F461507
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 542 | 311 | 518 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300035083|Ga0373926_0051281|Ga0373926_0051281_69_725 |
| Length | 218 |
| Sequence | MTQTLTAGGGPGAWALSSLVGCAMRQLHPHRWNRMTTITSLPLTEVLLITPKRHGDARGWFTETWSRRAMLEAGVDCDFVQDNQAFNARAGTVRGLHFQKAPHPQAKLLRVLRGVIFDVAVDVRPGSPTFGQWVGAELSAERGEQLFIPRGFAHGYSTLTDDCELAYKVDGLYAPQTEGGVIWNDPDLAIDWRIEGEPILSDKDQALPRLKDLEPLSF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 3 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 4 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 5 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 6 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 7 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 8 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 9 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 10 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 11 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 12 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 13 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 14 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 15 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 16 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 17 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 18 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 19 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 20 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 87 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 138 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 140 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 143 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 147 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 161 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 162 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 163 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 173 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 184 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 185 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 276 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 277 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 278 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 281 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 287 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 288 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 289 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 290 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 291 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 292 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 293 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 294 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 295 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 296 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 297 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 298 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 299 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 302 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 305 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 306 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 307 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 308 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 310 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 311 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.56 |
| Metatranscriptomes | 0.18 |
| Isolates | 4.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.7 |
| Nodule | 2.4 |
| Rhizoplane | 3.87 |
| Rhizosphere | 78.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10010452 | 3300003215 | Bacteria | 4195 |
| 2 | Ga0055537_1002437 | 3300003773 | Bacteria | 6251 |
| 3 | Ga0055524_1004355 | 3300003775 | Bacteria | 6548 |
| 4 | Ga0055528_1029862 | 3300003790 | Bacteria | 1461 |
| 5 | Ga0055530_10000035 | 3300003791 | Bacteria | 117598 |
| 6 | Ga0055530_10000788 | 3300003791 | Bacteria | 26395 |
| 7 | Ga0055531_10001105 | 3300003794 | Bacteria | 21012 |
| 8 | Ga0065165_1000688 | 3300005262 | Bacteria | 48324 |
| 9 | Ga0070683_101388295 | 3300005329 | Bacteria | 675 |
| 10 | Ga0070670_100000022 | 3300005331 | Bacteria | 199146 |
| 11 | Ga0070670_100386869 | 3300005331 | Bacteria | 1233 |
| 12 | Ga0070666_10017550 | 3300005335 | Bacteria | 4589 |
| 13 | Ga0068868_100884338 | 3300005338 | Bacteria | 811 |
| 14 | Ga0070660_100043678 | 3300005339 | Bacteria | 3426 |
| 15 | Ga0070689_100518674 | 3300005340 | Bacteria | 1023 |
| 16 | Ga0070687_100587535 | 3300005343 | Bacteria | 763 |
| 17 | Ga0070661_100467991 | 3300005344 | Bacteria | 1005 |
| 18 | Ga0070668_100000710 | 3300005347 | Bacteria | 22777 |
| 19 | Ga0070668_100008045 | 3300005347 | Bacteria | 7832 |
| 20 | Ga0070669_100166745 | 3300005353 | Bacteria | 1715 |
| 21 | Ga0070669_100312166 | 3300005353 | Bacteria | 1268 |
| 22 | Ga0070669_100318013 | 3300005353 | Bacteria | 1256 |
| 23 | Ga0070671_100103039 | 3300005355 | Bacteria | 2394 |
| 24 | Ga0070671_100344206 | 3300005355 | Bacteria | 1272 |
| 25 | Ga0070674_100447700 | 3300005356 | Bacteria | 1065 |
| 26 | Ga0070673_100126633 | 3300005364 | Bacteria | 2138 |
| 27 | Ga0070659_100002748 | 3300005366 | Bacteria | 12524 |
| 28 | Ga0070667_100005071 | 3300005367 | Bacteria | 11023 |
| 29 | Ga0070667_100014322 | 3300005367 | Bacteria | 6554 |
| 30 | Ga0070667_100014757 | 3300005367 | Bacteria | 6455 |
| 31 | Ga0070662_100633264 | 3300005457 | Bacteria | 901 |
| 32 | Ga0070681_10014375 | 3300005458 | Bacteria | 7877 |
| 33 | Ga0070707_101109756 | 3300005468 | Bacteria | 757 |
| 34 | Ga0068853_100472392 | 3300005539 | Bacteria | 1181 |
| 35 | Ga0070665_100001038 | 3300005548 | Bacteria | 34790 |
| 36 | Ga0070665_100047790 | 3300005548 | Bacteria | 4295 |
| 37 | Ga0070665_100348560 | 3300005548 | Bacteria | 1486 |
| 38 | Ga0070704_100043095 | 3300005549 | Bacteria | 3126 |
| 39 | Ga0068856_101875578 | 3300005614 | Bacteria | 611 |
| 40 | Ga0068859_100000681 | 3300005617 | Bacteria | 34110 |
| 41 | Ga0068859_100003103 | 3300005617 | Bacteria | 16870 |
| 42 | Ga0068859_100050876 | 3300005617 | Bacteria | 4163 |
| 43 | Ga0068859_100173053 | 3300005617 | Bacteria | 2241 |
| 44 | Ga0068864_100000125 | 3300005618 | Bacteria | 74686 |
| 45 | Ga0068864_100000418 | 3300005618 | Bacteria | 36672 |
| 46 | Ga0068864_100001709 | 3300005618 | Bacteria | 18031 |
| 47 | Ga0068864_100718175 | 3300005618 | Bacteria | 977 |
| 48 | Ga0068861_100014450 | 3300005719 | Bacteria | 5542 |
| 49 | Ga0068861_100251115 | 3300005719 | Bacteria | 1509 |
| 50 | Ga0068861_100563609 | 3300005719 | Bacteria | 1040 |
| 51 | Ga0068863_100000066 | 3300005841 | Bacteria | 117816 |
| 52 | Ga0068863_100000486 | 3300005841 | Bacteria | 40496 |
| 53 | Ga0068863_100024022 | 3300005841 | Bacteria | 5818 |
| 54 | Ga0068863_100112359 | 3300005841 | Bacteria | 2594 |
| 55 | Ga0068863_100178115 | 3300005841 | Bacteria | 2041 |
| 56 | Ga0068863_100456086 | 3300005841 | Bacteria | 1255 |
| 57 | Ga0068858_100000136 | 3300005842 | Bacteria | 77380 |
| 58 | Ga0068858_100003656 | 3300005842 | Bacteria | 15224 |
| 59 | Ga0068858_100095484 | 3300005842 | Bacteria | 2770 |
| 60 | Ga0068860_100000066 | 3300005843 | Bacteria | 182836 |
| 61 | Ga0068860_100000136 | 3300005843 | Bacteria | 120083 |
| 62 | Ga0068860_100011612 | 3300005843 | Bacteria | 8687 |
| 63 | Ga0068862_100001264 | 3300005844 | Bacteria | 23790 |
| 64 | Ga0068862_100022276 | 3300005844 | Bacteria | 5298 |
| 65 | Ga0068862_100041185 | 3300005844 | Bacteria | 3930 |
| 66 | Ga0068862_100063982 | 3300005844 | Bacteria | 3165 |
| 67 | Ga0075363_100564227 | 3300006048 | Bacteria | 680 |
| 68 | Ga0075366_10173624 | 3300006195 | Bacteria | 1308 |
| 69 | Ga0075370_10147269 | 3300006353 | Bacteria | 1379 |
| 70 | Ga0068871_100167640 | 3300006358 | Bacteria | 1881 |
| 71 | Ga0068865_100894772 | 3300006881 | Bacteria | 772 |
| 72 | Ga0097620_100000681 | 3300006931 | Bacteria | 34110 |
| 73 | Ga0097620_100003103 | 3300006931 | Bacteria | 16870 |
| 74 | Ga0097620_100050876 | 3300006931 | Bacteria | 4163 |
| 75 | Ga0097620_100173061 | 3300006931 | Bacteria | 2241 |
| 76 | Ga0105250_10194769 | 3300009092 | Bacteria | 854 |
| 77 | Ga0105240_10098535 | 3300009093 | Bacteria | 3559 |
| 78 | Ga0105240_10594003 | 3300009093 | Bacteria | 1220 |
| 79 | Ga0105240_10880117 | 3300009093 | Bacteria | 965 |
| 80 | Ga0111539_10016877 | 3300009094 | Bacteria | 9042 |
| 81 | Ga0111539_10987774 | 3300009094 | Bacteria | 979 |
| 82 | Ga0105245_10060427 | 3300009098 | Bacteria | 3413 |
| 83 | Ga0105245_10074157 | 3300009098 | Bacteria | 3096 |
| 84 | Ga0105247_10123383 | 3300009101 | Bacteria | 1681 |
| 85 | Ga0105247_10782554 | 3300009101 | Bacteria | 726 |
| 86 | Ga0105241_10780202 | 3300009174 | Bacteria | 879 |
| 87 | Ga0105248_10002170 | 3300009177 | Bacteria | 21730 |
| 88 | Ga0105248_10016699 | 3300009177 | Bacteria | 8080 |
| 89 | Ga0105248_10028114 | 3300009177 | Bacteria | 6263 |
| 90 | Ga0105248_10803756 | 3300009177 | Bacteria | 1061 |
| 91 | Ga0105237_10300579 | 3300009545 | Bacteria | 1608 |
| 92 | Ga0105238_10112245 | 3300009551 | Bacteria | 2705 |
| 93 | Ga0105238_10128582 | 3300009551 | Bacteria | 2512 |
| 94 | Ga0105238_10156461 | 3300009551 | Bacteria | 2254 |
| 95 | Ga0105238_10483434 | 3300009551 | Bacteria | 1238 |
| 96 | Ga0105238_10587282 | 3300009551 | Bacteria | 1121 |
