F461599

General Info

Members Datasets Scaffolds Average Seq Length
543 276 1086 205

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10029990|Ga0075365_100299902
Length 233
Sequence MPGLTTFRQPVDVLEAGCCKELQTRMDAVGSVIKLHKNDLPAGLAFPNGVAIDSETMGLNPQRDRLCVVQLSAGDGNAHLVQFDGKDWSAPRLKALLADPAVLKIFHFARFDMAMLKQYLGVLPQPIYCTKIASKLVRTYTDRHGLKDLCAELLGIELSKQQQSSDWGADKLSDQQKHYAASDVLHLHALKARLDAMLQREGRLTEAEACFGFLGTRAGLDLAGFAEMDIFAH

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
153 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
260 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
261 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 2643221736 Bosea sp. Root483D1 Isolate Unclassified
271 2841760612 Bosea sp. Tri-49 Isolate Nodule
272 2844104063 Bosea sp. Tri-39 Isolate Nodule
273 2851182111 Bosea sp. Tri-44 Isolate Nodule
274 2851246043 Bosea sp. Tri-54 Isolate Nodule
275 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
276 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0.37
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.31
Nodule 0.92
Rhizoplane 5.52
Rhizosphere 80.66
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10029990 3300006038 Bacteria 3480
2 JGI25159J45721_1009322 3300002987 Bacteria 2599
3 Ga0065165_1000150 3300005262 Bacteria 121992
4 Ga0070683_100152302 3300005329 Bacteria 2192
5 Ga0070680_100004838 3300005336 Bacteria 10142
6 Ga0070680_100011363 3300005336 Bacteria 6887
7 Ga0070680_100194268 3300005336 Bacteria 1711
8 Ga0070680_100342437 3300005336 Bacteria 1271
9 Ga0070682_100181173 3300005337 Bacteria 1472
10 Ga0068868_100512825 3300005338 Bacteria 1052
11 Ga0070689_100219378 3300005340 Bacteria 1559
12 Ga0070687_100141134 3300005343 Bacteria 1403
13 Ga0070661_100221140 3300005344 Bacteria 1452
14 Ga0070692_10119752 3300005345 Bacteria 1467
15 Ga0070668_100017892 3300005347 Bacteria 5317
16 Ga0070668_100158039 3300005347 Bacteria 1838
17 Ga0070668_100180514 3300005347 Bacteria 1724
18 Ga0070668_100302718 3300005347 Bacteria 1341
19 Ga0070669_100116084 3300005353 Bacteria 2037
20 Ga0070669_100655651 3300005353 Bacteria 883
21 Ga0070671_100002208 3300005355 Bacteria 15027
22 Ga0070673_100827213 3300005364 Bacteria 856
23 Ga0070688_100385083 3300005365 Bacteria 1034
24 Ga0070688_100448886 3300005365 Bacteria 964
25 Ga0070659_100127570 3300005366 Bacteria 2065
26 Ga0070659_100175766 3300005366 Bacteria 1756
27 Ga0070667_101030608 3300005367 Bacteria 768
28 Ga0070703_10004110 3300005406 Bacteria 4110
29 Ga0070709_10030465 3300005434 Bacteria 3238
30 Ga0070709_10392469 3300005434 Bacteria 1034
31 Ga0070714_100000594 3300005435 Bacteria 25870
32 Ga0070714_100758166 3300005435 Bacteria 938
33 Ga0070713_100086035 3300005436 Bacteria 2694
34 Ga0070713_100289398 3300005436 Bacteria 1505
35 Ga0070710_10001371 3300005437 Bacteria 11492
36 Ga0070710_10102478 3300005437 Bacteria 1707
37 Ga0070711_100094602 3300005439 Bacteria 2160
38 Ga0070711_100356882 3300005439 Bacteria 1176
39 Ga0070705_100000357 3300005440 Bacteria 26937
40 Ga0070700_100005088 3300005441 Bacteria 6936
41 Ga0070700_100037944 3300005441 Bacteria 2933
42 Ga0070700_100288936 3300005441 Bacteria 1192
43 Ga0070700_100556173 3300005441 Bacteria 892
44 Ga0070694_100014756 3300005444 Bacteria 4896
45 Ga0070694_100057937 3300005444 Bacteria 2634
46 Ga0070708_100199638 3300005445 Bacteria 1872
47 Ga0070663_100062463 3300005455 Bacteria 2685
48 Ga0070663_100331468 3300005455 Bacteria 1227
49 Ga0070663_100442507 3300005455 Bacteria 1070
50 Ga0070663_100629805 3300005455 Bacteria 905
51 Ga0070662_100735781 3300005457 Bacteria 836
52 Ga0070681_10000987 3300005458 Bacteria 24071
53 Ga0070681_10122317 3300005458 Bacteria 2536
54 Ga0070681_10122984 3300005458 Bacteria 2528
55 Ga0070681_10361579 3300005458 Bacteria 1362
56 Ga0070681_10377360 3300005458 Bacteria 1328
57 Ga0068867_100515931 3300005459 Bacteria 1030
58 Ga0070707_100005033 3300005468 Bacteria 12391
59 Ga0070707_100581638 3300005468 Bacteria 1082
60 Ga0070698_100086033 3300005471 Bacteria 3130
61 Ga0070698_100245414 3300005471 Bacteria 1724
62 Ga0070698_100275427 3300005471 Bacteria 1614
63 Ga0070699_100000404 3300005518 Bacteria 41723
64 Ga0070679_100007927 3300005530 Bacteria 9965
65 Ga0070679_100044995 3300005530 Bacteria 4398
66 Ga0070679_100196465 3300005530 Bacteria 1985
67 Ga0070679_100395337 3300005530 Bacteria 1328
68 Ga0070697_100034188 3300005536 Bacteria 4097
69 Ga0068853_100196926 3300005539 Bacteria 1833
70 Ga0068853_100283497 3300005539 Bacteria 1527
71 Ga0070672_100782667 3300005543 Bacteria 839
72 Ga0070686_100215124 3300005544 Bacteria 1386
73 Ga0070695_100001618 3300005545 Bacteria 12622
74 Ga0070695_100002123 3300005545 Bacteria 11350
75 Ga0070696_100000616 3300005546 Bacteria 22871
76 Ga0070693_100078581 3300005547 Bacteria 1961
77 Ga0070665_100038649 3300005548 Bacteria 4797
78 Ga0070665_100562705 3300005548 Bacteria 1153
79 Ga0070704_100001569 3300005549 Bacteria 12338
80 Ga0070704_101020478 3300005549 Bacteria 749
81 Ga0068855_100879873 3300005563 Bacteria 947
82 Ga0068855_100948319 3300005563 Bacteria 906
83 Ga0068855_100976515 3300005563 Bacteria 891
84 Ga0070664_100174750 3300005564 Bacteria 1906
85 Ga0068857_100036569 3300005577 Bacteria 4351
86 Ga0068854_100213701 3300005578 Bacteria 1522
87 Ga0068856_100017912 3300005614 Bacteria 6869
88 Ga0068856_100067657 3300005614 Bacteria 3530
89 Ga0068852_100022789 3300005616 Bacteria 5028
90 Ga0068859_100026259 3300005617 Bacteria 5840
91 Ga0068864_100142291 3300005618 Bacteria 2165
92 Ga0068861_100060103 3300005719 Bacteria 2912
93 Ga0068858_100236662 3300005842 Bacteria 1732
94 Ga0068858_100273015 3300005842 Bacteria 1609
95 Ga0068860_100004462 3300005843 Bacteria 14282
