 7517
401 Ga0495635_0000908 3300046663 Bacteria 19418
402 Ga0495635_0000989 3300046663 Bacteria 18730
403 Ga0495659_0127219 3300046664 Bacteria 1008
404 Ga0495588_0005605 3300046674 Bacteria 5596
405 Ga0495588_0049360 3300046674 Bacteria 2164
406 Ga0495657_0021318 3300046675 Bacteria 4649
407 Ga0495657_0199263 3300046675 Bacteria 1221
408 Ga0495599_0025091 3300046678 Bacteria 3730
409 Ga0495599_0027871 3300046678 Bacteria 3539
410 Ga0495623_0022358 3300046679 Bacteria 4085
411 Ga0495647_0001985 3300046681 Bacteria 6390
412 Ga0495647_0332460 3300046681 Unclassified 689
413 Ga0495658_0007826 3300046683 Bacteria 5292
414 Ga0495613_0046302 3300046689 Bacteria 3216
415 Ga0495613_0201344 3300046689 Unclassified 1404
416 Ga0495613_0295909 3300046689 Bacteria 1121
417 Ga0495624_0001433 3300046690 Bacteria 18540
418 Ga0495624_0590243 3300046690 Bacteria 662
419 Ga0495670_0480609 3300046691 Unclassified 674
420 Ga0495600_0023574 3300046809 Bacteria 3959
421 Ga0495600_0167927 3300046809 Bacteria 1417
422 Ga0495581_0000006 3300047315 Bacteria 77433
423 Ga0495581_0062350 3300047315 Bacteria 2154
424 Ga0495604_0034342 3300047317 Bacteria 4012
425 Ga0495604_0070260 3300047317 Bacteria 2652
426 Ga0495636_0299634 3300047318 Bacteria 752
427 Ga0495674_0001449 3300047319 Bacteria 23260
428 Ga0495674_0016754 3300047319 Bacteria 6836
429 Ga0495674_0231991 3300047319 Bacteria 1523
430 Ga0495674_0746649 3300047319 Bacteria 765
431 Ga0495676_0120291 3300047321 Bacteria 1911
432 Ga0495676_0684338 3300047321 Unclassified 664
433 Ga0495676_0726378 3300047321 Bacteria 642
434 Ga0495680_0010867 3300047322 Bacteria 8095
435 Ga0495680_0606867 3300047322 Unclassified 732
436 Ga0495675_0004052 3300047444 Bacteria 8879
437 Ga0495684_0001724 3300047471 Bacteria 17597
438 Ga0495684_0207423 3300047471 Bacteria 1442
439 Ga0495684_0716252 3300047471 Unclassified 662
440 Ga0495593_0000032 3300047673 Bacteria 58862
441 Ga0495593_0007534 3300047673 Bacteria 6364
442 Ga0495602_0035104 3300048088 Bacteria 4680
443 Ga0496102_0219742 3300048905 Bacteria 1791
444 Ga0496102_0693010 3300048905 Bacteria 942
445 Ga0496103_0358835 3300048906 Bacteria 937
446 Ga0496103_0396801 3300048906 Unclassified 886
447 Ga0496104_0063562 3300048907 Bacteria 3501
448 Ga0496104_0096778 3300048907 Bacteria 2824
449 Ga0496104_0215601 3300048907 Bacteria 1831
450 Ga0496105_0812744 3300048908 Bacteria 710
451 Ga0496106_0004616 3300048909 Bacteria 10219
452 Ga0496106_0016547 3300048909 Bacteria 5456
453 Ga0496107_0345515 3300048910 Bacteria 1107
454 Ga0496108_0005992 3300048911 Bacteria 9848
455 Ga0496108_1024101 3300048911 Bacteria 704
456 Ga0496109_0041675 3300048912 Bacteria 4158
457 Ga0496109_0433047 3300048912 Bacteria 1242
458 Ga0496110_0001652 3300048913 Bacteria 16361
459 Ga0496110_0407050 3300048913 Bacteria 1240
460 Ga0496111_0004073 3300048914 Bacteria 9182
461 Ga0496111_0197134 3300048914 Bacteria 1497
462 Ga0496111_0380860 3300048914 Bacteria 1043