| 97 | Ga0105249_10000376 | 3300009553 | Bacteria | 44283 |
| 98 | Ga0105249_10379628 | 3300009553 | Bacteria | 1439 |
| 99 | Ga0099796_10021119 | 3300010159 | Bacteria | 2001 |
| 100 | Ga0105239_10428647 | 3300010375 | Bacteria | 1499 |
| 101 | Ga0157374_10003601 | 3300013296 | Bacteria | 13042 |
| 102 | Ga0157374_10415412 | 3300013296 | Bacteria | 1343 |
| 103 | Ga0157378_10000834 | 3300013297 | Bacteria | 28613 |
| 104 | Ga0163162_10239247 | 3300013306 | Bacteria | 1946 |
| 105 | Ga0163162_11238720 | 3300013306 | Bacteria | 847 |
| 106 | Ga0157372_11050439 | 3300013307 | Bacteria | 943 |
| 107 | Ga0157375_10344891 | 3300013308 | Bacteria | 1655 |
| 108 | Ga0157375_11277334 | 3300013308 | Bacteria | 862 |
| 109 | Ga0163163_10007905 | 3300014325 | Bacteria | 9402 |
| 110 | Ga0163163_10065846 | 3300014325 | Bacteria | 3598 |
| 111 | Ga0163163_10127627 | 3300014325 | Bacteria | 2582 |
| 112 | Ga0182008_10475514 | 3300014497 | Bacteria | 683 |
| 113 | Ga0157379_10003769 | 3300014968 | Bacteria | 12906 |
| 114 | Ga0157379_10017570 | 3300014968 | Bacteria | 6296 |
| 115 | Ga0157379_11078149 | 3300014968 | Bacteria | 769 |
| 116 | Ga0157376_10485284 | 3300014969 | Bacteria | 1212 |
| 117 | Ga0163161_10472031 | 3300017792 | Unclassified | 1017 |
| 118 | Ga0206353_11902316 | 3300020082 | Bacteria | 679 |
| 119 | Ga0228598_1000575 | 3300024227 | Bacteria | 7703 |
| 120 | Ga0209026_1000567 | 3300025250 | Bacteria | 24901 |
| 121 | Ga0209148_1022340 | 3300025254 | Bacteria | 1018 |
| 122 | Ga0209565_1000090 | 3300025263 | Bacteria | 146540 |
| 123 | Ga0209673_1001000 | 3300025273 | Bacteria | 34384 |
| 124 | Ga0209675_1015077 | 3300025291 | Bacteria | 2315 |
| 125 | Ga0209676_1000454 | 3300025292 | Bacteria | 69136 |
| 126 | Ga0209564_1017317 | 3300025295 | Bacteria | 2816 |
| 127 | Ga0209758_1000999 | 3300025297 | Bacteria | 37624 |
| 128 | Ga0209758_1003056 | 3300025297 | Bacteria | 15909 |
| 129 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 130 | Ga0209050_1000867 | 3300025298 | Bacteria | 40877 |
| 131 | Ga0209256_1002391 | 3300025299 | Bacteria | 15466 |
| 132 | Ga0209256_1007405 | 3300025299 | Bacteria | 5420 |
| 133 | Ga0209257_1000227 | 3300025304 | Bacteria | 133512 |
| 134 | Ga0209257_1001860 | 3300025304 | Bacteria | 22903 |
| 135 | Ga0209257_1047283 | 3300025304 | Bacteria | 1238 |
| 136 | Ga0207697_10209006 | 3300025315 | Bacteria | 860 |
| 137 | Ga0207680_10016182 | 3300025903 | Bacteria | 3909 |
| 138 | Ga0207680_10106582 | 3300025903 | Bacteria | 1810 |
| 139 | Ga0207705_10087935 | 3300025909 | Bacteria | 2272 |
| 140 | Ga0207654_10185158 | 3300025911 | Bacteria | 1361 |
| 141 | Ga0207707_10179768 | 3300025912 | Bacteria | 1847 |
| 142 | Ga0207695_10003289 | 3300025913 | Bacteria | 22966 |
| 143 | Ga0207695_10034543 | 3300025913 | Bacteria | 5497 |
| 144 | Ga0207695_10182597 | 3300025913 | Bacteria | 2018 |
| 145 | Ga0207671_10445990 | 3300025914 | Bacteria | 1030 |
| 146 | Ga0207671_10732328 | 3300025914 | Bacteria | 786 |
| 147 | Ga0207660_10479198 | 3300025917 | Bacteria | 1008 |
| 148 | Ga0207660_10910018 | 3300025917 | Bacteria | 718 |
| 149 | Ga0207657_10016726 | 3300025919 | Bacteria | 7063 |
| 150 | Ga0207649_10424640 | 3300025920 | Bacteria | 999 |
| 151 | Ga0207681_10009307 | 3300025923 | Bacteria | 6000 |
| 152 | Ga0207681_10247103 | 3300025923 | Bacteria | 1391 |
| 153 | Ga0207694_10147416 | 3300025924 | Bacteria | 1895 |
| 154 | Ga0207694_10151763 | 3300025924 | Bacteria | 1867 |
| 155 | Ga0207694_10152522 | 3300025924 | Bacteria | 1862 |
| 156 | Ga0207694_10335147 | 3300025924 | Bacteria | 1250 |
| 157 | Ga0207650_10000016 | 3300025925 | Bacteria | 361958 |
| 158 | Ga0207650_10032724 | 3300025925 | Bacteria | 3762 |
| 159 | Ga0207650_10100576 | 3300025925 | Bacteria | 2225 |
| 160 | Ga0207690_10000496 | 3300025932 | Bacteria | 25421 |
| 161 | Ga0207706_10075205 | 3300025933 | Bacteria | 2970 |
| 162 | Ga0207665_10300291 | 3300025939 | Bacteria | 1200 |
| 163 | Ga0207711_10009460 | 3300025941 | Bacteria | 8130 |
| 164 | Ga0207711_10016203 | 3300025941 | Bacteria | 6188 |
| 165 | Ga0207711_10042892 | 3300025941 | Bacteria | 3856 |
| 166 | Ga0207711_10541998 | 3300025941 | Bacteria | 1085 |
| 167 | Ga0207711_10636461 | 3300025941 | Bacteria | 995 |
| 168 | Ga0207689_10111738 | 3300025942 | Bacteria | 2246 |
| 169 | Ga0207689_10572412 | 3300025942 | Bacteria | 949 |
| 170 | Ga0207651_10199458 | 3300025960 | Bacteria | 1602 |
| 171 | Ga0207712_10000794 | 3300025961 | Bacteria | 23385 |
| 172 | Ga0207668_10000117 | 3300025972 | Bacteria | 55600 |
| 173 | Ga0207668_10051933 | 3300025972 | Bacteria | 2834 |
| 174 | Ga0207668_10130149 | 3300025972 | Bacteria | 1920 |
| 175 | Ga0207668_10142410 | 3300025972 | Bacteria | 1845 |
| 176 | Ga0207640_10349578 | 3300025981 | Bacteria | 1187 |
| 177 | Ga0207658_10002457 | 3300025986 | Bacteria | 13540 |
| 178 | Ga0207658_10015009 | 3300025986 | Bacteria | 5311 |
| 179 | Ga0207658_10416795 | 3300025986 | Bacteria | 1183 |
| 180 | Ga0207658_10484179 | 3300025986 | Bacteria | 1100 |
| 181 | Ga0207703_10000065 | 3300026035 | Bacteria | 126087 |
| 182 | Ga0207703_10001304 | 3300026035 | Bacteria | 23078 |
| 183 | Ga0207703_10127104 | 3300026035 | Bacteria | 2196 |
| 184 | Ga0207703_10228732 | 3300026035 | Bacteria | 1666 |
| 185 | Ga0207703_10265198 | 3300026035 | Bacteria | 1554 |
| 186 | Ga0207639_10383163 | 3300026041 | Bacteria | 1263 |
| 187 | Ga0207678_10288256 | 3300026067 | Bacteria | 1410 |
| 188 | Ga0207678_11199536 | 3300026067 | Bacteria | 672 |
| 189 | Ga0207641_10000011 | 3300026088 | Bacteria | 384362 |
| 190 | Ga0207641_10001896 | 3300026088 | Bacteria | 20073 |
| 191 | Ga0207641_10009570 | 3300026088 | Bacteria | 7984 |
| 192 | Ga0207641_10017742 | 3300026088 | Bacteria | 5831 |
| 193 | Ga0207676_10000055 | 3300026095 | Bacteria | 124678 |
| 194 | Ga0207676_10000450 | 3300026095 | Bacteria | 34793 |
| 195 | Ga0207676_10003841 | 3300026095 | Bacteria | 10609 |
| 196 | Ga0207676_10038403 | 3300026095 | Bacteria | 3654 |
| 197 | Ga0207675_100022523 | 3300026118 | Bacteria | 5866 |
| 198 | Ga0207675_100380753 | 3300026118 | Bacteria | 1387 |
| 199 | Ga0209981_1000621 | 3300027378 | Bacteria | 4475 |
| 200 | Ga0209999_1012440 | 3300027543 | Bacteria | 1542 |
| 201 | Ga0207428_10320033 | 3300027907 | Unclassified | 1146 |
| 202 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 203 | Ga0268266_10004304 | 3300028379 | Bacteria | 13704 |
| 204 | Ga0268266_10137438 | 3300028379 | Bacteria | 2190 |
| 205 | Ga0268266_10177101 | 3300028379 | Bacteria | 1939 |
| 206 | Ga0268265_10001013 | 3300028380 | Bacteria | 25387 |
| 207 | Ga0268265_10006946 | 3300028380 | Bacteria | 7658 |
| 208 | Ga0268265_10052527 | 3300028380 | Bacteria | 3083 |
| 209 | Ga0268265_10118524 | 3300028380 | Bacteria | 2176 |
| 210 | Ga0268264_10000265 | 3300028381 | Bacteria | 92655 |
| 211 | Ga0268264_10261873 | 3300028381 | Bacteria | 1611 |
| 212 | Ga0268264_10889463 | 3300028381 | Bacteria | 893 |
| 213 | Ga0265326_10008000 | 3300028558 | Bacteria | 3211 |
| 214 | Ga0265319_1000301 | 3300028563 | Bacteria | 36705 |
| 215 | Ga0265334_10090731 | 3300028573 | Bacteria | 1115 |
| 216 | Ga0265318_10000122 | 3300028577 | Bacteria | 71971 |
| 217 | Ga0265323_10008039 | 3300028653 | Bacteria | 4362 |
| 218 | Ga0265323_10008563 | 3300028653 | Bacteria | 4215 |
| 219 | Ga0265322_10090787 | 3300028654 | Bacteria | 868 |
| 220 | Ga0307517_10006346 | 3300028786 | Bacteria | 17546 |
| 221 | Ga0307515_10028618 | 3300028794 | Bacteria | 9465 |
| 222 | Ga0307515_10242372 | 3300028794 | Bacteria | 1571 |
| 223 | Ga0265338_10028732 | 3300028800 | Bacteria | 5537 |
| 224 | Ga0265338_10061652 | 3300028800 | Bacteria | 3286 |
| 225 | Ga0265338_10259079 | 3300028800 | Bacteria | 1279 |
| 226 | Ga0265338_10269853 | 3300028800 | Bacteria | 1247 |
| 227 | Ga0265338_10489968 | 3300028800 | Bacteria | 866 |
| 228 | Ga0265338_10662690 | 3300028800 | Bacteria | 722 |
| 229 | Ga0307511_10037163 | 3300030521 | Bacteria | 4213 |
| 230 | Ga0265330_10033806 | 3300031235 | Bacteria | 2285 |
| 231 | Ga0265332_10260304 | 3300031238 | Bacteria | 717 |
| 232 | Ga0265320_10012449 | 3300031240 | Bacteria | 4947 |
| 233 | Ga0265325_10046974 | 3300031241 | Bacteria | 2237 |
| 234 | Ga0265329_10000720 | 3300031242 | Bacteria | 16786 |
| 235 | Ga0265340_10033752 | 3300031247 | Bacteria | 2546 |
| 236 | Ga0265331_10000028 | 3300031250 | Bacteria | 216539 |
| 237 | Ga0265327_10044047 | 3300031251 | Bacteria | 2382 |
| 238 | Ga0265316_10005586 | 3300031344 | Bacteria | 12190 |
| 239 | Ga0265316_10021205 | 3300031344 | Bacteria | 5511 |
| 240 | Ga0265316_10027007 | 3300031344 | Bacteria | 4764 |
| 241 | Ga0265316_10051414 | 3300031344 | Bacteria | 3237 |
| 242 | Ga0307513_10000100 | 3300031456 | Bacteria | 125183 |
| 243 | Ga0307513_10009312 | 3300031456 | Bacteria | 12435 |
| 244 | Ga0307513_10010426 | 3300031456 | Bacteria | 11648 |
| 245 | Ga0307408_100092015 | 3300031548 | Bacteria | 2292 |
| 246 | Ga0316575_10000800 | 3300031665 | Bacteria | 9520 |
| 247 | Ga0316575_10049241 | 3300031665 | Bacteria | 1676 |
| 248 | Ga0265314_10008476 | 3300031711 | Bacteria | 8799 |
| 249 | Ga0265314_10032544 | 3300031711 | Bacteria | 3835 |
| 250 | Ga0265314_10114437 | 3300031711 | Bacteria | 1709 |
| 251 | Ga0265314_10248103 | 3300031711 | Bacteria | 1023 |
| 252 | Ga0265342_10000161 | 3300031712 | Bacteria | 75750 |
| 253 | Ga0265342_10059007 | 3300031712 | Bacteria | 2267 |