96 Ga0068860_100084103 3300005843 Bacteria 3027
97 Ga0068862_100000968 3300005844 Bacteria 27625
98 Ga0068862_100161569 3300005844 Bacteria 2000
99 Ga0068862_101437210 3300005844 Bacteria 694
100 Ga0081455_10241291 3300005937 Bacteria 1328
101 Ga0081538_10099452 3300005981 Bacteria 1470
102 Ga0081540_1000048 3300005983 Bacteria 127924
103 Ga0081540_1096891 3300005983 Bacteria 1282
104 Ga0081539_10000797 3300005985 Bacteria 61227
105 Ga0081539_10058618 3300005985 Bacteria 2124
106 Ga0070717_10138260 3300006028 Bacteria 2099
107 Ga0075365_10014131 3300006038 Bacteria 4795
108 Ga0075368_10000535 3300006042 Bacteria 11385
109 Ga0075368_10064410 3300006042 Bacteria 1471
110 Ga0075363_100001467 3300006048 Bacteria 8962
111 Ga0075363_100124616 3300006048 Bacteria 1441
112 Ga0075364_10001704 3300006051 Bacteria 12083
113 Ga0070716_100188799 3300006173 Bacteria 1360
114 Ga0070712_100174714 3300006175 Bacteria 1669
115 Ga0070712_100314033 3300006175 Bacteria 1272
116 Ga0070712_100316725 3300006175 Bacteria 1267
117 Ga0075362_10040902 3300006177 Bacteria 2042
118 Ga0075362_10296802 3300006177 Bacteria 801
119 Ga0075367_10298192 3300006178 Bacteria 1014
120 Ga0075367_10330235 3300006178 Bacteria 961
121 Ga0075369_10000573 3300006186 Bacteria 11630
122 Ga0075369_10054510 3300006186 Bacteria 1736
123 Ga0075366_10154418 3300006195 Bacteria 1390
124 Ga0075370_10220605 3300006353 Bacteria 1121
125 Ga0075428_100042900 3300006844 Bacteria 4973
126 Ga0075428_100057539 3300006844 Bacteria 4256
127 Ga0075428_100117634 3300006844 Bacteria 2895
128 Ga0075428_100310772 3300006844 Bacteria 1694
129 Ga0075428_100370099 3300006844 Bacteria 1537
130 Ga0075428_100448624 3300006844 Bacteria 1382
131 Ga0075430_100031433 3300006846 Bacteria 4505
132 Ga0075430_100081954 3300006846 Bacteria 2703
133 Ga0075430_100085827 3300006846 Bacteria 2635
134 Ga0075430_100169419 3300006846 Bacteria 1817
135 Ga0075430_100395221 3300006846 Bacteria 1141
136 Ga0075431_100003335 3300006847 Bacteria 15553
137 Ga0075431_100018534 3300006847 Bacteria 7091
138 Ga0075431_100305777 3300006847 Bacteria 1606
139 Ga0075431_100381526 3300006847 Bacteria 1413
140 Ga0075433_10135075 3300006852 Bacteria 2193
141 Ga0075433_10326406 3300006852 Bacteria 1357
142 Ga0075434_100166728 3300006871 Bacteria 2223
143 Ga0075429_100015640 3300006880 Bacteria 6575
144 Ga0075429_100156987 3300006880 Bacteria 1992
145 Ga0075436_100047078 3300006914 Bacteria 2974
146 Ga0075436_100610402 3300006914 Bacteria 804
147 Ga0097620_100026259 3300006931 Bacteria 5840
148 Ga0097620_100121498 3300006931 Bacteria 2679
149 Ga0097620_101108000 3300006931 Bacteria 871
150 Ga0075435_100041420 3300007076 Bacteria 3681
151 Ga0075435_100116921 3300007076 Bacteria 2222
152 Ga0099795_10000232 3300007788 Bacteria 9771
153 Ga0105240_10083496 3300009093 Bacteria 3919
154 Ga0105240_10499533 3300009093 Bacteria 1353
155 Ga0111539_10004966 3300009094 Bacteria 17309
156 Ga0111539_10109642 3300009094 Bacteria 3239
157 Ga0111539_10121830 3300009094 Bacteria 3056
158 Ga0111539_10354708 3300009094 Bacteria 1707
159 Ga0111539_10887833 3300009094 Bacteria 1037
160 Ga0105245_10597406 3300009098 Bacteria 1130
161 Ga0105247_10213713 3300009101 Bacteria 1302
162 Ga0114129_10016557 3300009147 Bacteria 10499
163 Ga0114129_10058370 3300009147 Bacteria 5397
164 Ga0114129_10098797 3300009147 Bacteria 4040
165 Ga0114129_10373473 3300009147 Bacteria 1884
166 Ga0114129_10403221 3300009147 Bacteria 1802
167 Ga0114129_10766836 3300009147 Bacteria 1233
168 Ga0105243_10634437 3300009148 Bacteria 1033
169 Ga0105243_11461780 3300009148 Bacteria 706
170 Ga0105242_10209299 3300009176 Bacteria 1737
171 Ga0105242_11107131 3300009176 Bacteria 806
172 Ga0105248_11388537 3300009177 Bacteria 795
173 Ga0105238_10080176 3300009551 Bacteria 3254
174 Ga0105249_10007531 3300009553 Bacteria 9497
175 Ga0105249_10453827 3300009553 Bacteria 1321
176 Ga0105249_10726346 3300009553 Bacteria 1054
177 Ga0105249_10904867 3300009553 Bacteria 949
178 Ga0099796_10000095 3300010159 Bacteria 14357
179 Ga0105239_10216896 3300010375 Bacteria 2145
180 Ga0105239_10716879 3300010375 Bacteria 1144
181 Ga0105246_10011369 3300011119 Bacteria 5526
182 Ga0157373_10771541 3300013100 Bacteria 707
183 Ga0157370_10003572 3300013104 Bacteria 18198
184 Ga0157370_10064837 3300013104 Bacteria 3457
185 Ga0157369_10011864 3300013105 Bacteria 9896
186 Ga0157369_10097872 3300013105 Bacteria 3129
187 Ga0157374_10364207 3300013296 Bacteria 1438
188 Ga0163162_10038616 3300013306 Bacteria 4765
189 Ga0163162_10901575 3300013306 Bacteria 997
190 Ga0157372_10146835 3300013307 Bacteria 2720
191 Ga0157372_10561685 3300013307 Bacteria 1330
192 Ga0157372_10672826 3300013307 Bacteria 1205
193 Ga0157380_10005742 3300014326 Bacteria 8682
194 Ga0157380_10183825 3300014326 Bacteria 1839
195 Ga0157379_10298108 3300014968 Bacteria 1469
196 Ga0157376_10145199 3300014969 Bacteria 2133
197 Ga0206353_11841532 3300020082 Bacteria 1318
198 Ga0213873_10080486 3300021358 Bacteria 911
199 Ga0213876_10039435 3300021384 Bacteria 2495
200 Ga0213876_10223150 3300021384 Bacteria 1002
201 Ga0209130_1000187 3300025284 Bacteria 87082
202 Ga0209675_1009939 3300025291 Bacteria 3303
203 Ga0209025_1006243 3300025294 Bacteria 9340
204 Ga0207653_10001945 3300025885 Bacteria 6609
205 Ga0207692_10061135 3300025898 Bacteria 1951
206 Ga0207692_10080229 3300025898 Bacteria 1743
207 Ga0207692_10257342 3300025898 Bacteria 1048
208 Ga0207688_10273304 3300025901 Bacteria 1028
209 Ga0207699_10039636 3300025906 Bacteria 2708
210 Ga0207705_10124717 3300025909 Bacteria 1913
211 Ga0207707_10044724 3300025912 Bacteria 3859
212 Ga0207707_10063143 3300025912 Bacteria 3223
213 Ga0207707_10104745 3300025912 Bacteria 2472