463 Ga0496111_0925285 3300048914 Bacteria 627
464 Ga0496112_0025213 3300048915 Bacteria 5707
465 Ga0496112_0064908 3300048915 Bacteria 3603
466 Ga0496113_0032095 3300048916 Bacteria 3815
467 Ga0496113_0512089 3300048916 Bacteria 963
468 Ga0496114_0226751 3300048917 Bacteria 1641
469 Ga0496115_0069596 3300048918 Bacteria 2851
470 Ga0496115_0786169 3300048918 Bacteria 742
471 Ga0496115_0856659 3300048918 Bacteria 703
472 Ga0496118_0001822 3300048921 Bacteria 30624
473 Ga0496119_0104339 3300048922 Bacteria 1586
474 Ga0496121_0000707 3300048924 Bacteria 62128
475 Ga0496121_0453348 3300048924 Bacteria 826
476 Ga0496124_0009690 3300048927 Bacteria 9862
477 Ga0496125_0123444 3300048928 Bacteria 1841
478 Ga0496126_0009966 3300048929 Bacteria 10034
479 Ga0496126_0204149 3300048929 Bacteria 1667
480 Ga0496126_0487199 3300048929 Bacteria 987
481 Ga0501032_0020471 3300049569 Bacteria 4607
482 Ga0501033_0110568 3300049570 Bacteria 2000
483 Ga0501033_0214474 3300049570 Bacteria 1372
484 Ga0501037_0014268 3300049573 Bacteria 5855
485 Ga0501038_0024539 3300049574 Bacteria 5379
486 Ga0501043_0213214 3300049579 Bacteria 1496
487 Ga0501070_0000017 3300049586 Bacteria 173127
488 Ga0501071_0214825 3300049587 Bacteria 1447
489 Ga0501080_0000444 3300049742 Bacteria 32129
490 Ga0501035_0001450 3300049822 Bacteria 24304
491 Ga0501044_0003825 3300049823 Bacteria 16895
492 Ga0501044_0599859 3300049823 Bacteria 994
493 nmdc:mga06z11_432688_c1 3300050494 Bacteria 794
494 nmdc:mga0qj67_4803_c1 3300050509 Bacteria 9818
495 nmdc:mga06r32_4067_c1 3300050510 Bacteria 13107
496 nmdc:mga08y16_1254296_c1 3300050511 Bacteria 710
497 nmdc:mga0n895_10874_c1 3300050512 Bacteria 8079
498 nmdc:mga0n895_1142963_c1 3300050512 Bacteria 754
499 nmdc:mga0n895_142072_c1 3300050512 Bacteria 2429
500 nmdc:mga0n895_664073_c1 3300050512 Bacteria 1040
501 nmdc:mga0n895_722631_c1 3300050512 Unclassified 991
502 nmdc:mga0n895_838313_c1 3300050512 Bacteria 908
503 nmdc:mga0rr50_169768_c1 3300050513 Bacteria 1776
504 nmdc:mga0rr50_804935_c1 3300050513 Bacteria 802
505 nmdc:mga08x19_34637_c1 3300050514 Bacteria 3192
506 nmdc:mga08x19_52247_c1 3300050514 Bacteria 2628
507 nmdc:mga0a205_637365_c1 3300050515 Bacteria 917
508 Ga0495601_0028179 3300053077 Bacteria 3477
509 Ga0495601_0464436 3300053077 Unclassified 818
510 Ga0495612_0035868 3300053078 Bacteria 2011
511 Ga0495612_0195107 3300053078 Bacteria 892
512 Ga0500635_0005186 3300053080 Bacteria 3399
513 Ga0495595_0002206 3300053084 Bacteria 7566
514 Ga0495619_0164589 3300053085 Bacteria 1532
515 Ga0500647_0125629 3300053091 Bacteria 1212
516 Ga0500566_0000020 3300053094 Bacteria 83462
517 Ga0500566_0150752 3300053094 Bacteria 1223
518 Ga0500640_000459 3300053095 Bacteria 9997
519 Ga0500650_0362347 3300053098 Bacteria 632
520 Ga0500554_151718 3300053102 Bacteria 783
521 Ga0500572_000988 3300053111 Bacteria 8603
522 Ga0500591_017210 3300053115 Bacteria 3492
523 Ga0500595_047020 3300053119 Bacteria 1354