| 254 | Ga0265342_10237177 | 3300031712 | Bacteria | 977 |
| 255 | Ga0307516_10000113 | 3300031730 | Bacteria | 93946 |
| 256 | Ga0307414_10143181 | 3300032004 | Bacteria | 1875 |
| 257 | Ga0307411_10179676 | 3300032005 | Bacteria | 1605 |
| 258 | Ga0316583_10004608 | 3300032133 | Bacteria | 4917 |
| 259 | Ga0316583_10073615 | 3300032133 | Bacteria | 1195 |
| 260 | Ga0307510_10003321 | 3300033180 | Bacteria | 18743 |
| 261 | Ga0373926_0004859 | 3300035083 | Bacteria | 4418 |
| 262 | Ga0373926_0051281 | 3300035083 | Bacteria | 1488 |
| 263 | Ga0373944_0005748 | 3300035089 | Bacteria | 3275 |
| 264 | Ga0373923_0002249 | 3300035111 | Bacteria | 5878 |
| 265 | Ga0373936_0103086 | 3300035113 | Bacteria | 1205 |
| 266 | Ga0373936_0274987 | 3300035113 | Bacteria | 756 |
| 267 | Ga0373954_0072347 | 3300035118 | Bacteria | 1640 |
| 268 | Ga0373943_0443248 | 3300035170 | Bacteria | 754 |
| 269 | Ga0373946_0015865 | 3300035171 | Bacteria | 2863 |
| 270 | Ga0373946_0026778 | 3300035171 | Bacteria | 2277 |
| 271 | Ga0373955_0091267 | 3300035172 | Bacteria | 1736 |
| 272 | Ga0316574_0095520 | 3300035398 | Unclassified | 1899 |
| 273 | Ga0316574_0109912 | 3300035398 | Unclassified | 1767 |
| 274 | Ga0373935_0161776 | 3300035692 | Bacteria | 1526 |
| 275 | Ga0373927_0000173 | 3300035695 | Bacteria | 50996 |
| 276 | Ga0373927_0003596 | 3300035695 | Bacteria | 11052 |
| 277 | Ga0373933_0381710 | 3300035724 | Bacteria | 918 |
| 278 | Ga0373947_0021564 | 3300035725 | Bacteria | 3729 |
| 279 | Ga0373947_0061490 | 3300035725 | Bacteria | 2283 |
| 280 | Ga0373937_0031018 | 3300036401 | Bacteria | 4840 |
| 281 | Ga0373925_0000049 | 3300037068 | Bacteria | 128065 |
| 282 | Ga0373925_0117844 | 3300037068 | Bacteria | 2058 |
| 283 | Ga0395899_0000115 | 3300037312 | Bacteria | 133287 |
| 284 | Ga0395899_0057825 | 3300037312 | Bacteria | 2861 |
| 285 | Ga0395899_0177013 | 3300037312 | Bacteria | 1499 |
| 286 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 287 | Ga0395900_0230583 | 3300037418 | Bacteria | 1862 |
| 288 | Ga0395900_0372942 | 3300037418 | Bacteria | 1396 |
| 289 | Ga0395898_0008120 | 3300037466 | Bacteria | 11111 |
| 290 | Ga0395898_0809466 | 3300037466 | Bacteria | 877 |
| 291 | Ga0395905_0021615 | 3300037471 | Bacteria | 6085 |
| 292 | Ga0395905_0265671 | 3300037471 | Bacteria | 1601 |
| 293 | Ga0395905_0550337 | 3300037471 | Bacteria | 1055 |
| 294 | Ga0395905_0570213 | 3300037471 | Bacteria | 1033 |
| 295 | Ga0395905_0598089 | 3300037471 | Bacteria | 1005 |
| 296 | Ga0395901_0000021 | 3300038443 | Bacteria | 307734 |
| 297 | Ga0395901_0340827 | 3300038443 | Bacteria | 1549 |
| 298 | Ga0395901_0456930 | 3300038443 | Bacteria | 1305 |
| 299 | Ga0436365_0820477 | 3300039437 | Bacteria | 2654 |
| 300 | Ga0436361_0340319 | 3300039447 | Bacteria | 976 |
| 301 | Ga0439445_0115495 | 3300042004 | Bacteria | 768 |
| 302 | Ga0453684_0007109 | 3300044712 | Bacteria | 20863 |
| 303 | Ga0495592_0008377 | 3300046454 | Bacteria | 7755 |
| 304 | Ga0495592_0135940 | 3300046454 | Bacteria | 1715 |
| 305 | Ga0495629_0153650 | 3300046459 | Bacteria | 1599 |
| 306 | Ga0495638_0000293 | 3300046460 | Bacteria | 65718 |
| 307 | Ga0495638_0000996 | 3300046460 | Bacteria | 28464 |
| 308 | Ga0495638_0001207 | 3300046460 | Bacteria | 24665 |
| 309 | Ga0495651_0000564 | 3300046462 | Bacteria | 28657 |
| 310 | Ga0495651_0001572 | 3300046462 | Bacteria | 17661 |
| 311 | Ga0495651_0013435 | 3300046462 | Bacteria | 6332 |
| 312 | Ga0495653_0036579 | 3300046463 | Bacteria | 3865 |
| 313 | Ga0495653_0157783 | 3300046463 | Bacteria | 1578 |
| 314 | Ga0495650_0060642 | 3300046471 | Bacteria | 1518 |
| 315 | Ga0495650_0097678 | 3300046471 | Bacteria | 1107 |
| 316 | Ga0495580_0065697 | 3300046472 | Bacteria | 2540 |
| 317 | Ga0495639_0170119 | 3300046475 | Bacteria | 1057 |
| 318 | Ga0495664_0027415 | 3300046477 | Bacteria | 3321 |
| 319 | Ga0495664_0027998 | 3300046477 | Bacteria | 3289 |
| 320 | Ga0495664_0072559 | 3300046477 | Bacteria | 2057 |
| 321 | Ga0495664_0197485 | 3300046477 | Bacteria | 1219 |
| 322 | Ga0495584_0370082 | 3300046491 | Bacteria | 728 |
| 323 | Ga0495585_0217728 | 3300046492 | Bacteria | 965 |
| 324 | Ga0495594_0110543 | 3300046499 | Bacteria | 1550 |
| 325 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 326 | Ga0495606_0013252 | 3300046507 | Bacteria | 6537 |
| 327 | Ga0495606_0056313 | 3300046507 | Bacteria | 2539 |
| 328 | Ga0495606_0252638 | 3300046507 | Bacteria | 977 |
| 329 | Ga0495608_0167544 | 3300046511 | Bacteria | 1394 |
| 330 | Ga0495610_0000179 | 3300046512 | Bacteria | 70587 |
| 331 | Ga0495610_0008936 | 3300046512 | Bacteria | 6412 |
| 332 | Ga0495616_0031655 | 3300046513 | Bacteria | 2768 |
| 333 | Ga0495618_0172506 | 3300046514 | Bacteria | 1376 |
| 334 | Ga0495618_0323363 | 3300046514 | Bacteria | 955 |
| 335 | Ga0495620_0076779 | 3300046515 | Bacteria | 1357 |
| 336 | Ga0495628_0000524 | 3300046516 | Bacteria | 35187 |
| 337 | Ga0495628_0019538 | 3300046516 | Bacteria | 5599 |
| 338 | Ga0495628_0038837 | 3300046516 | Bacteria | 3808 |
| 339 | Ga0495630_0045302 | 3300046517 | Bacteria | 3286 |
| 340 | Ga0495630_0127253 | 3300046517 | Bacteria | 1934 |
| 341 | Ga0495630_0247434 | 3300046517 | Bacteria | 1362 |
| 342 | Ga0495637_0002909 | 3300046520 | Bacteria | 9256 |
| 343 | Ga0495643_0160463 | 3300046522 | Bacteria | 1106 |
| 344 | Ga0495648_0114818 | 3300046524 | Bacteria | 1458 |
| 345 | Ga0495666_0011645 | 3300046526 | Bacteria | 4385 |
| 346 | Ga0495642_0010307 | 3300046528 | Bacteria | 3579 |
| 347 | Ga0495642_0077509 | 3300046528 | Bacteria | 1396 |
| 348 | Ga0495652_0002166 | 3300046529 | Bacteria | 20646 |
| 349 | Ga0495652_0004359 | 3300046529 | Bacteria | 13542 |
| 350 | Ga0495665_0000718 | 3300046531 | Bacteria | 17120 |
| 351 | Ga0495665_0125218 | 3300046531 | Bacteria | 1346 |
| 352 | Ga0495665_0158977 | 3300046531 | Bacteria | 1178 |
| 353 | Ga0495640_0028261 | 3300046533 | Unclassified | 4039 |
| 354 | Ga0495640_0120869 | 3300046533 | Bacteria | 1703 |
| 355 | Ga0495586_0001155 | 3300046535 | Bacteria | 14771 |
| 356 | Ga0495587_0000766 | 3300046536 | Bacteria | 21421 |
| 357 | Ga0495587_0106551 | 3300046536 | Bacteria | 1612 |
| 358 | Ga0495609_0027662 | 3300046538 | Bacteria | 2590 |
| 359 | Ga0495621_0029202 | 3300046539 | Bacteria | 1879 |
| 360 | Ga0495597_0006922 | 3300046542 | Bacteria | 5816 |
| 361 | Ga0495597_0050110 | 3300046542 | Bacteria | 1844 |
| 362 | Ga0495645_0012695 | 3300046543 | Bacteria | 5942 |
| 363 | Ga0495645_0089849 | 3300046543 | Bacteria | 2196 |
| 364 | Ga0495622_0006369 | 3300046557 | Bacteria | 5479 |
| 365 | Ga0495667_0000245 | 3300046559 | Bacteria | 35362 |
| 366 | Ga0495667_0005502 | 3300046559 | Bacteria | 8558 |
| 367 | Ga0495667_0024974 | 3300046559 | Bacteria | 4026 |
| 368 | Ga0495668_0024376 | 3300046616 | Bacteria | 3442 |
| 369 | Ga0495668_0063554 | 3300046616 | Bacteria | 2033 |
| 370 | Ga0495668_0127685 | 3300046616 | Bacteria | 1392 |
| 371 | Ga0495668_0137242 | 3300046616 | Bacteria | 1339 |
| 372 | Ga0495668_0618786 | 3300046616 | Bacteria | 598 |
| 373 | Ga0495634_0163469 | 3300046642 | Unclassified | 1402 |
| 374 | Ga0495634_0381504 | 3300046642 | Bacteria | 840 |
| 375 | Ga0495611_0001327 | 3300046648 | Bacteria | 12555 |
| 376 | Ga0495611_0105737 | 3300046648 | Bacteria | 1309 |
| 377 | Ga0495625_0000034 | 3300046660 | Bacteria | 225120 |
| 378 | Ga0495625_0000795 | 3300046660 | Bacteria | 43736 |
| 379 | Ga0495625_0012684 | 3300046660 | Bacteria | 6815 |
| 380 | Ga0495625_0146514 | 3300046660 | Bacteria | 1589 |
| 381 | Ga0495625_0154648 | 3300046660 | Bacteria | 1540 |
| 382 | Ga0495625_0205110 | 3300046660 | Bacteria | 1299 |
| 383 | Ga0495625_0625649 | 3300046660 | Bacteria | 643 |
| 384 | Ga0495635_0004923 | 3300046663 | Bacteria | 9296 |
| 385 | Ga0495657_0018971 | 3300046675 | Bacteria | 4968 |
| 386 | Ga0495657_0040776 | 3300046675 | Bacteria | 3182 |
| 387 | Ga0495657_0180765 | 3300046675 | Bacteria | 1295 |
| 388 | Ga0495599_0023104 | 3300046678 | Bacteria | 3886 |
| 389 | Ga0495599_0078449 | 3300046678 | Bacteria | 2062 |
| 390 | Ga0495623_0003980 | 3300046679 | Bacteria | 9725 |
| 391 | Ga0495623_0033400 | 3300046679 | Unclassified | 3302 |
| 392 | Ga0495646_0003817 | 3300046680 | Bacteria | 9420 |
| 393 | Ga0495646_0112935 | 3300046680 | Bacteria | 1545 |
| 394 | Ga0495669_0006159 | 3300046684 | Bacteria | 5004 |
| 395 | Ga0495669_0071002 | 3300046684 | Bacteria | 1587 |
| 396 | Ga0495613_0125995 | 3300046689 | Bacteria | 1837 |
| 397 | Ga0495613_0313372 | 3300046689 | Bacteria | 1084 |
| 398 | Ga0495624_0004988 | 3300046690 | Bacteria | 9616 |
| 399 | Ga0495624_0296258 | 3300046690 | Bacteria | 976 |
| 400 | Ga0495624_0314881 | 3300046690 | Bacteria | 943 |
| 401 | Ga0495649_0304497 | 3300046694 | Bacteria | 811 |
| 402 | Ga0495589_0007108 | 3300046794 | Bacteria | 5867 |
| 403 | Ga0495600_0022165 | 3300046809 | Bacteria | 4076 |
| 404 | Ga0495600_0061032 | 3300046809 | Bacteria | 2462 |
| 405 | Ga0495581_0504765 | 3300047315 | Bacteria | 703 |
| 406 | Ga0495581_0522648 | 3300047315 | Bacteria | 689 |
| 407 | Ga0495604_0009221 | 3300047317 | Bacteria | 7812 |
| 408 | Ga0495674_0005320 | 3300047319 | Bacteria | 12347 |
| 409 | Ga0495674_0027438 | 3300047319 | Bacteria | 5204 |
| 410 | Ga0495674_0484661 | 3300047319 | Bacteria | 991 |
| 411 | Ga0495676_0026132 | 3300047321 | Bacteria | 5030 |
| 412 | Ga0495680_0000371 | 3300047322 | Bacteria | 50251 |