214 Ga0207707_10260671 3300025912 Bacteria 1504
215 Ga0207695_10222755 3300025913 Bacteria 1793
216 Ga0207693_10001882 3300025915 Bacteria 18351
217 Ga0207693_10077357 3300025915 Bacteria 2605
218 Ga0207693_10103246 3300025915 Bacteria 2235
219 Ga0207693_10187236 3300025915 Bacteria 1629
220 Ga0207693_10352116 3300025915 Bacteria 1152
221 Ga0207660_10018708 3300025917 Bacteria 4622
222 Ga0207660_10096409 3300025917 Bacteria 2202
223 Ga0207660_10133516 3300025917 Bacteria 1892
224 Ga0207660_10946285 3300025917 Bacteria 703
225 Ga0207657_10076519 3300025919 Bacteria 2823
226 Ga0207649_10203171 3300025920 Bacteria 1401
227 Ga0207652_10042061 3300025921 Bacteria 3887
228 Ga0207652_10105867 3300025921 Bacteria 2489
229 Ga0207652_10121216 3300025921 Bacteria 2327
230 Ga0207652_10235337 3300025921 Bacteria 1651
231 Ga0207646_10015866 3300025922 Bacteria 7089
232 Ga0207646_10547239 3300025922 Bacteria 1041
233 Ga0207681_10086642 3300025923 Bacteria 2226
234 Ga0207681_10467679 3300025923 Bacteria 1028
235 Ga0207650_10335403 3300025925 Bacteria 1241
236 Ga0207659_10389985 3300025926 Bacteria 1163
237 Ga0207700_10152066 3300025928 Bacteria 1914
238 Ga0207700_10175176 3300025928 Bacteria 1792
239 Ga0207700_10373280 3300025928 Bacteria 1246
240 Ga0207664_10003459 3300025929 Bacteria 10526
241 Ga0207664_10247561 3300025929 Bacteria 1554
242 Ga0207664_10355769 3300025929 Bacteria 1297
243 Ga0207664_11078102 3300025929 Bacteria 718
244 Ga0207644_10038914 3300025931 Bacteria 3354
245 Ga0207690_10128186 3300025932 Bacteria 1853
246 Ga0207690_10260060 3300025932 Bacteria 1344
247 Ga0207706_10277490 3300025933 Bacteria 1462
248 Ga0207706_10764089 3300025933 Bacteria 823
249 Ga0207665_10046903 3300025939 Bacteria 2895
250 Ga0207665_10142572 3300025939 Bacteria 1710
251 Ga0207667_10135378 3300025949 Bacteria 2537
252 Ga0207667_10895915 3300025949 Bacteria 879
253 Ga0207651_10276717 3300025960 Bacteria 1385
254 Ga0207651_10658454 3300025960 Bacteria 920
255 Ga0207651_11177482 3300025960 Bacteria 688
256 Ga0207712_10025763 3300025961 Bacteria 3911
257 Ga0207712_10229710 3300025961 Bacteria 1488
258 Ga0207668_10018035 3300025972 Bacteria 4434
259 Ga0207668_11044500 3300025972 Bacteria 731
260 Ga0207677_10549741 3300026023 Bacteria 1006
261 Ga0207703_10091782 3300026035 Bacteria 2555
262 Ga0207703_10196317 3300026035 Bacteria 1791
263 Ga0207639_10154231 3300026041 Bacteria 1927
264 Ga0207678_10004100 3300026067 Bacteria 13102
265 Ga0207678_10267776 3300026067 Bacteria 1465
266 Ga0207708_10011661 3300026075 Bacteria 6548
267 Ga0207708_10058721 3300026075 Bacteria 2935
268 Ga0207708_10233082 3300026075 Bacteria 1478
269 Ga0207708_10651955 3300026075 Bacteria 896
270 Ga0207702_10085799 3300026078 Bacteria 2744
271 Ga0207641_10595899 3300026088 Bacteria 1081
272 Ga0207676_10054279 3300026095 Bacteria 3140
273 Ga0207676_10077733 3300026095 Bacteria 2686
274 Ga0207674_10001752 3300026116 Bacteria 27750
275 Ga0207675_100006887 3300026118 Bacteria 10766
276 Ga0207675_100391988 3300026118 Bacteria 1367
277 Ga0209179_1002909 3300027512 Bacteria 2390
278 Ga0209813_10000431 3300027866 Bacteria 10251
279 Ga0209813_10003028 3300027866 Bacteria 3903
280 Ga0209813_10077942 3300027866 Bacteria 1090
281 Ga0207428_10001719 3300027907 Bacteria 22431
282 Ga0207428_10193584 3300027907 Bacteria 1532
283 Ga0268265_10081576 3300028380 Bacteria 2554
284 Ga0268264_10006466 3300028381 Bacteria 9866
285 Ga0268264_10008048 3300028381 Bacteria 8766
286 Ga0265337_1008904 3300028556 Bacteria 3615
287 Ga0265318_10052406 3300028577 Bacteria 1531
288 Ga0265338_10148684 3300028800 Bacteria 1823
289 Ga0265338_10522267 3300028800 Bacteria 834
290 Ga0265330_10088655 3300031235 Bacteria 1329
291 Ga0265332_10041973 3300031238 Bacteria 1978
292 Ga0265332_10088951 3300031238 Bacteria 1307
293 Ga0265325_10113722 3300031241 Bacteria 1312
294 Ga0265340_10067097 3300031247 Bacteria 1705
295 Ga0265339_10014949 3300031249 Bacteria 4667
296 Ga0265331_10000586 3300031250 Bacteria 32549
297 Ga0265331_10015971 3300031250 Bacteria 3950
298 Ga0265314_10019890 3300031711 Bacteria 5191
299 Ga0265314_10021381 3300031711 Bacteria 4975
300 Ga0265342_10139451 3300031712 Bacteria 1353
301 Ga0307406_10110140 3300031901 Bacteria 1894
302 Ga0307406_10199690 3300031901 Bacteria 1471
303 Ga0307411_10557236 3300032005 Bacteria 979
304 Ga0316053_103422 3300032120 Bacteria 941
305 Ga0373926_0002650 3300035083 Bacteria 5695
306 Ga0373928_0030212 3300035084 Bacteria 1196
307 Ga0373928_0085123 3300035084 Bacteria 803
308 Ga0373934_0051082 3300035086 Bacteria 1639
309 Ga0373944_0015202 3300035089 Bacteria 2158
310 Ga0373936_0332326 3300035113 Bacteria 690
311 Ga0373939_0140770 3300035114 Bacteria 870
312 Ga0373953_0050757 3300035117 Bacteria 1676
313 Ga0373943_0098512 3300035170 Bacteria 1525
314 Ga0373946_0244234 3300035171 Bacteria 874
315 Ga0373955_0037328 3300035172 Bacteria 2582
316 Ga0373961_0018830 3300035241 Bacteria 1808
317 Ga0373961_0134555 3300035241 Bacteria 830
318 Ga0373931_0000910 3300035691 Bacteria 12471
319 Ga0373931_0028774 3300035691 Bacteria 2848
320 Ga0373931_0204528 3300035691 Bacteria 1181
321 Ga0373927_0031881 3300035695 Bacteria 3433
322 Ga0373927_0200045 3300035695 Bacteria 1312
323 Ga0373933_0013344 3300035724 Bacteria 4553
324 Ga0373933_0074928 3300035724 Bacteria 2065
325 Ga0373947_0015551 3300035725 Bacteria 4370
326 Ga0373947_0448576 3300035725 Bacteria 874
327 Ga0373937_0036569 3300036401 Bacteria 4475
328 Ga0373937_0089385 3300036401 Bacteria 2852
329 Ga0373937_0147152 3300036401 Bacteria 2205
330 Ga0373925_0046645 3300037068 Bacteria 3223
331 Ga0373925_0217367 3300037068 Bacteria 1524
332 Ga0395899_0051221 3300037312 Bacteria 3064
333 Ga0395899_0291421 3300037312 Bacteria 1107