524 Ga0500608_091474 3300053122 Bacteria 1421
525 Ga0500614_000383 3300053123 Bacteria 11532
526 Ga0500559_0039157 3300053136 Bacteria 2061
527 Ga0500559_0088400 3300053136 Bacteria 1416
528 Ga0500559_0153943 3300053136 Bacteria 1079
529 Ga0500590_042737 3300053148 Bacteria 2326
530 Ga0500603_000219 3300053150 Bacteria 15061
531 Ga0500603_000793 3300053150 Bacteria 7570
532 Ga0500630_000308 3300053159 Bacteria 20300
533 Ga0500638_045865 3300053162 Bacteria 2120
534 Ga0500639_000066 3300053163 Bacteria 47938
535 Ga0500636_0154452 3300053177 Bacteria 1257
536 Ga0500637_0014228 3300053178 Bacteria 4191
537 Ga0500637_0192248 3300053178 Bacteria 1165
538 Ga0500637_0412339 3300053178 Bacteria 697
539 Ga0500552_049012 3300053733 Bacteria 710
540 Ga0500596_000033 3300053735 Bacteria 18734
541 Ga0500596_000662 3300053735 Bacteria 6663
542 Ga0530510_0082904 3300061734 Bacteria 2335
543 2885411780 2885409591 Bacteria 9235467
544 Ga0500636_0005066
545 rootL2_10041149
546 rootH1_10095701
547 rootH1_10162906
548 Ga0070658_10621036
549 Ga0070680_100210527
550 Ga0070680_100242430
551 Ga0070680_100840220
552 Ga0070682_100079027
553 Ga0070660_100823587
554 Ga0070691_10075687
555 Ga0070691_10389253
556 Ga0070661_100779612
557 Ga0070668_100461343
558 Ga0070709_10019667
559 Ga0070709_10077519
560 Ga0070709_11426983
561 Ga0070714_100006274
562 Ga0070714_100022515
563 Ga0070714_100042303
564 Ga0070714_100554183
565 Ga0070714_101113781
566 Ga0070713_100027078
567 Ga0070713_100031799
568 Ga0070713_100034141
569 Ga0070713_100051342
570 Ga0070713_100129688
571 Ga0070713_100270925
572 Ga0070713_100854452
573 Ga0070713_100894705
574 Ga0070710_10001220
575 Ga0070710_10003703
576 Ga0070710_10067392
577 Ga0070710_10407819
578 Ga0070710_10938196
579 Ga0070711_100005513
580 Ga0070711_100012211
581 Ga0070711_100016195
582 Ga0070711_100445869
583 Ga0070705_101074883
584 Ga0070708_100054904
585 Ga0070708_100064734
586 Ga0070708_101569556
587 Ga0070681_10017772
588 Ga0070706_100423594
589 Ga0070706_100682287
590 Ga0070706_100943223
591 Ga0070706_100966616
592 Ga0070706_101348837
593 Ga0070698_100159665
594 Ga0070698_100178134
595 Ga0070698_100574163
596 Ga0070698_100594046
597 Ga0070698_100798520
598 Ga0070699_101491065
599 Ga0070679_100054934
600 Ga0070679_100063387
601 Ga0070679_100699570
602 Ga0070684_100064123
603 Ga0070684_100087763
604 Ga0070697_100677752
605 Ga0070697_100709879
606 Ga0070697_100714626
607 Ga0070697_101215090
608 Ga0068853_100952984
609 Ga0070696_100268365
610 Ga0068855_100313604
611 Ga0068855_100360713
612 Ga0068855_100692105
613 Ga0068855_101042154
614 Ga0068857_101100942
615 Ga0068854_100086018
616 Ga0068854_100496894
617 Ga0068856_100092225
618 Ga0068852_100517936
619 Ga0068852_100948694
620 Ga0068859_100231083
621 Ga0068864_100286916
622 Ga0068866_11148754
623 Ga0081455_10202320
624 Ga0081455_10283628
625 Ga0081538_10170915
626 Ga0081540_1023580
627 Ga0070717_10001690
628 Ga0070717_10011591
629 Ga0070717_10045129