| 413 | Ga0495680_0111886 | 3300047322 | Bacteria | 2023 |
| 414 | Ga0495687_018449 | 3300047443 | Bacteria | 3449 |
| 415 | Ga0495675_0000236 | 3300047444 | Bacteria | 39933 |
| 416 | Ga0495675_0199468 | 3300047444 | Bacteria | 1218 |
| 417 | Ga0495675_0322541 | 3300047444 | Bacteria | 913 |
| 418 | Ga0495677_0023234 | 3300047445 | Bacteria | 2251 |
| 419 | Ga0495673_0000053 | 3300047469 | Bacteria | 254433 |
| 420 | Ga0495673_0011591 | 3300047469 | Bacteria | 4731 |
| 421 | Ga0495681_0043875 | 3300047470 | Bacteria | 2153 |
| 422 | Ga0495681_0084032 | 3300047470 | Bacteria | 1416 |
| 423 | Ga0495684_0014989 | 3300047471 | Bacteria | 5970 |
| 424 | Ga0495684_0024884 | 3300047471 | Bacteria | 4604 |
| 425 | Ga0495684_0341397 | 3300047471 | Unclassified | 1066 |
| 426 | Ga0495686_0000779 | 3300047472 | Bacteria | 41840 |
| 427 | Ga0495686_0008203 | 3300047472 | Bacteria | 7707 |
| 428 | Ga0495686_0018102 | 3300047472 | Bacteria | 4733 |
| 429 | Ga0495686_0035394 | 3300047472 | Bacteria | 3210 |
| 430 | Ga0495686_0056673 | 3300047472 | Bacteria | 2448 |
| 431 | Ga0495686_0205512 | 3300047472 | Bacteria | 1128 |
| 432 | Ga0495593_0010500 | 3300047673 | Bacteria | 5344 |
| 433 | Ga0495593_0067701 | 3300047673 | Bacteria | 1859 |
| 434 | Ga0495602_0020653 | 3300048088 | Bacteria | 6504 |
| 435 | Ga0495602_0057608 | 3300048088 | Bacteria | 3407 |
| 436 | Ga0495602_0137989 | 3300048088 | Bacteria | 1934 |
| 437 | Ga0495602_0488115 | 3300048088 | Bacteria | 863 |
| 438 | Ga0495614_0003221 | 3300048089 | Bacteria | 7293 |
| 439 | Ga0496100_0266932 | 3300048903 | Bacteria | 1271 |
| 440 | Ga0496101_0055659 | 3300048904 | Bacteria | 2858 |
| 441 | Ga0496101_0167922 | 3300048904 | Bacteria | 1685 |
| 442 | Ga0496101_0213658 | 3300048904 | Bacteria | 1495 |
| 443 | Ga0496102_0050829 | 3300048905 | Bacteria | 3775 |
| 444 | Ga0496103_0023950 | 3300048906 | Bacteria | 3683 |
| 445 | Ga0496104_0178039 | 3300048907 | Bacteria | 2036 |
| 446 | Ga0496106_0012556 | 3300048909 | Bacteria | 6254 |
| 447 | Ga0496106_0104384 | 3300048909 | Bacteria | 2201 |
| 448 | Ga0496106_0282527 | 3300048909 | Bacteria | 1330 |
| 449 | Ga0496106_0421215 | 3300048909 | Bacteria | 1073 |
| 450 | Ga0496107_0000034 | 3300048910 | Bacteria | 91621 |
| 451 | Ga0496108_0057239 | 3300048911 | Bacteria | 3276 |
| 452 | Ga0496109_0113056 | 3300048912 | Bacteria | 2525 |
| 453 | Ga0496112_0019671 | 3300048915 | Bacteria | 6379 |
| 454 | Ga0496112_0310109 | 3300048915 | Bacteria | 1523 |
| 455 | Ga0496113_0294046 | 3300048916 | Bacteria | 1300 |
| 456 | Ga0496115_0001261 | 3300048918 | Bacteria | 18161 |
| 457 | Ga0496115_0009461 | 3300048918 | Bacteria | 7239 |
| 458 | Ga0496115_0259596 | 3300048918 | Bacteria | 1429 |
| 459 | Ga0496115_0682936 | 3300048918 | Bacteria | 809 |
| 460 | Ga0496121_0004814 | 3300048924 | Bacteria | 17781 |
| 461 | Ga0496121_0160442 | 3300048924 | Bacteria | 1645 |
| 462 | Ga0496125_0112129 | 3300048928 | Bacteria | 1971 |
| 463 | Ga0501033_0017057 | 3300049570 | Bacteria | 5489 |
| 464 | Ga0501040_0326033 | 3300049576 | Bacteria | 1099 |
| 465 | Ga0501046_0138063 | 3300049580 | Bacteria | 1846 |
| 466 | Ga0501046_0433573 | 3300049580 | Bacteria | 946 |
| 467 | Ga0501047_0002950 | 3300049581 | Bacteria | 16124 |
| 468 | Ga0501047_0030290 | 3300049581 | Bacteria | 5218 |
| 469 | Ga0501047_0554708 | 3300049581 | Bacteria | 973 |
| 470 | Ga0501048_0297585 | 3300049582 | Bacteria | 1148 |
| 471 | Ga0501071_0310538 | 3300049587 | Bacteria | 1196 |
| 472 | Ga0501072_0186359 | 3300049588 | Bacteria | 1655 |
| 473 | Ga0501075_0136212 | 3300049591 | Bacteria | 1871 |
| 474 | Ga0501238_000290 | 3300049671 | Bacteria | 6622 |
| 475 | Ga0501238_000461 | 3300049671 | Bacteria | 4709 |
| 476 | Ga0501257_004222 | 3300049686 | Bacteria | 3126 |
| 477 | Ga0501266_043111 | 3300049763 | Bacteria | 677 |
| 478 | Ga0501035_0232942 | 3300049822 | Bacteria | 1569 |
| 479 | Ga0501044_0056897 | 3300049823 | Bacteria | 4014 |
| 480 | Ga0501044_0519379 | 3300049823 | Bacteria | 1091 |
| 481 | nmdc:mga0k408_201209_c1 | 3300050493 | Bacteria | 1189 |
| 482 | nmdc:mga07m45_156255_c1 | 3300050496 | Bacteria | 1323 |
| 483 | nmdc:mga07m45_71084_c1 | 3300050496 | Bacteria | 1980 |
| 484 | nmdc:mga08y16_903916_c1 | 3300050511 | Bacteria | 869 |
| 485 | nmdc:mga08y16_9776_c1 | 3300050511 | Bacteria | 10071 |
| 486 | Ga0495601_0126346 | 3300053077 | Bacteria | 1663 |
| 487 | Ga0495612_0002058 | 3300053078 | Bacteria | 8277 |
| 488 | Ga0495619_0072552 | 3300053085 | Bacteria | 2306 |
| 489 | Ga0500647_0072952 | 3300053091 | Bacteria | 1648 |
| 490 | Ga0500651_0143238 | 3300053093 | Bacteria | 1439 |
| 491 | Ga0500641_0005703 | 3300053096 | Bacteria | 4411 |
| 492 | Ga0500554_002506 | 3300053102 | Bacteria | 3623 |
| 493 | Ga0500555_002319 | 3300053103 | Bacteria | 5538 |
| 494 | Ga0500555_048565 | 3300053103 | Bacteria | 1166 |
| 495 | Ga0500556_0000401 | 3300053104 | Bacteria | 31673 |
| 496 | Ga0500562_000596 | 3300053108 | Bacteria | 8682 |
| 497 | Ga0500562_002545 | 3300053108 | Bacteria | 4545 |
| 498 | Ga0500569_004229 | 3300053109 | Bacteria | 3006 |
| 499 | Ga0500593_196948 | 3300053117 | Bacteria | 731 |
| 500 | Ga0500595_018095 | 3300053119 | Bacteria | 2583 |
| 501 | Ga0500595_022793 | 3300053119 | Bacteria | 2209 |
| 502 | Ga0500608_017132 | 3300053122 | Bacteria | 3286 |
| 503 | Ga0500614_002542 | 3300053123 | Bacteria | 4042 |
| 504 | Ga0500614_022524 | 3300053123 | Bacteria | 1472 |
| 505 | Ga0500652_000159 | 3300053131 | Bacteria | 26040 |
| 506 | Ga0500658_0001449 | 3300053134 | Bacteria | 9497 |
| 507 | Ga0500658_0027186 | 3300053134 | Bacteria | 2210 |
| 508 | Ga0500559_0012057 | 3300053136 | Bacteria | 3681 |
| 509 | Ga0500590_008191 | 3300053148 | Bacteria | 5205 |
| 510 | Ga0500638_026644 | 3300053162 | Bacteria | 2771 |
| 511 | Ga0500636_0003540 | 3300053177 | Bacteria | 8791 |
| 512 | Ga0500636_0029250 | 3300053177 | Bacteria | 3254 |
| 513 | Ga0500576_058984 | 3300053725 | Bacteria | 1684 |
| 514 | Ga0500625_010904 | 3300053729 | Bacteria | 4112 |
| 515 | Ga0500645_000738 | 3300053730 | Bacteria | 20146 |
| 516 | Ga0500645_001858 | 3300053730 | Bacteria | 10118 |
| 517 | Ga0500656_006054 | 3300053732 | Bacteria | 1215 |
| 518 | Ga0501082_0912639 | 3300060353 | Bacteria | 768 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035083 | Ga0373926_0004859 | Ga0373926_0004859_389_895 | 161 |
| 2 | 3300035111 | Ga0373923_0002249 | Ga0373923_0002249_1824_2330 | 161 |
| 3 | 3300035113 | Ga0373936_0274987 | Ga0373936_0274987_77_583 | 161 |
| 4 | 3300035171 | Ga0373946_0026778 | Ga0373946_0026778_400_906 | 161 |
| 5 | 3300035172 | Ga0373955_0091267 | Ga0373955_0091267_653_1159 | 161 |
| 6 | 3300035695 | Ga0373927_0003596 | Ga0373927_0003596_8640_9146 | 161 |
| 7 | 3300035725 | Ga0373947_0021564 | Ga0373947_0021564_540_1046 | 161 |
| 8 | 3300036401 | Ga0373937_0031018 | Ga0373937_0031018_2559_3065 | 161 |
| 9 | 3300046454 | Ga0495592_0008377 | Ga0495592_0008377_2598_3104 | 161 |
| 10 | 3300046462 | Ga0495651_0013435 | Ga0495651_0013435_2903_3409 | 161 |
| 11 | 3300046463 | Ga0495653_0036579 | Ga0495653_0036579_3008_3514 | 161 |
| 12 | 3300046472 | Ga0495580_0065697 | Ga0495580_0065697_1347_1853 | 161 |
| 13 | 3300046477 | Ga0495664_0027415 | Ga0495664_0027415_1002_1508 | 161 |
| 14 | 3300046511 | Ga0495608_0167544 | Ga0495608_0167544_607_1113 | 161 |
| 15 | 3300046516 | Ga0495628_0038837 | Ga0495628_0038837_1830_2336 | 161 |
| 16 | 3300046529 | Ga0495652_0004359 | Ga0495652_0004359_8359_8865 | 161 |
| 17 | 3300046531 | Ga0495665_0000718 | Ga0495665_0000718_1611_2117 | 161 |
| 18 | 3300046535 | Ga0495586_0001155 | Ga0495586_0001155_10246_10752 | 161 |
| 19 | 3300046543 | Ga0495645_0012695 | Ga0495645_0012695_3530_4036 | 161 |
| 20 | 3300046559 | Ga0495667_0005502 | Ga0495667_0005502_1906_2412 | 161 |
| 21 | 3300046642 | Ga0495634_0381504 | Ga0495634_0381504_106_612 | 161 |
| 22 | 3300046663 | Ga0495635_0004923 | Ga0495635_0004923_3059_3565 | 161 |
| 23 | 3300046675 | Ga0495657_0018971 | Ga0495657_0018971_1666_2172 | 161 |
| 24 | 3300046678 | Ga0495599_0023104 | Ga0495599_0023104_3366_3872 | 161 |
| 25 | 3300046679 | Ga0495623_0003980 | Ga0495623_0003980_3756_4262 | 161 |
| 26 | 3300046680 | Ga0495646_0003817 | Ga0495646_0003817_3243_3749 | 161 |
| 27 | 3300046690 | Ga0495624_0004988 | Ga0495624_0004988_4126_4632 | 161 |
| 28 | 3300047317 | Ga0495604_0009221 | Ga0495604_0009221_3347_3853 | 161 |
| 29 | 3300047319 | Ga0495674_0027438 | Ga0495674_0027438_2919_3425 | 161 |
| 30 | 3300047321 | Ga0495676_0026132 | Ga0495676_0026132_2967_3473 | 161 |
| 31 | 3300047322 | Ga0495680_0111886 | Ga0495680_0111886_1174_1680 | 161 |
| 32 | 3300047444 | Ga0495675_0199468 | Ga0495675_0199468_197_703 | 161 |
| 33 | 3300047471 | Ga0495684_0024884 | Ga0495684_0024884_2903_3409 | 161 |
| 34 | 3300047673 | Ga0495593_0010500 | Ga0495593_0010500_586_1092 | 161 |
| 35 | 3300048088 | Ga0495602_0020653 | Ga0495602_0020653_2602_3108 | 161 |
| 36 | 3300048089 | Ga0495614_0003221 | Ga0495614_0003221_3313_3819 | 161 |
| 37 | 3300053077 | Ga0495601_0126346 | Ga0495601_0126346_210_716 | 161 |
| 38 | 3300053078 | Ga0495612_0002058 | Ga0495612_0002058_5570_6076 | 161 |
| 39 | 3300049576 | Ga0501040_0326033 | Ga0501040_0326033_402_914 | 168 |
| 40 | 3300049587 | Ga0501071_0310538 | Ga0501071_0310538_422_934 | 168 |
| 41 | 3300049588 | Ga0501072_0186359 | Ga0501072_0186359_373_885 | 168 |
| 42 | 3300049591 | Ga0501075_0136212 | Ga0501075_0136212_373_885 | 168 |