334 Ga0395900_0049048 3300037418 Bacteria 4349
335 Ga0395900_0096496 3300037418 Bacteria 3037
336 Ga0395900_0130172 3300037418 Bacteria 2579
337 Ga0395900_0431661 3300037418 Bacteria 1276
338 Ga0395898_0055211 3300037466 Bacteria 3874
339 Ga0395898_0070694 3300037466 Bacteria 3373
340 Ga0395898_0108611 3300037466 Bacteria 2660
341 Ga0395905_0043438 3300037471 Bacteria 4217
342 Ga0436364_0139470 3300037853 Bacteria 5325
343 Ga0436364_0178373 3300037853 Bacteria 15951
344 Ga0436364_0356442 3300037853 Bacteria 3712
345 Ga0436364_0803723 3300037853 Bacteria 805
346 Ga0395901_0006936 3300038443 Bacteria 11445
347 Ga0395901_0032028 3300038443 Bacteria 5424
348 Ga0395901_0043243 3300038443 Bacteria 4673
349 Ga0395901_0194205 3300038443 Bacteria 2128
350 Ga0400486_31203 3300038742 Unclassified 1559
351 Ga0436365_0387785 3300039437 Bacteria 1024
352 Ga0436365_0633453 3300039437 Bacteria 25670
353 Ga0436365_0698488 3300039437 Bacteria 2308
354 Ga0436365_1144500 3300039437 Bacteria 1392
355 Ga0436360_0039666 3300039438 Bacteria 949
356 Ga0436360_0470140 3300039438 Bacteria 1157
357 Ga0436360_0691709 3300039438 Bacteria 6582
358 Ga0436360_1070389 3300039438 Bacteria 1637
359 Ga0436361_0088001 3300039447 Bacteria 2026
360 Ga0436361_0306123 3300039447 Bacteria 18730
361 Ga0436361_1096286 3300039447 Bacteria 1614
362 Ga0436361_1129523 3300039447 Bacteria 770
363 Ga0436363_0396333 3300039450 Bacteria 1441
364 Ga0436363_0534202 3300039450 Bacteria 2643
365 Ga0436362_0182447 3300039453 Bacteria 1274
366 Ga0436362_0494352 3300039453 Bacteria 1921
367 Ga0436362_0511093 3300039453 Bacteria 6884
368 Ga0436362_0699119 3300039453 Bacteria 1653
369 Ga0436362_0881187 3300039453 Bacteria 797
370 Ga0451802_2020354 3300041460 Bacteria 959
371 Ga0439464_0022433 3300042439 Bacteria 1739
372 Ga0453684_0248376 3300044712 Bacteria 2044
373 Ga0466957_0001660 3300044842 Bacteria 11680
374 Ga0466957_0663574 3300044842 Bacteria 734
375 Ga0466960_0193328 3300044901 Bacteria 1108
376 Ga0466958_0001407 3300045836 Bacteria 11379
377 Ga0495603_0209402 3300046455 Bacteria 1126
378 Ga0495658_0170502 3300046683 Bacteria 1347
379 Ga0496100_0026992 3300048903 Bacteria 3526
380 Ga0496102_0006383 3300048905 Bacteria 10051
381 Ga0496102_0075055 3300048905 Bacteria 3108
382 Ga0496102_0142791 3300048905 Bacteria 2245
383 Ga0496102_0622111 3300048905 Bacteria 1003
384 Ga0496103_0098286 3300048906 Bacteria 1851
385 Ga0496103_0662962 3300048906 Bacteria 662
386 Ga0496104_0000360 3300048907 Bacteria 40585
387 Ga0496104_0018348 3300048907 Bacteria 6384
388 Ga0496105_0026031 3300048908 Bacteria 4768
389 Ga0496105_0071285 3300048908 Bacteria 2872
390 Ga0496106_0000538 3300048909 Bacteria 26884
391 Ga0496107_0129532 3300048910 Bacteria 1862
392 Ga0496108_0003186 3300048911 Bacteria 13203
393 Ga0496108_0076567 3300048911 Bacteria 2828
394 Ga0496108_0292426 3300048911 Bacteria 1418
395 Ga0496109_0007552 3300048912 Bacteria 9218
396 Ga0496109_0056358 3300048912 Bacteria 3587
397 Ga0496109_0131214 3300048912 Bacteria 2339
398 Ga0496110_0002031 3300048913 Bacteria 15082
399 Ga0496110_0095779 3300048913 Bacteria 2659
400 Ga0496111_0005290 3300048914 Bacteria 8244
401 Ga0496111_0390905 3300048914 Bacteria 1028
402 Ga0496112_0003551 3300048915 Bacteria 12952
403 Ga0496112_0098441 3300048915 Bacteria 2894
404 Ga0496112_0156834 3300048915 Bacteria 2243
405 Ga0496112_0407309 3300048915 Bacteria 1299
406 Ga0496115_0006961 3300048918 Bacteria 8305
407 Ga0496115_0040156 3300048918 Bacteria 3719
408 Ga0501034_0050825 3300049571 Bacteria 4180
409 Ga0501034_0357475 3300049571 Bacteria 1388
410 Ga0501036_0204374 3300049572 Bacteria 1661
411 Ga0501038_0190438 3300049574 Unclassified 1651
412 Ga0501039_0177168 3300049575 Bacteria 1677
413 Ga0501039_0200518 3300049575 Bacteria 1569
414 Ga0501039_0227862 3300049575 Bacteria 1465
415 Ga0501039_0526281 3300049575 Bacteria 928
416 Ga0501040_0010952 3300049576 Bacteria 5930
417 Ga0501040_0026451 3300049576 Bacteria 3903
418 Ga0501041_0005902 3300049577 Bacteria 7157
419 Ga0501042_0006432 3300049578 Bacteria 7622
420 Ga0501042_0404249 3300049578 Bacteria 989
421 Ga0501043_0194021 3300049579 Bacteria 1579
422 Ga0501043_0644025 3300049579 Bacteria 779
423 Ga0501046_0075017 3300049580 Bacteria 2623
424 Ga0501046_0225790 3300049580 Unclassified 1385
425 Ga0501047_0006888 3300049581 Bacteria 10680
426 Ga0501047_0315671 3300049581 Bacteria 1403
427 Ga0501047_0613079 3300049581 Bacteria 909
428 Ga0501067_0047253 3300049583 Bacteria 2387
429 Ga0501068_0103574 3300049584 Bacteria 1765
430 Ga0501070_0474870 3300049586 Bacteria 1006
431 Ga0501072_0047328 3300049588 Bacteria 3387
432 Ga0501072_0064287 3300049588 Bacteria 2894
433 Ga0501072_0075725 3300049588 Bacteria 2662
434 Ga0501072_0190041 3300049588 Bacteria 1638
435 Ga0501073_0271691 3300049589 Bacteria 1170
436 Ga0501074_0470032 3300049590 Bacteria 891
437 Ga0501075_0007881 3300049591 Bacteria 7394
438 Ga0501075_0023919 3300049591 Bacteria 4475
439 Ga0501075_0056403 3300049591 Bacteria 2957
440 Ga0501076_0274584 3300049592 Bacteria 1380
441 Ga0501076_0291362 3300049592 Bacteria 1337
442 Ga0501076_0346574 3300049592 Unclassified 1219
443 Ga0501076_0473330 3300049592 Bacteria 1032
444 Ga0501077_0043570 3300049593 Bacteria 2852
445 Ga0501077_0117969 3300049593 Bacteria 1682
446 Ga0501077_0460396 3300049593 Bacteria 815
447 Ga0501077_0579533 3300049593 Bacteria 720
448 Ga0501079_0011025 3300049741 Bacteria 6889
449 Ga0501079_0025776 3300049741 Bacteria 4509
450 Ga0501079_0046600 3300049741 Bacteria 3345
451 Ga0501079_0066916 3300049741 Bacteria 2773
452 Ga0501080_0015254 3300049742 Bacteria 7082
453 Ga0501080_0620978 3300049742 Bacteria 958
454 Ga0501080_0689934 3300049742 Bacteria 901