630 Ga0070717_10750099
631 Ga0070717_11007186
632 Ga0075368_10211038
633 Ga0070715_10000972
634 Ga0070715_10037319
635 Ga0070715_10131626
636 Ga0070716_100025347
637 Ga0070716_100065414
638 Ga0070716_100168867
639 Ga0070716_100244307
640 Ga0070716_100278244
641 Ga0070716_100332317
642 Ga0070712_100016712
643 Ga0070712_100025754
644 Ga0070712_100215927
645 Ga0097621_100080777
646 Ga0097621_100146948
647 Ga0068871_100501838
648 Ga0075428_100175242
649 Ga0075430_100005375
650 Ga0075431_100007837
651 Ga0075433_10129618
652 Ga0075433_10645348
653 Ga0075433_11395936
654 Ga0075434_100077073
655 Ga0075434_100394586
656 Ga0075434_100572598
657 Ga0075434_101310595
658 Ga0075436_100019236
659 Ga0075436_100268299
660 Ga0097620_100231077
661 Ga0099794_10062598
662 Ga0099794_10105993
663 Ga0099795_10056075
664 Ga0099795_10078387
665 Ga0099795_10100297
666 Ga0105240_10011273
667 Ga0105240_11422146
668 Ga0111539_11567797
669 Ga0105247_10005003
670 Ga0114129_10219595
671 Ga0105237_10145003
672 Ga0105237_10361900
673 Ga0105237_10667706
674 Ga0105238_10341885
675 Ga0105238_10723098
676 Ga0105249_11977757
677 Ga0099796_10004502
678 Ga0099796_10018659
679 Ga0099796_10034293
680 Ga0105239_10117856
681 Ga0105239_10433506
682 Ga0105239_10460056
683 Ga0105239_10529846
684 Ga0157369_10012432
685 Ga0157369_10020644
686 Ga0157369_10081491
687 Ga0157374_10088467
688 Ga0163162_11973387
689 Ga0163162_12647887
690 Ga0157372_10056620
691 Ga0157372_10436628
692 Ga0157379_10186963
693 Ga0206356_11911801
694 Ga0206354_10184547
695 Ga0206354_10653325
696 Ga0206353_11679581
697 Ga0213874_10020243
698 Ga0213874_10050428
699 Ga0213876_10003089
700 Ga0213871_10027488
701 Ga0209758_1002267
702 Ga0207692_10001610
703 Ga0207692_10003099
704 Ga0207692_10063800
705 Ga0207692_10070017
706 Ga0207692_10149382
707 Ga0207710_10004687
708 Ga0207647_10089460
709 Ga0207685_10012061
710 Ga0207685_10015207
711 Ga0207685_10384530
712 Ga0207699_10000343
713 Ga0207699_10002520
714 Ga0207699_10950250
715 Ga0207705_10505217
716 Ga0207684_10072207
717 Ga0207684_10123524
718 Ga0207684_10289188
719 Ga0207684_10449682
720 Ga0207684_11361424
721 Ga0207654_10087581
722 Ga0207707_10022850
723 Ga0207695_10029734
724 Ga0207695_10086026
725 Ga0207695_10300679
726 Ga0207671_10369138
727 Ga0207693_10012311
728 Ga0207693_10024588
729 Ga0207693_10028686
730 Ga0207693_10050892
731 Ga0207693_10158735
732 Ga0207693_11012924
733 Ga0207663_10002302
734 Ga0207663_10009267
735 Ga0207663_10046625
736 Ga0207663_10142410
737 Ga0207663_10449379
738 Ga0207663_10911356
739 Ga0207660_10033845
740 Ga0207652_10013773
741 Ga0207652_10793707
742 Ga0207646_10802478
743 Ga0207694_10229089
744 Ga0207694_10247541
745 Ga0207700_10004606
746 Ga0207700_10007192
747 Ga0207700_10023271
748 Ga0207700_10062187
749 Ga0207700_10219225
750 Ga0207700_10320571
751 Ga0207700_10470796
752 Ga0207700_10835016
753 Ga0207700_11028037
754 Ga0207664_10004683
755 Ga0207664_10005855
756 Ga0207664_10034629
757 Ga0207664_11322831