| 43 | 3300028800 | Ga0265338_10269853 | Ga0265338_102698532 | 169 |
| 44 | 3300031240 | Ga0265320_10012449 | Ga0265320_100124491 | 169 |
| 45 | 3300031247 | Ga0265340_10033752 | Ga0265340_100337521 | 169 |
| 46 | 3300031344 | Ga0265316_10027007 | Ga0265316_100270073 | 169 |
| 47 | 3300009098 | Ga0105245_10074157 | Ga0105245_100741573 | 174 |
| 48 | 3300009551 | Ga0105238_10112245 | Ga0105238_101122452 | 174 |
| 49 | 3300025924 | Ga0207694_10147416 | Ga0207694_101474162 | 174 |
| 50 | 3300047472 | Ga0495686_0000779 | Ga0495686_0000779_23094_23657 | 174 |
| 51 | 3300035398 | Ga0316574_0109912 | Ga0316574_0109912_1134_1667 | 176 |
| 52 | 3300046454 | Ga0495592_0135940 | Ga0495592_0135940_512_1063 | 176 |
| 53 | 3300046462 | Ga0495651_0001572 | Ga0495651_0001572_4470_5021 | 176 |
| 54 | 3300046463 | Ga0495653_0157783 | Ga0495653_0157783_1000_1551 | 176 |
| 55 | 3300046477 | Ga0495664_0072559 | Ga0495664_0072559_940_1491 | 176 |
| 56 | 3300046516 | Ga0495628_0000524 | Ga0495628_0000524_32835_33386 | 176 |
| 57 | 3300046517 | Ga0495630_0247434 | Ga0495630_0247434_476_1039 | 176 |
| 58 | 3300046529 | Ga0495652_0002166 | Ga0495652_0002166_296_847 | 176 |
| 59 | 3300046533 | Ga0495640_0028261 | Ga0495640_0028261_434_985 | 176 |
| 60 | 3300046536 | Ga0495587_0000766 | Ga0495587_0000766_18051_18602 | 176 |
| 61 | 3300046559 | Ga0495667_0024974 | Ga0495667_0024974_2247_2798 | 176 |
| 62 | 3300046675 | Ga0495657_0040776 | Ga0495657_0040776_494_1045 | 176 |
| 63 | 3300046678 | Ga0495599_0078449 | Ga0495599_0078449_1223_1774 | 176 |
| 64 | 3300046690 | Ga0495624_0314881 | Ga0495624_0314881_345_896 | 176 |
| 65 | 3300046809 | Ga0495600_0022165 | Ga0495600_0022165_3142_3693 | 176 |
| 66 | 3300047444 | Ga0495675_0000236 | Ga0495675_0000236_29025_29576 | 176 |
| 67 | 3300047471 | Ga0495684_0014989 | Ga0495684_0014989_450_1001 | 176 |
| 68 | 3300048088 | Ga0495602_0057608 | Ga0495602_0057608_1971_2522 | 176 |
| 69 | 3300053085 | Ga0495619_0072552 | Ga0495619_0072552_365_916 | 176 |
| 70 | iso_pu_bacteria | 2834578030 | 2834578614 | 177 |
| 71 | iso_pu_bacteria | 2899275550 | 2899276948 | 177 |
| 72 | 3300003791 | Ga0055530_10000035 | Ga0055530_100000359 | 178 |
| 73 | 3300005719 | Ga0068861_100251115 | Ga0068861_1002511152 | 178 |
| 74 | 3300009094 | Ga0111539_10987774 | Ga0111539_109877742 | 178 |
| 75 | 3300017792 | Ga0163161_10472031 | Ga0163161_104720312 | 178 |
| 76 | 3300025292 | Ga0209676_1000454 | Ga0209676_100045414 | 178 |
| 77 | 3300025298 | Ga0209050_1000042 | Ga0209050_100004291 | 178 |
| 78 | 3300025304 | Ga0209257_1001860 | Ga0209257_100186012 | 178 |
| 79 | 3300032005 | Ga0307411_10179676 | Ga0307411_101796762 | 178 |
| 80 | 3300044712 | Ga0453684_0007109 | Ga0453684_0007109_16588_17127 | 178 |
| 81 | 3300049671 | Ga0501238_000461 | Ga0501238_000461_1625_2182 | 178 |
| 82 | 3300050511 | nmdc:mga08y16_903916_c1 | nmdc:mga08y16_903916_c1_311_853 | 178 |
| 83 | 3300005549 | Ga0070704_100043095 | Ga0070704_1000430951 | 179 |
| 84 | 3300009093 | Ga0105240_10880117 | Ga0105240_108801171 | 179 |
| 85 | 3300009094 | Ga0111539_10016877 | Ga0111539_100168773 | 179 |
| 86 | 3300009098 | Ga0105245_10060427 | Ga0105245_100604273 | 179 |
| 87 | 3300009101 | Ga0105247_10123383 | Ga0105247_101233832 | 179 |
| 88 | 3300009545 | Ga0105237_10300579 | Ga0105237_103005792 | 179 |
| 89 | 3300010159 | Ga0099796_10021119 | Ga0099796_100211192 | 179 |
| 90 | 3300013296 | Ga0157374_10003601 | Ga0157374_1000360110 | 179 |
| 91 | 3300013297 | Ga0157378_10000834 | Ga0157378_100008346 | 179 |
| 92 | 3300014969 | Ga0157376_10485284 | Ga0157376_104852842 | 179 |
| 93 | 3300024227 | Ga0228598_1000575 | Ga0228598_10005755 | 179 |
| 94 | 3300025914 | Ga0207671_10445990 | Ga0207671_104459902 | 179 |
| 95 | 3300027907 | Ga0207428_10320033 | Ga0207428_103200331 | 179 |
| 96 | 3300028563 | Ga0265319_1000301 | Ga0265319_10003015 | 179 |
| 97 | 3300028577 | Ga0265318_10000122 | Ga0265318_1000012255 | 179 |
| 98 | 3300028653 | Ga0265323_10008039 | Ga0265323_100080395 | 179 |
| 99 | 3300028653 | Ga0265323_10008563 | Ga0265323_100085632 | 179 |
| 100 | 3300028654 | Ga0265322_10090787 | Ga0265322_100907872 | 179 |
| 101 | 3300028800 | Ga0265338_10061652 | Ga0265338_100616524 | 179 |
| 102 | 3300028800 | Ga0265338_10259079 | Ga0265338_102590792 | 179 |
| 103 | 3300031235 | Ga0265330_10033806 | Ga0265330_100338061 | 179 |
| 104 | 3300031238 | Ga0265332_10260304 | Ga0265332_102603041 | 179 |
| 105 | 3300031241 | Ga0265325_10046974 | Ga0265325_100469743 | 179 |
| 106 | 3300031242 | Ga0265329_10000720 | Ga0265329_100007205 | 179 |
| 107 | 3300031250 | Ga0265331_10000028 | Ga0265331_1000002830 | 179 |
| 108 | 3300031344 | Ga0265316_10005586 | Ga0265316_100055867 | 179 |
| 109 | 3300031344 | Ga0265316_10021205 | Ga0265316_100212053 | 179 |
| 110 | 3300031344 | Ga0265316_10051414 | Ga0265316_100514143 | 179 |
| 111 | 3300031665 | Ga0316575_10000800 | Ga0316575_100008004 | 179 |
| 112 | 3300031665 | Ga0316575_10049241 | Ga0316575_100492411 | 179 |
| 113 | 3300031711 | Ga0265314_10032544 | Ga0265314_100325444 | 179 |
| 114 | 3300031711 | Ga0265314_10114437 | Ga0265314_101144372 | 179 |
| 115 | 3300031711 | Ga0265314_10248103 | Ga0265314_102481032 | 179 |
| 116 | 3300031712 | Ga0265342_10000161 | Ga0265342_1000016128 | 179 |
| 117 | 3300031712 | Ga0265342_10059007 | Ga0265342_100590072 | 179 |
| 118 | 3300031712 | Ga0265342_10237177 | Ga0265342_102371772 | 179 |
| 119 | 3300032133 | Ga0316583_10004608 | Ga0316583_100046084 | 179 |
| 120 | 3300032133 | Ga0316583_10073615 | Ga0316583_100736152 | 179 |
| 121 | 3300035118 | Ga0373954_0072347 | Ga0373954_0072347_889_1449 | 179 |
| 122 | 3300035170 | Ga0373943_0443248 | Ga0373943_0443248_120_680 | 179 |
| 123 | 3300035398 | Ga0316574_0095520 | Ga0316574_0095520_1308_1859 | 179 |
| 124 | 3300035724 | Ga0373933_0381710 | Ga0373933_0381710_167_727 | 179 |
| 125 | 3300037471 | Ga0395905_0598089 | Ga0395905_0598089_12_563 | 179 |
| 126 | 3300046462 | Ga0495651_0000564 | Ga0495651_0000564_2243_2803 | 179 |
| 127 | 3300046477 | Ga0495664_0027998 | Ga0495664_0027998_2683_3243 | 179 |
| 128 | 3300046499 | Ga0495594_0110543 | Ga0495594_0110543_250_810 | 179 |
| 129 | 3300046514 | Ga0495618_0172506 | Ga0495618_0172506_128_688 | 179 |
| 130 | 3300046514 | Ga0495618_0323363 | Ga0495618_0323363_381_941 | 179 |
| 131 | 3300046516 | Ga0495628_0019538 | Ga0495628_0019538_2977_3537 | 179 |
| 132 | 3300046517 | Ga0495630_0045302 | Ga0495630_0045302_2375_2935 | 179 |
| 133 | 3300046517 | Ga0495630_0127253 | Ga0495630_0127253_1163_1723 | 179 |
| 134 | 3300046526 | Ga0495666_0011645 | Ga0495666_0011645_2883_3443 | 179 |
| 135 | 3300046531 | Ga0495665_0125218 | Ga0495665_0125218_617_1177 | 179 |
| 136 | 3300046533 | Ga0495640_0120869 | Ga0495640_0120869_528_1088 | 179 |
| 137 | 3300046536 | Ga0495587_0106551 | Ga0495587_0106551_764_1324 | 179 |
| 138 | 3300046543 | Ga0495645_0089849 | Ga0495645_0089849_546_1106 | 179 |
| 139 | 3300046559 | Ga0495667_0000245 | Ga0495667_0000245_15567_16127 | 179 |
| 140 | 3300046642 | Ga0495634_0163469 | Ga0495634_0163469_564_1124 | 179 |
| 141 | 3300046675 | Ga0495657_0180765 | Ga0495657_0180765_699_1259 | 179 |
| 142 | 3300046679 | Ga0495623_0033400 | Ga0495623_0033400_2133_2693 | 179 |
| 143 | 3300046680 | Ga0495646_0112935 | Ga0495646_0112935_816_1376 | 179 |
| 144 | 3300046689 | Ga0495613_0125995 | Ga0495613_0125995_346_906 | 179 |
| 145 | 3300046809 | Ga0495600_0061032 | Ga0495600_0061032_548_1108 | 179 |
| 146 | 3300047319 | Ga0495674_0005320 | Ga0495674_0005320_5030_5590 | 179 |
| 147 | 3300047319 | Ga0495674_0484661 | Ga0495674_0484661_326_946 | 179 |
| 148 | 3300047322 | Ga0495680_0000371 | Ga0495680_0000371_15949_16509 | 179 |
| 149 | 3300047444 | Ga0495675_0322541 | Ga0495675_0322541_206_766 | 179 |
| 150 | 3300047471 | Ga0495684_0341397 | Ga0495684_0341397_131_691 | 179 |
| 151 | 3300048088 | Ga0495602_0137989 | Ga0495602_0137989_951_1511 | 179 |
| 152 | 3300048915 | Ga0496112_0310109 | Ga0496112_0310109_185_745 | 179 |
| 153 | 3300050511 | nmdc:mga08y16_9776_c1 | nmdc:mga08y16_9776_c1_4787_5374 | 179 |
| 154 | iso_pu_bacteria | 2508501042 | 2508697711 | 179 |
| 155 | iso_pu_bacteria | 2510917020 | 2511123751 | 179 |
| 156 | iso_pu_bacteria | 2643221583 | 2643922518 | 179 |
| 157 | iso_pu_bacteria | 2849560528 | 2849561297 | 179 |
| 158 | iso_pu_bacteria | 2849573788 | 2849577332 | 179 |
| 159 | iso_pu_bacteria | 2936055302 | 2936063180 | 179 |
| 160 | iso_pu_bacteria | 8016630954 | 8016632929 | 179 |
| 161 | 3300026067 | Ga0207678_11199536 | Ga0207678_111995361 | 180 |
| 162 | 3300049580 | Ga0501046_0138063 | Ga0501046_0138063_657_1211 | 180 |
| 163 | iso_pu_bacteria | 2643221614 | 2644087404 | 180 |
| 164 | iso_pu_bacteria | 2643221661 | 2644344552 | 180 |
| 165 | iso_pu_bacteria | 2643221666 | 2644366764 | 180 |
| 166 | 3300005329 | Ga0070683_101388295 | Ga0070683_1013882951 | 181 |
| 167 | 3300025254 | Ga0209148_1022340 | Ga0209148_10223402 | 181 |
| 168 | 3300028558 | Ga0265326_10008000 | Ga0265326_100080003 | 181 |
| 169 | 3300028573 | Ga0265334_10090731 | Ga0265334_100907312 | 181 |
| 170 | 3300028800 | Ga0265338_10028732 | Ga0265338_100287324 | 181 |
| 171 | 3300028800 | Ga0265338_10489968 | Ga0265338_104899682 | 181 |
| 172 | 3300028800 | Ga0265338_10662690 | Ga0265338_106626902 | 181 |
| 173 | 3300031251 | Ga0265327_10044047 | Ga0265327_100440472 | 181 |
| 174 | 3300031711 | Ga0265314_10008476 | Ga0265314_100084762 | 181 |