455 Ga0501081_0046834 3300049743 Bacteria 2974
456 Ga0501081_0051534 3300049743 Bacteria 2838
457 Ga0501081_0055574 3300049743 Bacteria 2735
458 Ga0501081_0253967 3300049743 Bacteria 1284
459 Ga0501083_0482640 3300049744 Bacteria 807
460 Ga0501083_0648440 3300049744 Bacteria 687
461 Ga0501044_0051473 3300049823 Bacteria 4246
462 Ga0501045_0168877 3300049824 Bacteria 1629
463 Ga0501045_0391453 3300049824 Bacteria 1034
464 nmdc:mga03683_167124_c1 3300050489 Bacteria 998
465 nmdc:mga03n38_15716_c1 3300050490 Bacteria 2928
466 nmdc:mga03n38_218526_c1 3300050490 Bacteria 994
467 nmdc:mga00v17_2831_c1 3300050491 Bacteria 8910
468 nmdc:mga0yw44_63132_c1 3300050492 Bacteria 2277
469 nmdc:mga0yw44_77565_c1 3300050492 Bacteria 2076
470 nmdc:mga0yw44_86737_c1 3300050492 Bacteria 1972
471 nmdc:mga0k408_226983_c1 3300050493 Bacteria 1115
472 nmdc:mga0k408_323945_c1 3300050493 Bacteria 919
473 nmdc:mga06z11_11304_c1 3300050494 Bacteria 3845
474 nmdc:mga06z11_135946_c1 3300050494 Bacteria 1385
475 nmdc:mga06z11_34933_c1 3300050494 Bacteria 2471
476 nmdc:mga06z11_4879_c1 3300050494 Bacteria 5319
477 nmdc:mga06z11_61848_c1 3300050494 Bacteria 1954
478 nmdc:mga06z11_96337_c1 3300050494 Bacteria 1616
479 nmdc:mga04h51_165480_c1 3300050495 Bacteria 853
480 nmdc:mga04h51_2897_c1 3300050495 Bacteria 4114
481 nmdc:mga04h51_4839_c1 3300050495 Bacteria 3385
482 nmdc:mga04h51_88643_c1 3300050495 Bacteria 1110
483 nmdc:mga07m45_63451_c2 3300050496 Bacteria 1432
484 nmdc:mga05p37_113508_c1 3300050507 Bacteria 3331
485 nmdc:mga05p37_477815_c1 3300050507 Bacteria 1436
486 nmdc:mga05p37_55779_c1 3300050507 Bacteria 4864
487 nmdc:mga09592_13722_c1 3300050508 Bacteria 6620
488 nmdc:mga09592_158998_c1 3300050508 Bacteria 1951
489 nmdc:mga09592_956663_c1 3300050508 Bacteria 718
490 nmdc:mga0qj67_157007_c1 3300050509 Bacteria 1846
491 nmdc:mga0qj67_383376_c1 3300050509 Bacteria 1135
492 nmdc:mga0qj67_43731_c1 3300050509 Bacteria 3528
493 nmdc:mga06r32_12459_c1 3300050510 Bacteria 7674
494 nmdc:mga06r32_1544_c1 3300050510 Bacteria 20738
495 nmdc:mga06r32_206238_c1 3300050510 Bacteria 1954
496 nmdc:mga06r32_288981_c1 3300050510 Bacteria 1626
497 nmdc:mga06r32_4807_c1 3300050510 Bacteria 12156
498 nmdc:mga06r32_59622_c1 3300050510 Bacteria 3671
499 nmdc:mga06r32_77175_c1 3300050510 Bacteria 3236
500 nmdc:mga08y16_12389_c1 3300050511 Bacteria 8968
501 nmdc:mga08y16_128382_c1 3300050511 Bacteria 2637
502 nmdc:mga08y16_4211_c1 3300050511 Bacteria 15009
503 nmdc:mga0n895_624834_c1 3300050512 Bacteria 1078
504 nmdc:mga0rr50_146182_c1 3300050513 Bacteria 1906
505 nmdc:mga0rr50_515039_c1 3300050513 Bacteria 1018
506 nmdc:mga0a205_380919_c1 3300050515 Bacteria 1276
507 nmdc:mga0a205_429909_c1 3300050515 Bacteria 1182
508 nmdc:mga0sz30_160568_c1 3300050516 Bacteria 996
509 nmdc:mga0sz30_205656_c1 3300050516 Bacteria 874
510 nmdc:mga0sz30_211253_c1 3300050516 Bacteria 862
511 nmdc:mga0sz30_30864_c1 3300050516 Bacteria 2216
512 Ga0495601_0018425 3300053077 Bacteria 4250
513 Ga0500643_001444 3300053087 Bacteria 13682
514 Ga0500643_036979 3300053087 Bacteria 1456
515 Ga0500641_0003989 3300053096 Bacteria 5217
516 Ga0500641_0010203 3300053096 Bacteria 3389
517 Ga0500652_002284 3300053131 Bacteria 5765
518 Ga0500658_0114656 3300053134 Bacteria 1189
519 Ga0500568_0005794 3300053139 Bacteria 6311
520 Ga0500616_0262963 3300053153 Bacteria 732
521 Ga0500601_008584 3300053737 Bacteria 1137
522 Ga0501084_0004623 3300054114 Bacteria 11247
523 Ga0501084_0043742 3300054114 Bacteria 3746
524 Ga0501084_0059802 3300054114 Bacteria 3190
525 Ga0501084_0115743 3300054114 Bacteria 2253
526 Ga0501084_0944644 3300054114 Bacteria 725
527 Ga0501082_0003609 3300060353 Bacteria 13515
528 Ga0501082_0139706 3300060353 Bacteria 2102
529 Ga0501082_0163508 3300060353 Bacteria 1934
530 Ga0501082_0390128 3300060353 Bacteria 1215
531 Ga0501082_0728887 3300060353 Bacteria 868
532 Ga0466962_0017410 3300061719 Bacteria 3460
533 Ga0530510_0007046 3300061734 Bacteria 7830
534 Ga0530510_0009563 3300061734 Bacteria 6799
535 Ga0530510_0056980 3300061734 Bacteria 2824
536 Ga0530510_0414220 3300061734 Bacteria 1017
537 2644742576 2643221736 Bacteria 6608466
538 2841763981 2841760612 Bacteria 6454112
539 2844108564 2844104063 Bacteria 6440972
540 2851185224 2851182111 Bacteria 6047226
541 2851250416 2851246043 Bacteria 6439203
542 3000020743 3000017691 Bacteria 3772574
543 8057534094 8057529695 Bacteria 6306553
544 Ga0075365_10029990
545 JGI25159J45721_1009322
546 Ga0065165_1000150
547 Ga0070683_100152302
548 Ga0070680_100004838
549 Ga0070680_100011363
550 Ga0070680_100194268
551 Ga0070680_100342437
552 Ga0070682_100181173
553 Ga0068868_100512825
554 Ga0070689_100219378
555 Ga0070687_100141134
556 Ga0070661_100221140
557 Ga0070692_10119752
558 Ga0070668_100017892
559 Ga0070668_100158039
560 Ga0070668_100180514
561 Ga0070668_100302718
562 Ga0070669_100116084
563 Ga0070669_100655651
564 Ga0070671_100002208
565 Ga0070673_100827213
566 Ga0070688_100385083
567 Ga0070688_100448886
568 Ga0070659_100127570
569 Ga0070659_100175766
570 Ga0070667_101030608
571 Ga0070703_10004110
572 Ga0070709_10030465
573 Ga0070709_10392469
574 Ga0070714_100000594
575 Ga0070714_100758166
576 Ga0070713_100086035
577 Ga0070713_100289398
578 Ga0070710_10001371
579 Ga0070710_10102478
580 Ga0070711_100094602
581 Ga0070711_100356882
582 Ga0070705_100000357
583 Ga0070700_100005088
584 Ga0070700_100037944
585 Ga0070700_100288936
586 Ga0070700_100556173
587 Ga0070694_100014756
588 Ga0070694_100057937
589 Ga0070708_100199638
590 Ga0070663_100062463
591 Ga0070663_100331468
592 Ga0070663_100442507
593 Ga0070663_100629805
594 Ga0070662_100735781
595 Ga0070681_10000987
596 Ga0070681_10122317
597 Ga0070681_10122984
598 Ga0070681_10361579