758 Ga0207704_10515795
759 Ga0207665_10000992
760 Ga0207665_10006120
761 Ga0207665_10015095
762 Ga0207665_10050681
763 Ga0207665_10143847
764 Ga0207665_10156653
765 Ga0207665_10215713
766 Ga0207665_10413048
767 Ga0207665_10714611
768 Ga0207661_10045709
769 Ga0207661_10168984
770 Ga0207679_10783164
771 Ga0207667_10075239
772 Ga0207667_10445281
773 Ga0207667_10866785
774 Ga0207667_11492756
775 Ga0207640_10086110
776 Ga0207639_10270999
777 Ga0207639_10380456
778 Ga0207676_11126204
779 Ga0207698_10024283
780 Ga0207698_10538375
781 Ga0209588_1062251
782 Ga0207428_10709029
783 Ga0268266_11856365
784 Ga0268264_10000035
785 Ga0265326_10006064
786 Ga0265319_1011902
787 Ga0265334_10002814
788 Ga0265323_10001095
789 Ga0265336_10000233
790 Ga0265338_10000090
791 Ga0307511_10059249
792 Ga0265320_10001310
793 Ga0265325_10020382
794 Ga0265340_10181950
795 Ga0265339_10141802
796 Ga0307509_10228496
797 Ga0265313_10112784
798 Ga0307508_10034106
799 Ga0307508_10227139
800 Ga0265314_10006452
801 Ga0265314_10317743
802 Ga0307516_10000729
803 Ga0307516_10024016
804 Ga0307507_10058583
805 Ga0307510_10006633
806 Ga0373926_0035806
807 Ga0373926_0134700
808 Ga0373923_0031924
809 Ga0373923_0088047
810 Ga0373936_0312508
811 Ga0373936_0628044
812 Ga0373945_0006320
813 Ga0373953_0007363
814 Ga0373953_0090561
815 Ga0373953_0333299
816 Ga0373954_0006887
817 Ga0373954_0067938
818 Ga0373956_0008411
819 Ga0373957_0040418
820 Ga0373943_0004369
821 Ga0373943_0039841
822 Ga0373943_0105055
823 Ga0373943_0206864
824 Ga0373946_0013212
825 Ga0373955_0003130
826 Ga0373955_0050123
827 Ga0373961_0146498
828 Ga0373924_0002448
829 Ga0373924_0137955
830 Ga0373931_0232626
831 Ga0373931_0278615
832 Ga0373935_0000150
833 Ga0373935_0267001
834 Ga0373935_1150851
835 Ga0373927_0000849
836 Ga0373927_0044228
837 Ga0373927_0046294
838 Ga0373927_0074448
839 Ga0373927_0082798
840 Ga0373927_0129429
841 Ga0373927_0313786
842 Ga0373927_0443715
843 Ga0373933_0004866
844 Ga0373947_0001298
845 Ga0373947_0061633
846 Ga0373947_0065320
847 Ga0373947_0166753
848 Ga0373947_0360841
849 Ga0373947_0833854
850 Ga0373937_0008184
851 Ga0373937_0133874
852 Ga0373937_1260928
853 Ga0373925_0051869
854 Ga0373925_0155718
855 Ga0373925_0161617
856 Ga0373925_0318345
857 Ga0373925_0323087
858 Ga0373925_0554869
859 Ga0373925_0633738
860 Ga0395899_0307481
861 Ga0395900_0018508
862 Ga0395898_0052034
863 Ga0395898_0404663
864 Ga0395905_1270932
865 Ga0436364_0945662
866 Ga0395901_0594542
867 Ga0436365_0675790
868 Ga0436365_0810644
869 Ga0436365_1373403
870 Ga0436360_0599669
871 Ga0436360_1203927
872 Ga0436361_0288205
873 Ga0436361_1043816
874 Ga0436363_0022005
875 Ga0436363_0058465
876 Ga0436363_0297222
877 Ga0436363_0644604
878 Ga0436362_0381540
879 Ga0451804_1013000
880 Ga0451807_0528095
881 Ga0451853_0077130
882 Ga0466966_0178432
883 Ga0466963_0083174
884 Ga0466963_1038459
885 Ga0466958_0377777
886 Ga0466967_0347981
887 Ga0495617_132221
888 Ga0495592_0001539
889 Ga0495592_0008829