| 175 | 3300048909 | Ga0496106_0421215 | Ga0496106_0421215_210_773 | 181 |
| 176 | 3300005339 | Ga0070660_100043678 | Ga0070660_1000436782 | 182 |
| 177 | 3300005353 | Ga0070669_100166745 | Ga0070669_1001667452 | 182 |
| 178 | 3300005355 | Ga0070671_100103039 | Ga0070671_1001030392 | 182 |
| 179 | 3300005366 | Ga0070659_100002748 | Ga0070659_1000027485 | 182 |
| 180 | 3300005367 | Ga0070667_100014757 | Ga0070667_1000147573 | 182 |
| 181 | 3300005614 | Ga0068856_101875578 | Ga0068856_1018755781 | 182 |
| 182 | 3300005617 | Ga0068859_100000681 | Ga0068859_10000068132 | 182 |
| 183 | 3300005719 | Ga0068861_100563609 | Ga0068861_1005636092 | 182 |
| 184 | 3300005841 | Ga0068863_100024022 | Ga0068863_1000240226 | 182 |
| 185 | 3300005844 | Ga0068862_100041185 | Ga0068862_1000411853 | 182 |
| 186 | 3300006048 | Ga0075363_100564227 | Ga0075363_1005642271 | 182 |
| 187 | 3300006931 | Ga0097620_100000681 | Ga0097620_1000006816 | 182 |
| 188 | 3300009093 | Ga0105240_10098535 | Ga0105240_100985353 | 182 |
| 189 | 3300009177 | Ga0105248_10002170 | Ga0105248_100021703 | 182 |
| 190 | 3300009551 | Ga0105238_10128582 | Ga0105238_101285822 | 182 |
| 191 | 3300014325 | Ga0163163_10007905 | Ga0163163_100079055 | 182 |
| 192 | 3300014968 | Ga0157379_10003769 | Ga0157379_100037695 | 182 |
| 193 | 3300025909 | Ga0207705_10087935 | Ga0207705_100879352 | 182 |
| 194 | 3300025914 | Ga0207671_10732328 | Ga0207671_107323281 | 182 |
| 195 | 3300025919 | Ga0207657_10016726 | Ga0207657_100167264 | 182 |
| 196 | 3300025923 | Ga0207681_10009307 | Ga0207681_100093076 | 182 |
| 197 | 3300025924 | Ga0207694_10152522 | Ga0207694_101525222 | 182 |
| 198 | 3300025932 | Ga0207690_10000496 | Ga0207690_1000049628 | 182 |
| 199 | 3300025941 | Ga0207711_10009460 | Ga0207711_100094605 | 182 |
| 200 | 3300025986 | Ga0207658_10015009 | Ga0207658_100150095 | 182 |
| 201 | 3300026035 | Ga0207703_10127104 | Ga0207703_101271043 | 182 |
| 202 | 3300026041 | Ga0207639_10383163 | Ga0207639_103831632 | 182 |
| 203 | 3300026088 | Ga0207641_10009570 | Ga0207641_100095707 | 182 |
| 204 | 3300026118 | Ga0207675_100380753 | Ga0207675_1003807532 | 182 |
| 205 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031184 | 182 |
| 206 | 3300028380 | Ga0268265_10118524 | Ga0268265_101185242 | 182 |
| 207 | 3300028381 | Ga0268264_10261873 | Ga0268264_102618732 | 182 |
| 208 | 3300046471 | Ga0495650_0097678 | Ga0495650_0097678_284_832 | 182 |
| 209 | 3300048904 | Ga0496101_0213658 | Ga0496101_0213658_107_658 | 182 |
| 210 | 3300048918 | Ga0496115_0009461 | Ga0496115_0009461_3850_4398 | 182 |
| 211 | 3300003215 | JGI25153J46596_10010452 | JGI25153J46596_100104523 | 183 |
| 212 | 3300003773 | Ga0055537_1002437 | Ga0055537_10024374 | 183 |
| 213 | 3300003775 | Ga0055524_1004355 | Ga0055524_10043555 | 183 |
| 214 | 3300003790 | Ga0055528_1029862 | Ga0055528_10298621 | 183 |
| 215 | 3300003791 | Ga0055530_10000788 | Ga0055530_1000078814 | 183 |
| 216 | 3300003794 | Ga0055531_10001105 | Ga0055531_100011058 | 183 |
| 217 | 3300005262 | Ga0065165_1000688 | Ga0065165_100068815 | 183 |
| 218 | 3300005331 | Ga0070670_100000022 | Ga0070670_100000022113 | 183 |
| 219 | 3300005331 | Ga0070670_100386869 | Ga0070670_1003868692 | 183 |
| 220 | 3300005335 | Ga0070666_10017550 | Ga0070666_100175502 | 183 |
| 221 | 3300005338 | Ga0068868_100884338 | Ga0068868_1008843381 | 183 |
| 222 | 3300005340 | Ga0070689_100518674 | Ga0070689_1005186741 | 183 |
| 223 | 3300005343 | Ga0070687_100587535 | Ga0070687_1005875351 | 183 |
| 224 | 3300005344 | Ga0070661_100467991 | Ga0070661_1004679911 | 183 |
| 225 | 3300005347 | Ga0070668_100000710 | Ga0070668_1000007109 | 183 |
| 226 | 3300005347 | Ga0070668_100008045 | Ga0070668_1000080453 | 183 |
| 227 | 3300005353 | Ga0070669_100312166 | Ga0070669_1003121662 | 183 |
| 228 | 3300005353 | Ga0070669_100318013 | Ga0070669_1003180132 | 183 |
| 229 | 3300005355 | Ga0070671_100344206 | Ga0070671_1003442062 | 183 |
| 230 | 3300005356 | Ga0070674_100447700 | Ga0070674_1004477002 | 183 |
| 231 | 3300005364 | Ga0070673_100126633 | Ga0070673_1001266332 | 183 |
| 232 | 3300005367 | Ga0070667_100005071 | Ga0070667_10000507111 | 183 |
| 233 | 3300005367 | Ga0070667_100014322 | Ga0070667_1000143222 | 183 |
| 234 | 3300005457 | Ga0070662_100633264 | Ga0070662_1006332642 | 183 |
| 235 | 3300005458 | Ga0070681_10014375 | Ga0070681_100143757 | 183 |
| 236 | 3300005468 | Ga0070707_101109756 | Ga0070707_1011097561 | 183 |
| 237 | 3300005539 | Ga0068853_100472392 | Ga0068853_1004723922 | 183 |
| 238 | 3300005548 | Ga0070665_100001038 | Ga0070665_1000010382 | 183 |
| 239 | 3300005548 | Ga0070665_100047790 | Ga0070665_1000477902 | 183 |
| 240 | 3300005548 | Ga0070665_100348560 | Ga0070665_1003485602 | 183 |
| 241 | 3300005617 | Ga0068859_100003103 | Ga0068859_10000310322 | 183 |
| 242 | 3300005617 | Ga0068859_100050876 | Ga0068859_1000508765 | 183 |
| 243 | 3300005617 | Ga0068859_100173053 | Ga0068859_1001730532 | 183 |
| 244 | 3300005618 | Ga0068864_100000125 | Ga0068864_10000012558 | 183 |
| 245 | 3300005618 | Ga0068864_100000418 | Ga0068864_10000041819 | 183 |
| 246 | 3300005618 | Ga0068864_100001709 | Ga0068864_1000017096 | 183 |
| 247 | 3300005618 | Ga0068864_100718175 | Ga0068864_1007181752 | 183 |
| 248 | 3300005719 | Ga0068861_100014450 | Ga0068861_1000144506 | 183 |
| 249 | 3300005841 | Ga0068863_100000066 | Ga0068863_10000006617 | 183 |
| 250 | 3300005841 | Ga0068863_100000486 | Ga0068863_10000048642 | 183 |
| 251 | 3300005841 | Ga0068863_100112359 | Ga0068863_1001123593 | 183 |
| 252 | 3300005841 | Ga0068863_100178115 | Ga0068863_1001781152 | 183 |
| 253 | 3300005841 | Ga0068863_100456086 | Ga0068863_1004560862 | 183 |
| 254 | 3300005842 | Ga0068858_100000136 | Ga0068858_1000001365 | 183 |
| 255 | 3300005842 | Ga0068858_100003656 | Ga0068858_1000036565 | 183 |
| 256 | 3300005842 | Ga0068858_100095484 | Ga0068858_1000954843 | 183 |
| 257 | 3300005843 | Ga0068860_100000066 | Ga0068860_100000066173 | 183 |
| 258 | 3300005843 | Ga0068860_100000136 | Ga0068860_10000013689 | 183 |
| 259 | 3300005843 | Ga0068860_100011612 | Ga0068860_1000116129 | 183 |
| 260 | 3300005844 | Ga0068862_100001264 | Ga0068862_10000126410 | 183 |
| 261 | 3300005844 | Ga0068862_100022276 | Ga0068862_1000222765 | 183 |
| 262 | 3300005844 | Ga0068862_100063982 | Ga0068862_1000639823 | 183 |
| 263 | 3300006195 | Ga0075366_10173624 | Ga0075366_101736242 | 183 |
| 264 | 3300006353 | Ga0075370_10147269 | Ga0075370_101472692 | 183 |
| 265 | 3300006358 | Ga0068871_100167640 | Ga0068871_1001676403 | 183 |
| 266 | 3300006881 | Ga0068865_100894772 | Ga0068865_1008947721 | 183 |
| 267 | 3300006931 | Ga0097620_100003103 | Ga0097620_10000310322 | 183 |
| 268 | 3300006931 | Ga0097620_100050876 | Ga0097620_1000508765 | 183 |
| 269 | 3300006931 | Ga0097620_100173061 | Ga0097620_1001730612 | 183 |
| 270 | 3300009092 | Ga0105250_10194769 | Ga0105250_101947691 | 183 |
| 271 | 3300009093 | Ga0105240_10594003 | Ga0105240_105940032 | 183 |
| 272 | 3300009101 | Ga0105247_10782554 | Ga0105247_107825542 | 183 |
| 273 | 3300009174 | Ga0105241_10780202 | Ga0105241_107802022 | 183 |
| 274 | 3300009177 | Ga0105248_10016699 | Ga0105248_100166994 | 183 |
| 275 | 3300009177 | Ga0105248_10028114 | Ga0105248_100281143 | 183 |
| 276 | 3300009177 | Ga0105248_10803756 | Ga0105248_108037562 | 183 |
| 277 | 3300009551 | Ga0105238_10156461 | Ga0105238_101564613 | 183 |
| 278 | 3300009551 | Ga0105238_10483434 | Ga0105238_104834342 | 183 |
| 279 | 3300009551 | Ga0105238_10587282 | Ga0105238_105872822 | 183 |
| 280 | 3300009553 | Ga0105249_10000376 | Ga0105249_1000037631 | 183 |
| 281 | 3300009553 | Ga0105249_10379628 | Ga0105249_103796282 | 183 |
| 282 | 3300010375 | Ga0105239_10428647 | Ga0105239_104286472 | 183 |
| 283 | 3300013296 | Ga0157374_10415412 | Ga0157374_104154121 | 183 |
| 284 | 3300013306 | Ga0163162_10239247 | Ga0163162_102392472 | 183 |
| 285 | 3300013306 | Ga0163162_11238720 | Ga0163162_112387202 | 183 |
| 286 | 3300013307 | Ga0157372_11050439 | Ga0157372_110504392 | 183 |
| 287 | 3300013308 | Ga0157375_10344891 | Ga0157375_103448912 | 183 |
| 288 | 3300013308 | Ga0157375_11277334 | Ga0157375_112773342 | 183 |
| 289 | 3300014325 | Ga0163163_10065846 | Ga0163163_100658463 | 183 |
| 290 | 3300014325 | Ga0163163_10127627 | Ga0163163_101276272 | 183 |
| 291 | 3300014497 | Ga0182008_10475514 | Ga0182008_104755141 | 183 |
| 292 | 3300014968 | Ga0157379_10017570 | Ga0157379_100175703 | 183 |
| 293 | 3300014968 | Ga0157379_11078149 | Ga0157379_110781492 | 183 |
| 294 | 3300020082 | Ga0206353_11902316 | Ga0206353_119023161 | 183 |
| 295 | 3300025250 | Ga0209026_1000567 | Ga0209026_10005673 | 183 |
| 296 | 3300025263 | Ga0209565_1000090 | Ga0209565_100009059 | 183 |
| 297 | 3300025273 | Ga0209673_1001000 | Ga0209673_100100022 | 183 |
| 298 | 3300025291 | Ga0209675_1015077 | Ga0209675_10150772 | 183 |
| 299 | 3300025295 | Ga0209564_1017317 | Ga0209564_10173173 | 183 |
| 300 | 3300025297 | Ga0209758_1000999 | Ga0209758_100099922 | 183 |
| 301 | 3300025297 | Ga0209758_1003056 | Ga0209758_100305612 | 183 |
| 302 | 3300025298 | Ga0209050_1000867 | Ga0209050_100086736 | 183 |
| 303 | 3300025299 | Ga0209256_1002391 | Ga0209256_10023918 | 183 |
| 304 | 3300025299 | Ga0209256_1007405 | Ga0209256_10074053 | 183 |
| 305 | 3300025304 | Ga0209257_1000227 | Ga0209257_1000227135 | 183 |
| 306 | 3300025304 | Ga0209257_1047283 | Ga0209257_10472832 | 183 |
| 307 | 3300025315 | Ga0207697_10209006 | Ga0207697_102090062 | 183 |