599 Ga0070681_10377360
600 Ga0068867_100515931
601 Ga0070707_100005033
602 Ga0070707_100581638
603 Ga0070698_100086033
604 Ga0070698_100245414
605 Ga0070698_100275427
606 Ga0070699_100000404
607 Ga0070679_100007927
608 Ga0070679_100044995
609 Ga0070679_100196465
610 Ga0070679_100395337
611 Ga0070697_100034188
612 Ga0068853_100196926
613 Ga0068853_100283497
614 Ga0070672_100782667
615 Ga0070686_100215124
616 Ga0070695_100001618
617 Ga0070695_100002123
618 Ga0070696_100000616
619 Ga0070693_100078581
620 Ga0070665_100038649
621 Ga0070665_100562705
622 Ga0070704_100001569
623 Ga0070704_101020478
624 Ga0068855_100879873
625 Ga0068855_100948319
626 Ga0068855_100976515
627 Ga0070664_100174750
628 Ga0068857_100036569
629 Ga0068854_100213701
630 Ga0068856_100017912
631 Ga0068856_100067657
632 Ga0068852_100022789
633 Ga0068859_100026259
634 Ga0068864_100142291
635 Ga0068861_100060103
636 Ga0068858_100236662
637 Ga0068858_100273015
638 Ga0068860_100004462
639 Ga0068860_100084103
640 Ga0068862_100000968
641 Ga0068862_100161569
642 Ga0068862_101437210
643 Ga0081455_10241291
644 Ga0081538_10099452
645 Ga0081540_1000048
646 Ga0081540_1096891
647 Ga0081539_10000797
648 Ga0081539_10058618
649 Ga0070717_10138260
650 Ga0075365_10014131
651 Ga0075368_10000535
652 Ga0075368_10064410
653 Ga0075363_100001467
654 Ga0075363_100124616
655 Ga0075364_10001704
656 Ga0070716_100188799
657 Ga0070712_100174714
658 Ga0070712_100314033
659 Ga0070712_100316725
660 Ga0075362_10040902
661 Ga0075362_10296802
662 Ga0075367_10298192
663 Ga0075367_10330235
664 Ga0075369_10000573
665 Ga0075369_10054510
666 Ga0075366_10154418
667 Ga0075370_10220605
668 Ga0075428_100042900
669 Ga0075428_100057539
670 Ga0075428_100117634
671 Ga0075428_100310772
672 Ga0075428_100370099
673 Ga0075428_100448624
674 Ga0075430_100031433
675 Ga0075430_100081954
676 Ga0075430_100085827
677 Ga0075430_100169419
678 Ga0075430_100395221
679 Ga0075431_100003335
680 Ga0075431_100018534
681 Ga0075431_100305777
682 Ga0075431_100381526
683 Ga0075433_10135075
684 Ga0075433_10326406
685 Ga0075434_100166728
686 Ga0075429_100015640
687 Ga0075429_100156987
688 Ga0075436_100047078
689 Ga0075436_100610402
690 Ga0097620_100026259
691 Ga0097620_100121498
692 Ga0097620_101108000
693 Ga0075435_100041420
694 Ga0075435_100116921
695 Ga0099795_10000232
696 Ga0105240_10083496
697 Ga0105240_10499533
698 Ga0111539_10004966
699 Ga0111539_10109642
700 Ga0111539_10121830
701 Ga0111539_10354708
702 Ga0111539_10887833
703 Ga0105245_10597406
704 Ga0105247_10213713
705 Ga0114129_10016557
706 Ga0114129_10058370
707 Ga0114129_10098797
708 Ga0114129_10373473
709 Ga0114129_10403221
710 Ga0114129_10766836
711 Ga0105243_10634437
712 Ga0105243_11461780
713 Ga0105242_10209299
714 Ga0105242_11107131
715 Ga0105248_11388537
716 Ga0105238_10080176
717 Ga0105249_10007531
718 Ga0105249_10453827
719 Ga0105249_10726346
720 Ga0105249_10904867
721 Ga0099796_10000095
722 Ga0105239_10216896
723 Ga0105239_10716879
724 Ga0105246_10011369
725 Ga0157373_10771541
726 Ga0157370_10003572
727 Ga0157370_10064837
728 Ga0157369_10011864
729 Ga0157369_10097872
730 Ga0157374_10364207
731 Ga0163162_10038616
732 Ga0163162_10901575
733 Ga0157372_10146835
734 Ga0157372_10561685
735 Ga0157372_10672826
736 Ga0157380_10005742
737 Ga0157380_10183825
738 Ga0157379_10298108
739 Ga0157376_10145199
740 Ga0206353_11841532
741 Ga0213873_10080486
742 Ga0213876_10039435
743 Ga0213876_10223150
744 Ga0209130_1000187
745 Ga0209675_1009939
746 Ga0209025_1006243
747 Ga0207653_10001945
748 Ga0207692_10061135
749 Ga0207692_10080229
750 Ga0207692_10257342
751 Ga0207688_10273304
752 Ga0207699_10039636
753 Ga0207705_10124717
754 Ga0207707_10044724
755 Ga0207707_10063143
756 Ga0207707_10104745
757 Ga0207707_10260671
758 Ga0207695_10222755
759 Ga0207693_10001882
760 Ga0207693_10077357
761 Ga0207693_10103246
762 Ga0207693_10187236
763 Ga0207693_10352116
764 Ga0207660_10018708
765 Ga0207660_10096409
766 Ga0207660_10133516
767 Ga0207660_10946285
768 Ga0207657_10076519
769 Ga0207649_10203171
770 Ga0207652_10042061
771 Ga0207652_10105867
772 Ga0207652_10121216
773 Ga0207652_10235337
774 Ga0207646_10015866
775 Ga0207646_10547239
776 Ga0207681_10086642
777 Ga0207681_10467679
778 Ga0207650_10335403
779 Ga0207659_10389985
780 Ga0207700_10152066
781 Ga0207700_10175176
782 Ga0207700_10373280
783 Ga0207664_10003459
784 Ga0207664_10247561
785 Ga0207664_10355769
786 Ga0207664_11078102
787 Ga0207644_10038914
788 Ga0207690_10128186
789 Ga0207690_10260060
790 Ga0207706_10277490
791 Ga0207706_10764089
792 Ga0207665_10046903
793 Ga0207665_10142572
794 Ga0207667_10135378
795 Ga0207667_10895915
796 Ga0207651_10276717
797 Ga0207651_10658454
798 Ga0207651_11177482
799 Ga0207712_10025763
800 Ga0207712_10229710
801 Ga0207668_10018035
802 Ga0207668_11044500
803 Ga0207677_10549741
804 Ga0207703_10091782
805 Ga0207703_10196317
806 Ga0207639_10154231
807 Ga0207678_10004100
808 Ga0207678_10267776
809 Ga0207708_10011661
810 Ga0207708_10058721
811 Ga0207708_10233082
812 Ga0207708_10651955
813 Ga0207702_10085799
814 Ga0207641_10595899
815 Ga0207676_10054279
816 Ga0207676_10077733
817 Ga0207674_10001752
818 Ga0207675_100006887
819 Ga0207675_100391988
820 Ga0209179_1002909
821 Ga0209813_10000431
822 Ga0209813_10003028
823 Ga0209813_10077942
824 Ga0207428_10001719
825 Ga0207428_10193584
826 Ga0268265_10081576
827 Ga0268264_10006466
828 Ga0268264_10008048
829 Ga0265337_1008904
830 Ga0265318_10052406
831 Ga0265338_10148684
832 Ga0265338_10522267
833 Ga0265330_10088655
834 Ga0265332_10041973
835 Ga0265332_10088951
836 Ga0265325_10113722
837 Ga0265340_10067097
838 Ga0265339_10014949
839 Ga0265331_10000586
840 Ga0265331_10015971
841 Ga0265314_10019890
842 Ga0265314_10021381
843 Ga0265342_10139451