890 Ga0495603_0001784
891 Ga0495603_0001788
892 Ga0495603_0010803
893 Ga0495603_0046765
894 Ga0495603_0711546
895 Ga0495629_0000338
896 Ga0495629_0001699
897 Ga0495641_0001278
898 Ga0495651_0076027
899 Ga0495653_0257157
900 Ga0495580_0000235
901 Ga0495582_0000524
902 Ga0495639_0000039
903 Ga0495639_0044717
904 Ga0495662_0000109
905 Ga0495664_0026355
906 Ga0495664_0087045
907 Ga0495664_0133184
908 Ga0495664_0206279
909 Ga0495584_0029891
910 Ga0495584_0506701
911 Ga0495594_0000190
912 Ga0495594_0111491
913 Ga0495594_0134800
914 Ga0495607_0302667
915 Ga0495618_0126306
916 Ga0495618_0355713
917 Ga0495628_0017134
918 Ga0495628_0026035
919 Ga0495630_0004917
920 Ga0495630_0403905
921 Ga0495644_0302107
922 Ga0495666_0012001
923 Ga0495666_0105198
924 Ga0495652_0015285
925 Ga0495652_0121995
926 Ga0495665_0000082
927 Ga0495665_0170302
928 Ga0495665_0367276
929 Ga0495640_0000178
930 Ga0495640_0463217
931 Ga0495586_0272652
932 Ga0495587_0032679
933 Ga0495587_0064098
934 Ga0495645_0046691
935 Ga0495645_0116615
936 Ga0495622_0001232
937 Ga0495622_0073851
938 Ga0495667_0001807
939 Ga0495667_0021352
940 Ga0495667_0109373
941 Ga0495656_0045670
942 Ga0495634_0006281
943 Ga0495634_0008726
944 Ga0495635_0000908
945 Ga0495635_0000989
946 Ga0495659_0127219
947 Ga0495588_0005605
948 Ga0495588_0049360
949 Ga0495657_0021318
950 Ga0495657_0199263
951 Ga0495599_0025091
952 Ga0495599_0027871
953 Ga0495623_0022358
954 Ga0495647_0001985
955 Ga0495647_0332460
956 Ga0495658_0007826
957 Ga0495613_0046302
958 Ga0495613_0201344
959 Ga0495613_0295909
960 Ga0495624_0001433
961 Ga0495624_0590243
962 Ga0495670_0480609
963 Ga0495600_0023574
964 Ga0495600_0167927
965 Ga0495581_0000006
966 Ga0495581_0062350
967 Ga0495604_0034342
968 Ga0495604_0070260
969 Ga0495636_0299634
970 Ga0495674_0001449
971 Ga0495674_0016754
972 Ga0495674_0231991
973 Ga0495674_0746649
974 Ga0495676_0120291
975 Ga0495676_0684338
976 Ga0495676_0726378
977 Ga0495680_0010867
978 Ga0495680_0606867
979 Ga0495675_0004052
980 Ga0495684_0001724
981 Ga0495684_0207423
982 Ga0495684_0716252
983 Ga0495593_0000032
984 Ga0495593_0007534
985 Ga0495602_0035104
986 Ga0496102_0219742
987 Ga0496102_0693010
988 Ga0496103_0358835
989 Ga0496103_0396801
990 Ga0496104_0063562
991 Ga0496104_0096778
992 Ga0496104_0215601
993 Ga0496105_0812744
994 Ga0496106_0004616
995 Ga0496106_0016547
996 Ga0496107_0345515
997 Ga0496108_0005992
998 Ga0496108_1024101
999 Ga0496109_0041675
1000 Ga0496109_0433047
1001 Ga0496110_0001652
1002 Ga0496110_0407050
1003 Ga0496111_0004073
1004 Ga0496111_0197134
1005 Ga0496111_0380860
1006 Ga0496111_0925285
1007 Ga0496112_0025213
1008 Ga0496112_0064908
1009 Ga0496113_0032095
1010 Ga0496113_0512089
1011 Ga0496114_0226751
1012 Ga0496115_0069596
1013 Ga0496115_0786169
1014 Ga0496115_0856659
1015 Ga0496118_0001822
1016 Ga0496119_0104339
1017 Ga0496121_0000707
1018 Ga0496121_0453348
1019 Ga0496124_0009690
1020 Ga0496125_0123444
1021 Ga0496126_0009966
1022 Ga0496126_0204149