| 308 | 3300025903 | Ga0207680_10016182 | Ga0207680_100161824 | 183 |
| 309 | 3300025903 | Ga0207680_10106582 | Ga0207680_101065822 | 183 |
| 310 | 3300025911 | Ga0207654_10185158 | Ga0207654_101851581 | 183 |
| 311 | 3300025912 | Ga0207707_10179768 | Ga0207707_101797682 | 183 |
| 312 | 3300025913 | Ga0207695_10003289 | Ga0207695_100032899 | 183 |
| 313 | 3300025913 | Ga0207695_10034543 | Ga0207695_100345435 | 183 |
| 314 | 3300025913 | Ga0207695_10182597 | Ga0207695_101825973 | 183 |
| 315 | 3300025917 | Ga0207660_10479198 | Ga0207660_104791982 | 183 |
| 316 | 3300025917 | Ga0207660_10910018 | Ga0207660_109100181 | 183 |
| 317 | 3300025920 | Ga0207649_10424640 | Ga0207649_104246402 | 183 |
| 318 | 3300025923 | Ga0207681_10247103 | Ga0207681_102471032 | 183 |
| 319 | 3300025924 | Ga0207694_10151763 | Ga0207694_101517632 | 183 |
| 320 | 3300025924 | Ga0207694_10335147 | Ga0207694_103351472 | 183 |
| 321 | 3300025925 | Ga0207650_10000016 | Ga0207650_1000001633 | 183 |
| 322 | 3300025925 | Ga0207650_10032724 | Ga0207650_100327241 | 183 |
| 323 | 3300025925 | Ga0207650_10100576 | Ga0207650_101005761 | 183 |
| 324 | 3300025933 | Ga0207706_10075205 | Ga0207706_100752052 | 183 |
| 325 | 3300025939 | Ga0207665_10300291 | Ga0207665_103002912 | 183 |
| 326 | 3300025941 | Ga0207711_10016203 | Ga0207711_100162035 | 183 |
| 327 | 3300025941 | Ga0207711_10042892 | Ga0207711_100428923 | 183 |
| 328 | 3300025941 | Ga0207711_10541998 | Ga0207711_105419982 | 183 |
| 329 | 3300025941 | Ga0207711_10636461 | Ga0207711_106364612 | 183 |
| 330 | 3300025942 | Ga0207689_10111738 | Ga0207689_101117383 | 183 |
| 331 | 3300025942 | Ga0207689_10572412 | Ga0207689_105724122 | 183 |
| 332 | 3300025960 | Ga0207651_10199458 | Ga0207651_101994582 | 183 |
| 333 | 3300025961 | Ga0207712_10000794 | Ga0207712_100007944 | 183 |
| 334 | 3300025972 | Ga0207668_10000117 | Ga0207668_1000011711 | 183 |
| 335 | 3300025972 | Ga0207668_10051933 | Ga0207668_100519332 | 183 |
| 336 | 3300025972 | Ga0207668_10130149 | Ga0207668_101301492 | 183 |
| 337 | 3300025972 | Ga0207668_10142410 | Ga0207668_101424102 | 183 |
| 338 | 3300025981 | Ga0207640_10349578 | Ga0207640_103495782 | 183 |
| 339 | 3300025986 | Ga0207658_10002457 | Ga0207658_100024573 | 183 |
| 340 | 3300025986 | Ga0207658_10416795 | Ga0207658_104167952 | 183 |
| 341 | 3300025986 | Ga0207658_10484179 | Ga0207658_104841792 | 183 |
| 342 | 3300026035 | Ga0207703_10000065 | Ga0207703_1000006584 | 183 |
| 343 | 3300026035 | Ga0207703_10001304 | Ga0207703_1000130413 | 183 |
| 344 | 3300026035 | Ga0207703_10228732 | Ga0207703_102287322 | 183 |
| 345 | 3300026035 | Ga0207703_10265198 | Ga0207703_102651982 | 183 |
| 346 | 3300026067 | Ga0207678_10288256 | Ga0207678_102882562 | 183 |
| 347 | 3300026088 | Ga0207641_10000011 | Ga0207641_10000011372 | 183 |
| 348 | 3300026088 | Ga0207641_10001896 | Ga0207641_100018965 | 183 |
| 349 | 3300026088 | Ga0207641_10017742 | Ga0207641_100177422 | 183 |
| 350 | 3300026095 | Ga0207676_10000055 | Ga0207676_10000055100 | 183 |
| 351 | 3300026095 | Ga0207676_10000450 | Ga0207676_1000045041 | 183 |
| 352 | 3300026095 | Ga0207676_10003841 | Ga0207676_100038416 | 183 |
| 353 | 3300026095 | Ga0207676_10038403 | Ga0207676_100384034 | 183 |
| 354 | 3300026118 | Ga0207675_100022523 | Ga0207675_1000225236 | 183 |
| 355 | 3300027378 | Ga0209981_1000621 | Ga0209981_10006215 | 183 |
| 356 | 3300027543 | Ga0209999_1012440 | Ga0209999_10124402 | 183 |
| 357 | 3300028379 | Ga0268266_10004304 | Ga0268266_100043042 | 183 |
| 358 | 3300028379 | Ga0268266_10137438 | Ga0268266_101374382 | 183 |
| 359 | 3300028379 | Ga0268266_10177101 | Ga0268266_101771012 | 183 |
| 360 | 3300028380 | Ga0268265_10001013 | Ga0268265_1000101319 | 183 |
| 361 | 3300028380 | Ga0268265_10006946 | Ga0268265_100069462 | 183 |
| 362 | 3300028380 | Ga0268265_10052527 | Ga0268265_100525273 | 183 |
| 363 | 3300028381 | Ga0268264_10000265 | Ga0268264_1000026524 | 183 |
| 364 | 3300028381 | Ga0268264_10889463 | Ga0268264_108894632 | 183 |
| 365 | 3300028786 | Ga0307517_10006346 | Ga0307517_100063464 | 183 |
| 366 | 3300028794 | Ga0307515_10028618 | Ga0307515_100286184 | 183 |
| 367 | 3300028794 | Ga0307515_10242372 | Ga0307515_102423722 | 183 |
| 368 | 3300030521 | Ga0307511_10037163 | Ga0307511_100371635 | 183 |
| 369 | 3300031456 | Ga0307513_10000100 | Ga0307513_1000010035 | 183 |
| 370 | 3300031456 | Ga0307513_10009312 | Ga0307513_100093122 | 183 |
| 371 | 3300031456 | Ga0307513_10010426 | Ga0307513_100104262 | 183 |
| 372 | 3300031548 | Ga0307408_100092015 | Ga0307408_1000920153 | 183 |
| 373 | 3300031730 | Ga0307516_10000113 | Ga0307516_100001139 | 183 |
| 374 | 3300032004 | Ga0307414_10143181 | Ga0307414_101431813 | 183 |
| 375 | 3300033180 | Ga0307510_10003321 | Ga0307510_100033218 | 183 |
| 376 | 3300035083 | Ga0373926_0051281 | Ga0373926_0051281_69_725 | 183 |
| 377 | 3300035089 | Ga0373944_0005748 | Ga0373944_0005748_2065_2619 | 183 |
| 378 | 3300035113 | Ga0373936_0103086 | Ga0373936_0103086_302_856 | 183 |
| 379 | 3300035171 | Ga0373946_0015865 | Ga0373946_0015865_1383_1937 | 183 |
| 380 | 3300035692 | Ga0373935_0161776 | Ga0373935_0161776_270_824 | 183 |
| 381 | 3300035695 | Ga0373927_0000173 | Ga0373927_0000173_18366_18920 | 183 |
| 382 | 3300035725 | Ga0373947_0061490 | Ga0373947_0061490_957_1511 | 183 |
| 383 | 3300037068 | Ga0373925_0000049 | Ga0373925_0000049_50089_50643 | 183 |
| 384 | 3300037068 | Ga0373925_0117844 | Ga0373925_0117844_1307_1861 | 183 |
| 385 | 3300037312 | Ga0395899_0000115 | Ga0395899_0000115_49834_50388 | 183 |
| 386 | 3300037312 | Ga0395899_0057825 | Ga0395899_0057825_1634_2188 | 183 |
| 387 | 3300037312 | Ga0395899_0177013 | Ga0395899_0177013_345_899 | 183 |
| 388 | 3300037418 | Ga0395900_0000002 | Ga0395900_0000002_87164_87718 | 183 |
| 389 | 3300037418 | Ga0395900_0230583 | Ga0395900_0230583_1194_1748 | 183 |
| 390 | 3300037418 | Ga0395900_0372942 | Ga0395900_0372942_318_872 | 183 |
| 391 | 3300037466 | Ga0395898_0008120 | Ga0395898_0008120_6785_7339 | 183 |
| 392 | 3300037466 | Ga0395898_0809466 | Ga0395898_0809466_275_829 | 183 |
| 393 | 3300037471 | Ga0395905_0021615 | Ga0395905_0021615_5231_5785 | 183 |
| 394 | 3300037471 | Ga0395905_0265671 | Ga0395905_0265671_406_960 | 183 |
| 395 | 3300037471 | Ga0395905_0550337 | Ga0395905_0550337_131_685 | 183 |
| 396 | 3300037471 | Ga0395905_0570213 | Ga0395905_0570213_447_1001 | 183 |
| 397 | 3300038443 | Ga0395901_0000021 | Ga0395901_0000021_207191_207745 | 183 |
| 398 | 3300038443 | Ga0395901_0340827 | Ga0395901_0340827_623_1177 | 183 |
| 399 | 3300038443 | Ga0395901_0456930 | Ga0395901_0456930_101_655 | 183 |
| 400 | 3300039437 | Ga0436365_0820477 | Ga0436365_0820477_489_1049 | 183 |
| 401 | 3300039447 | Ga0436361_0340319 | Ga0436361_0340319_301_855 | 183 |
| 402 | 3300042004 | Ga0439445_0115495 | Ga0439445_0115495_20_577 | 183 |
| 403 | 3300046459 | Ga0495629_0153650 | Ga0495629_0153650_684_1271 | 183 |
| 404 | 3300046460 | Ga0495638_0000293 | Ga0495638_0000293_13509_14081 | 183 |
| 405 | 3300046460 | Ga0495638_0000996 | Ga0495638_0000996_12483_13055 | 183 |
| 406 | 3300046460 | Ga0495638_0001207 | Ga0495638_0001207_11457_12029 | 183 |
| 407 | 3300046471 | Ga0495650_0060642 | Ga0495650_0060642_450_1019 | 183 |
| 408 | 3300046475 | Ga0495639_0170119 | Ga0495639_0170119_89_676 | 183 |
| 409 | 3300046477 | Ga0495664_0197485 | Ga0495664_0197485_29_583 | 183 |
| 410 | 3300046491 | Ga0495584_0370082 | Ga0495584_0370082_125_715 | 183 |
| 411 | 3300046492 | Ga0495585_0217728 | Ga0495585_0217728_178_732 | 183 |
| 412 | 3300046506 | Ga0495583_0000003 | Ga0495583_0000003_615446_616018 | 183 |
| 413 | 3300046507 | Ga0495606_0013252 | Ga0495606_0013252_1771_2343 | 183 |
| 414 | 3300046507 | Ga0495606_0056313 | Ga0495606_0056313_172_726 | 183 |
| 415 | 3300046507 | Ga0495606_0252638 | Ga0495606_0252638_32_598 | 183 |
| 416 | 3300046512 | Ga0495610_0000179 | Ga0495610_0000179_14594_15166 | 183 |
| 417 | 3300046512 | Ga0495610_0008936 | Ga0495610_0008936_1319_1888 | 183 |
| 418 | 3300046513 | Ga0495616_0031655 | Ga0495616_0031655_600_1172 | 183 |
| 419 | 3300046515 | Ga0495620_0076779 | Ga0495620_0076779_130_720 | 183 |
| 420 | 3300046520 | Ga0495637_0002909 | Ga0495637_0002909_1595_2167 | 183 |
| 421 | 3300046522 | Ga0495643_0160463 | Ga0495643_0160463_209_799 | 183 |
| 422 | 3300046524 | Ga0495648_0114818 | Ga0495648_0114818_311_883 | 183 |
| 423 | 3300046528 | Ga0495642_0010307 | Ga0495642_0010307_1357_1911 | 183 |
| 424 | 3300046528 | Ga0495642_0077509 | Ga0495642_0077509_627_1181 | 183 |
| 425 | 3300046531 | Ga0495665_0158977 | Ga0495665_0158977_542_1096 | 183 |
| 426 | 3300046538 | Ga0495609_0027662 | Ga0495609_0027662_67_657 | 183 |
| 427 | 3300046539 | Ga0495621_0029202 | Ga0495621_0029202_302_856 | 183 |
| 428 | 3300046542 | Ga0495597_0006922 | Ga0495597_0006922_3001_3591 | 183 |
| 429 | 3300046542 | Ga0495597_0050110 | Ga0495597_0050110_1209_1760 | 183 |
| 430 | 3300046557 | Ga0495622_0006369 | Ga0495622_0006369_2333_2899 | 183 |
| 431 | 3300046616 | Ga0495668_0024376 | Ga0495668_0024376_2789_3343 | 183 |
| 432 | 3300046616 | Ga0495668_0063554 | Ga0495668_0063554_793_1347 | 183 |
| 433 | 3300046616 | Ga0495668_0127685 | Ga0495668_0127685_756_1307 | 183 |
| 434 | 3300046616 | Ga0495668_0137242 | Ga0495668_0137242_247_819 | 183 |
| 435 | 3300046616 | Ga0495668_0618786 | Ga0495668_0618786_24_578 | 183 |
| 436 | 3300046648 | Ga0495611_0001327 | Ga0495611_0001327_330_884 | 183 |