844 Ga0307406_10110140
845 Ga0307406_10199690
846 Ga0307411_10557236
847 Ga0316053_103422
848 Ga0373926_0002650
849 Ga0373928_0030212
850 Ga0373928_0085123
851 Ga0373934_0051082
852 Ga0373944_0015202
853 Ga0373936_0332326
854 Ga0373939_0140770
855 Ga0373953_0050757
856 Ga0373943_0098512
857 Ga0373946_0244234
858 Ga0373955_0037328
859 Ga0373961_0018830
860 Ga0373961_0134555
861 Ga0373931_0000910
862 Ga0373931_0028774
863 Ga0373931_0204528
864 Ga0373927_0031881
865 Ga0373927_0200045
866 Ga0373933_0013344
867 Ga0373933_0074928
868 Ga0373947_0015551
869 Ga0373947_0448576
870 Ga0373937_0036569
871 Ga0373937_0089385
872 Ga0373937_0147152
873 Ga0373925_0046645
874 Ga0373925_0217367
875 Ga0395899_0051221
876 Ga0395899_0291421
877 Ga0395900_0049048
878 Ga0395900_0096496
879 Ga0395900_0130172
880 Ga0395900_0431661
881 Ga0395898_0055211
882 Ga0395898_0070694
883 Ga0395898_0108611
884 Ga0395905_0043438
885 Ga0436364_0139470
886 Ga0436364_0178373
887 Ga0436364_0356442
888 Ga0436364_0803723
889 Ga0395901_0006936
890 Ga0395901_0032028
891 Ga0395901_0043243
892 Ga0395901_0194205
893 Ga0400486_31203
894 Ga0436365_0387785
895 Ga0436365_0633453
896 Ga0436365_0698488
897 Ga0436365_1144500
898 Ga0436360_0039666
899 Ga0436360_0470140
900 Ga0436360_0691709
901 Ga0436360_1070389
902 Ga0436361_0088001
903 Ga0436361_0306123
904 Ga0436361_1096286
905 Ga0436361_1129523
906 Ga0436363_0396333
907 Ga0436363_0534202
908 Ga0436362_0182447
909 Ga0436362_0494352
910 Ga0436362_0511093
911 Ga0436362_0699119
912 Ga0436362_0881187
913 Ga0451802_2020354
914 Ga0439464_0022433
915 Ga0453684_0248376
916 Ga0466957_0001660
917 Ga0466957_0663574
918 Ga0466960_0193328
919 Ga0466958_0001407
920 Ga0495603_0209402
921 Ga0495658_0170502
922 Ga0496100_0026992
923 Ga0496102_0006383
924 Ga0496102_0075055
925 Ga0496102_0142791
926 Ga0496102_0622111
927 Ga0496103_0098286
928 Ga0496103_0662962
929 Ga0496104_0000360
930 Ga0496104_0018348
931 Ga0496105_0026031
932 Ga0496105_0071285
933 Ga0496106_0000538
934 Ga0496107_0129532
935 Ga0496108_0003186
936 Ga0496108_0076567
937 Ga0496108_0292426
938 Ga0496109_0007552
939 Ga0496109_0056358
940 Ga0496109_0131214
941 Ga0496110_0002031
942 Ga0496110_0095779
943 Ga0496111_0005290
944 Ga0496111_0390905
945 Ga0496112_0003551
946 Ga0496112_0098441
947 Ga0496112_0156834
948 Ga0496112_0407309
949 Ga0496115_0006961
950 Ga0496115_0040156
951 Ga0501034_0050825
952 Ga0501034_0357475
953 Ga0501036_0204374
954 Ga0501038_0190438
955 Ga0501039_0177168
956 Ga0501039_0200518
957 Ga0501039_0227862
958 Ga0501039_0526281
959 Ga0501040_0010952
960 Ga0501040_0026451
961 Ga0501041_0005902
962 Ga0501042_0006432
963 Ga0501042_0404249
964 Ga0501043_0194021
965 Ga0501043_0644025
966 Ga0501046_0075017
967 Ga0501046_0225790
968 Ga0501047_0006888
969 Ga0501047_0315671
970 Ga0501047_0613079
971 Ga0501067_0047253
972 Ga0501068_0103574
973 Ga0501070_0474870
974 Ga0501072_0047328
975 Ga0501072_0064287
976 Ga0501072_0075725
977 Ga0501072_0190041
978 Ga0501073_0271691
979 Ga0501074_0470032
980 Ga0501075_0007881
981 Ga0501075_0023919
982 Ga0501075_0056403
983 Ga0501076_0274584
984 Ga0501076_0291362
985 Ga0501076_0346574
986 Ga0501076_0473330
987 Ga0501077_0043570
988 Ga0501077_0117969
989 Ga0501077_0460396
990 Ga0501077_0579533
991 Ga0501079_0011025
992 Ga0501079_0025776
993 Ga0501079_0046600
994 Ga0501079_0066916
995 Ga0501080_0015254
996 Ga0501080_0620978
997 Ga0501080_0689934
998 Ga0501081_0046834
999 Ga0501081_0051534
1000 Ga0501081_0055574
1001 Ga0501081_0253967
1002 Ga0501083_0482640
1003 Ga0501083_0648440
1004 Ga0501044_0051473
1005 Ga0501045_0168877
1006 Ga0501045_0391453
1007 nmdc:mga03683_167124_c1
1008 nmdc:mga03n38_15716_c1
1009 nmdc:mga03n38_218526_c1
1010 nmdc:mga00v17_2831_c1
1011 nmdc:mga0yw44_63132_c1
1012 nmdc:mga0yw44_77565_c1
1013 nmdc:mga0yw44_86737_c1
1014 nmdc:mga0k408_226983_c1
1015 nmdc:mga0k408_323945_c1
1016 nmdc:mga06z11_11304_c1
1017 nmdc:mga06z11_135946_c1
1018 nmdc:mga06z11_34933_c1
1019 nmdc:mga06z11_4879_c1
1020 nmdc:mga06z11_61848_c1
1021 nmdc:mga06z11_96337_c1
1022 nmdc:mga04h51_165480_c1
1023 nmdc:mga04h51_2897_c1
1024 nmdc:mga04h51_4839_c1
1025 nmdc:mga04h51_88643_c1
1026 nmdc:mga07m45_63451_c2
1027 nmdc:mga05p37_113508_c1
1028 nmdc:mga05p37_477815_c1
1029 nmdc:mga05p37_55779_c1
1030 nmdc:mga09592_13722_c1
1031 nmdc:mga09592_158998_c1
1032 nmdc:mga09592_956663_c1
1033 nmdc:mga0qj67_157007_c1
1034 nmdc:mga0qj67_383376_c1
1035 nmdc:mga0qj67_43731_c1
1036 nmdc:mga06r32_12459_c1
1037 nmdc:mga06r32_1544_c1
1038 nmdc:mga06r32_206238_c1
1039 nmdc:mga06r32_288981_c1
1040 nmdc:mga06r32_4807_c1
1041 nmdc:mga06r32_59622_c1
1042 nmdc:mga06r32_77175_c1
1043 nmdc:mga08y16_12389_c1
1044 nmdc:mga08y16_128382_c1
1045 nmdc:mga08y16_4211_c1
1046 nmdc:mga0n895_624834_c1
1047 nmdc:mga0rr50_146182_c1
1048 nmdc:mga0rr50_515039_c1
1049 nmdc:mga0a205_380919_c1
1050 nmdc:mga0a205_429909_c1
1051 nmdc:mga0sz30_160568_c1
1052 nmdc:mga0sz30_205656_c1
1053 nmdc:mga0sz30_211253_c1
1054 nmdc:mga0sz30_30864_c1
1055 Ga0495601_0018425
1056 Ga0500643_001444
1057 Ga0500643_036979
1058 Ga0500641_0003989
1059 Ga0500641_0010203
1060 Ga0500652_002284
1061 Ga0500658_0114656
1062 Ga0500568_0005794
1063 Ga0500616_0262963
1064 Ga0500601_008584
1065 Ga0501084_0004623
1066 Ga0501084_0043742
1067 Ga0501084_0059802
1068 Ga0501084_0115743
1069 Ga0501084_0944644
1070 Ga0501082_0003609
1071 Ga0501082_0139706
1072 Ga0501082_0163508
1073 Ga0501082_0390128
1074 Ga0501082_0728887
1075 Ga0466962_0017410
1076 Ga0530510_0007046
1077 Ga0530510_0009563
1078 Ga0530510_0056980
1079 Ga0530510_0414220
1080 2644742576
1081 2841763981
1082 2844108564
1083 2851185224
1084 2851250416
1085 3000020743
1086 8057534094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01612

DNA_pol_A_exo1

3'-5' exonuclease

32

199

0.94

PF13482

RNase_H_2

RNase_H superfamily

50

195

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mpr-assembly1.cif.gz_A brucella melitensis nrnc 0.9727 2 204
7mpu-assembly1.cif.gz_A-2 brucella melitensis nrnc bound to pgg 0.9672 1 204
5zo3-assembly1.cif.gz_A apo form of the nuclease 0.9667 1 204
7mpr-assembly1.cif.gz_A brucella melitensis nrnc 0.9634 2 204
5zo3-assembly1.cif.gz_A apo form of the nuclease 0.9621 1 204
ID Description Score Start End Superfamily
af_Q8ILY1_1321_1641_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9034 18 190 3.30.420.10
af_A0A1D8PDF4_132_438_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.892 18 185 3.30.420.10
1yt3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8851 18 189 3.30.420.10
af_I6XF17_15_224_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8611 19 189 3.30.420.10
af_C6T412_17_205_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8586 19 164 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A382DFH7-F1-model_v4 3'-5' exonuclease domain-containing protein 0.9893 2 204 GO:0003676
GO:0006139
GO:0008408
AF-A0A7C7KJJ0-F1-model_v4 Ribonuclease D 0.9832 2 203 GO:0003676
GO:0006139
GO:0008408
AF-A0A382QKE5-F1-model_v4 3'-5' exonuclease domain-containing protein 0.9832 1 190 GO:0003676
GO:0006139
GO:0008408
AF-A0A211ZKZ5-F1-model_v4 Ribonuclease D 0.983 1 203 GO:0003676
GO:0006139
GO:0008408
AF-A0A081BBE9-F1-model_v4 3'-5' exonuclease 0.9826 1 203 GO:0003676
GO:0006139
GO:0008408

Map