1023 Ga0496126_0487199
1024 Ga0501032_0020471
1025 Ga0501033_0110568
1026 Ga0501033_0214474
1027 Ga0501037_0014268
1028 Ga0501038_0024539
1029 Ga0501043_0213214
1030 Ga0501070_0000017
1031 Ga0501071_0214825
1032 Ga0501080_0000444
1033 Ga0501035_0001450
1034 Ga0501044_0003825
1035 Ga0501044_0599859
1036 nmdc:mga06z11_432688_c1
1037 nmdc:mga0qj67_4803_c1
1038 nmdc:mga06r32_4067_c1
1039 nmdc:mga08y16_1254296_c1
1040 nmdc:mga0n895_10874_c1
1041 nmdc:mga0n895_1142963_c1
1042 nmdc:mga0n895_142072_c1
1043 nmdc:mga0n895_664073_c1
1044 nmdc:mga0n895_722631_c1
1045 nmdc:mga0n895_838313_c1
1046 nmdc:mga0rr50_169768_c1
1047 nmdc:mga0rr50_804935_c1
1048 nmdc:mga08x19_34637_c1
1049 nmdc:mga08x19_52247_c1
1050 nmdc:mga0a205_637365_c1
1051 Ga0495601_0028179
1052 Ga0495601_0464436
1053 Ga0495612_0035868
1054 Ga0495612_0195107
1055 Ga0500635_0005186
1056 Ga0495595_0002206
1057 Ga0495619_0164589
1058 Ga0500647_0125629
1059 Ga0500566_0000020
1060 Ga0500566_0150752
1061 Ga0500640_000459
1062 Ga0500650_0362347
1063 Ga0500554_151718
1064 Ga0500572_000988
1065 Ga0500591_017210
1066 Ga0500595_047020
1067 Ga0500608_091474
1068 Ga0500614_000383
1069 Ga0500559_0039157
1070 Ga0500559_0088400
1071 Ga0500559_0153943
1072 Ga0500590_042737
1073 Ga0500603_000219
1074 Ga0500603_000793
1075 Ga0500630_000308
1076 Ga0500638_045865
1077 Ga0500639_000066
1078 Ga0500636_0154452
1079 Ga0500637_0014228
1080 Ga0500637_0192248
1081 Ga0500637_0412339
1082 Ga0500552_049012
1083 Ga0500596_000033
1084 Ga0500596_000662
1085 Ga0530510_0082904
1086 2885411780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

35

173

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nn5-assembly1.cif.gz_A structure of conserved protein of unknown function ef2215 from enterococcus faecalis 0.8204 11 159
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.7887 8 159
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.7834 8 159
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.7669 8 151
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.7667 9 152
ID Description Score Start End Superfamily
af_O53479_6_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9567 7 154 3.30.530.20
af_O53479_6_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9262 7 154 3.30.530.20
2nn5A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8196 11 159 3.30.530.20
af_A0A1D6FG83_297_420_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.773 72 123 3.30.310.80
af_Q55DB6_248_379_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7648 8 152 3.30.530.20
ID Description Score Start End GO Terms
AF-H0T615-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.995 7 159
AF-H0TD66-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9946 5 159
AF-H0TD66-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9882 5 159
AF-A0A560HKN0-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9779 1 155
AF-A0A1H8NW97-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9734 7 155

Map