| 437 | 3300046648 | Ga0495611_0105737 | Ga0495611_0105737_184_774 | 183 |
| 438 | 3300046660 | Ga0495625_0000034 | Ga0495625_0000034_105095_105667 | 183 |
| 439 | 3300046660 | Ga0495625_0000795 | Ga0495625_0000795_5298_5885 | 183 |
| 440 | 3300046660 | Ga0495625_0012684 | Ga0495625_0012684_1663_2235 | 183 |
| 441 | 3300046660 | Ga0495625_0146514 | Ga0495625_0146514_707_1294 | 183 |
| 442 | 3300046660 | Ga0495625_0154648 | Ga0495625_0154648_869_1441 | 183 |
| 443 | 3300046660 | Ga0495625_0205110 | Ga0495625_0205110_359_910 | 183 |
| 444 | 3300046660 | Ga0495625_0625649 | Ga0495625_0625649_33_587 | 183 |
| 445 | 3300046684 | Ga0495669_0006159 | Ga0495669_0006159_665_1219 | 183 |
| 446 | 3300046684 | Ga0495669_0071002 | Ga0495669_0071002_307_861 | 183 |
| 447 | 3300046689 | Ga0495613_0313372 | Ga0495613_0313372_305_859 | 183 |
| 448 | 3300046690 | Ga0495624_0296258 | Ga0495624_0296258_94_660 | 183 |
| 449 | 3300046694 | Ga0495649_0304497 | Ga0495649_0304497_31_621 | 183 |
| 450 | 3300046794 | Ga0495589_0007108 | Ga0495589_0007108_2309_2881 | 183 |
| 451 | 3300047315 | Ga0495581_0504765 | Ga0495581_0504765_102_656 | 183 |
| 452 | 3300047315 | Ga0495581_0522648 | Ga0495581_0522648_106_669 | 183 |
| 453 | 3300047443 | Ga0495687_018449 | Ga0495687_018449_1309_1899 | 183 |
| 454 | 3300047445 | Ga0495677_0023234 | Ga0495677_0023234_1184_1738 | 183 |
| 455 | 3300047469 | Ga0495673_0000053 | Ga0495673_0000053_45987_46559 | 183 |
| 456 | 3300047469 | Ga0495673_0011591 | Ga0495673_0011591_398_970 | 183 |
| 457 | 3300047470 | Ga0495681_0043875 | Ga0495681_0043875_1337_1924 | 183 |
| 458 | 3300047470 | Ga0495681_0084032 | Ga0495681_0084032_156_710 | 183 |
| 459 | 3300047472 | Ga0495686_0008203 | Ga0495686_0008203_4692_5243 | 183 |
| 460 | 3300047472 | Ga0495686_0018102 | Ga0495686_0018102_4128_4700 | 183 |
| 461 | 3300047472 | Ga0495686_0035394 | Ga0495686_0035394_379_951 | 183 |
| 462 | 3300047472 | Ga0495686_0056673 | Ga0495686_0056673_659_1222 | 183 |
| 463 | 3300047472 | Ga0495686_0205512 | Ga0495686_0205512_33_587 | 183 |
| 464 | 3300047673 | Ga0495593_0067701 | Ga0495593_0067701_815_1402 | 183 |
| 465 | 3300048088 | Ga0495602_0488115 | Ga0495602_0488115_223_813 | 183 |
| 466 | 3300048903 | Ga0496100_0266932 | Ga0496100_0266932_464_1018 | 183 |
| 467 | 3300048904 | Ga0496101_0055659 | Ga0496101_0055659_33_602 | 183 |
| 468 | 3300048904 | Ga0496101_0167922 | Ga0496101_0167922_659_1213 | 183 |
| 469 | 3300048905 | Ga0496102_0050829 | Ga0496102_0050829_2274_2828 | 183 |
| 470 | 3300048906 | Ga0496103_0023950 | Ga0496103_0023950_287_841 | 183 |
| 471 | 3300048907 | Ga0496104_0178039 | Ga0496104_0178039_285_839 | 183 |
| 472 | 3300048909 | Ga0496106_0012556 | Ga0496106_0012556_3047_3616 | 183 |
| 473 | 3300048909 | Ga0496106_0104384 | Ga0496106_0104384_490_1044 | 183 |
| 474 | 3300048909 | Ga0496106_0282527 | Ga0496106_0282527_702_1256 | 183 |
| 475 | 3300048910 | Ga0496107_0000034 | Ga0496107_0000034_75775_76344 | 183 |
| 476 | 3300048911 | Ga0496108_0057239 | Ga0496108_0057239_1795_2349 | 183 |
| 477 | 3300048912 | Ga0496109_0113056 | Ga0496109_0113056_964_1518 | 183 |
| 478 | 3300048915 | Ga0496112_0019671 | Ga0496112_0019671_2270_2824 | 183 |
| 479 | 3300048916 | Ga0496113_0294046 | Ga0496113_0294046_624_1178 | 183 |
| 480 | 3300048918 | Ga0496115_0001261 | Ga0496115_0001261_16154_16711 | 183 |
| 481 | 3300048918 | Ga0496115_0259596 | Ga0496115_0259596_578_1135 | 183 |
| 482 | 3300048918 | Ga0496115_0682936 | Ga0496115_0682936_183_740 | 183 |
| 483 | 3300048924 | Ga0496121_0004814 | Ga0496121_0004814_3687_4256 | 183 |
| 484 | 3300048924 | Ga0496121_0160442 | Ga0496121_0160442_536_1108 | 183 |
| 485 | 3300048928 | Ga0496125_0112129 | Ga0496125_0112129_164_718 | 183 |
| 486 | 3300049570 | Ga0501033_0017057 | Ga0501033_0017057_3605_4159 | 183 |
| 487 | 3300049580 | Ga0501046_0433573 | Ga0501046_0433573_218_772 | 183 |
| 488 | 3300049581 | Ga0501047_0002950 | Ga0501047_0002950_1310_1864 | 183 |
| 489 | 3300049581 | Ga0501047_0030290 | Ga0501047_0030290_339_896 | 183 |
| 490 | 3300049581 | Ga0501047_0554708 | Ga0501047_0554708_300_854 | 183 |
| 491 | 3300049582 | Ga0501048_0297585 | Ga0501048_0297585_289_843 | 183 |
| 492 | 3300049671 | Ga0501238_000290 | Ga0501238_000290_2695_3264 | 183 |
| 493 | 3300049686 | Ga0501257_004222 | Ga0501257_004222_490_1047 | 183 |
| 494 | 3300049763 | Ga0501266_043111 | Ga0501266_043111_103_660 | 183 |
| 495 | 3300049822 | Ga0501035_0232942 | Ga0501035_0232942_828_1382 | 183 |
| 496 | 3300049823 | Ga0501044_0056897 | Ga0501044_0056897_1883_2437 | 183 |
| 497 | 3300049823 | Ga0501044_0519379 | Ga0501044_0519379_319_876 | 183 |
| 498 | 3300050493 | nmdc:mga0k408_201209_c1 | nmdc:mga0k408_201209_c1_465_1022 | 183 |
| 499 | 3300050496 | nmdc:mga07m45_156255_c1 | nmdc:mga07m45_156255_c1_538_1095 | 183 |
| 500 | 3300050496 | nmdc:mga07m45_71084_c1 | nmdc:mga07m45_71084_c1_1240_1794 | 183 |
| 501 | 3300053091 | Ga0500647_0072952 | Ga0500647_0072952_489_1043 | 183 |
| 502 | 3300053093 | Ga0500651_0143238 | Ga0500651_0143238_511_1077 | 183 |
| 503 | 3300053096 | Ga0500641_0005703 | Ga0500641_0005703_2633_3187 | 183 |
| 504 | 3300053102 | Ga0500554_002506 | Ga0500554_002506_1584_2156 | 183 |
| 505 | 3300053103 | Ga0500555_002319 | Ga0500555_002319_1985_2539 | 183 |
| 506 | 3300053103 | Ga0500555_048565 | Ga0500555_048565_543_1100 | 183 |
| 507 | 3300053104 | Ga0500556_0000401 | Ga0500556_0000401_11424_11996 | 183 |
| 508 | 3300053108 | Ga0500562_000596 | Ga0500562_000596_7925_8497 | 183 |
| 509 | 3300053108 | Ga0500562_002545 | Ga0500562_002545_104_658 | 183 |
| 510 | 3300053109 | Ga0500569_004229 | Ga0500569_004229_93_683 | 183 |
| 511 | 3300053117 | Ga0500593_196948 | Ga0500593_196948_137_709 | 183 |
| 512 | 3300053119 | Ga0500595_018095 | Ga0500595_018095_1182_1736 | 183 |
| 513 | 3300053119 | Ga0500595_022793 | Ga0500595_022793_1277_1867 | 183 |
| 514 | 3300053122 | Ga0500608_017132 | Ga0500608_017132_2465_3055 | 183 |
| 515 | 3300053123 | Ga0500614_002542 | Ga0500614_002542_2335_2925 | 183 |
| 516 | 3300053123 | Ga0500614_022524 | Ga0500614_022524_178_750 | 183 |
| 517 | 3300053131 | Ga0500652_000159 | Ga0500652_000159_10726_11289 | 183 |
| 518 | 3300053134 | Ga0500658_0001449 | Ga0500658_0001449_4348_4920 | 183 |
| 519 | 3300053134 | Ga0500658_0027186 | Ga0500658_0027186_128_718 | 183 |
| 520 | 3300053136 | Ga0500559_0012057 | Ga0500559_0012057_1652_2242 | 183 |
| 521 | 3300053148 | Ga0500590_008191 | Ga0500590_008191_370_960 | 183 |
| 522 | 3300053162 | Ga0500638_026644 | Ga0500638_026644_1897_2451 | 183 |
| 523 | 3300053177 | Ga0500636_0003540 | Ga0500636_0003540_164_718 | 183 |
| 524 | 3300053177 | Ga0500636_0029250 | Ga0500636_0029250_2475_3041 | 183 |
| 525 | 3300053725 | Ga0500576_058984 | Ga0500576_058984_1080_1646 | 183 |
| 526 | 3300053729 | Ga0500625_010904 | Ga0500625_010904_3102_3692 | 183 |
| 527 | 3300053730 | Ga0500645_000738 | Ga0500645_000738_4292_4843 | 183 |
| 528 | 3300053730 | Ga0500645_001858 | Ga0500645_001858_4811_5383 | 183 |
| 529 | 3300053732 | Ga0500656_006054 | Ga0500656_006054_358_912 | 183 |
| 530 | 3300060353 | Ga0501082_0912639 | Ga0501082_0912639_198_758 | 183 |
| 531 | iso_pu_bacteria | 2513237161 | 2514013543 | 183 |
| 532 | iso_pu_bacteria | 2922368715 | 2922372156 | 183 |
| 533 | iso_pu_bacteria | 2935665750 | 2935674612 | 183 |
| 534 | iso_pu_bacteria | 2935908558 | 2935914541 | 183 |
| 535 | iso_pu_bacteria | 2935926038 | 2935932079 | 183 |
| 536 | iso_pu_bacteria | 2935934488 | 2935940676 | 183 |
| 537 | iso_pu_bacteria | 2935942939 | 2935948737 | 183 |
| 538 | iso_pu_bacteria | 2935951376 | 2935957156 | 183 |
| 539 | iso_pu_bacteria | 2935967501 | 2935973872 | 183 |
| 540 | iso_pu_bacteria | 3000405567 | 3000408218 | 183 |
| 541 | iso_pu_bacteria | 8019619141 | 8019626151 | 183 |
| 542 | iso_pu_bacteria | 8019687851 | 8019688045 | 183 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ixk-assembly1.cif.gz_B | rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) | 0.9756 | 2 | 177 |
| 3ryk-assembly1.cif.gz_B | 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound | 0.9711 | 2 | 174 |
| 7pvi-assembly1.cif.gz_BBB | dtdp-sugar epimerase | 0.9693 | 2 | 177 |
| 6din-assembly1.cif.gz_A-2 | high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase | 0.9657 | 1 | 177 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9643 | 1 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.965 | 2 | 177 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9578 | 2 | 174 | 2.60.120.10 |
| 2b9uD00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9514 | 2 | 177 | 2.60.120.10 |
| 1epzA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9497 | 2 | 183 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9397 | 1 | 177 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3CCT1-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9861 | 2 | 178 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A1G5QZS5-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9856 | 1 | 177 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A7X8CSM9-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9854 | 1 | 176 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A1G0UV91-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9854 | 42 | 178 |
GO:0000271
GO:0005829 GO:0008830 GO:0019305 |
| AF-A0A0J7NA76-F1-model_v4 | Dtdp-4-dehydrorhamnose-epimerase | 0.9845 | 42 | 182 |
GO:0000271
GO:0005829 GO:0008830 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar