F461507

General Info

Members Datasets Scaffolds Average Seq Length
542 311 518 184

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0051281|Ga0373926_0051281_69_725
Length 218
Sequence MTQTLTAGGGPGAWALSSLVGCAMRQLHPHRWNRMTTITSLPLTEVLLITPKRHGDARGWFTETWSRRAMLEAGVDCDFVQDNQAFNARAGTVRGLHFQKAPHPQAKLLRVLRGVIFDVAVDVRPGSPTFGQWVGAELSAERGEQLFIPRGFAHGYSTLTDDCELAYKVDGLYAPQTEGGVIWNDPDLAIDWRIEGEPILSDKDQALPRLKDLEPLSF

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
4 2643221583 Caulobacter sp. Root655 Isolate Unclassified
5 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
6 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
7 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
8 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
9 2849560528 Caulobacter zeae 410 Isolate Unclassified
10 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
11 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
12 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
13 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
14 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
15 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
16 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
17 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
18 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
19 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
20 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
138 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
163 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
276 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
277 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
287 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
290 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
291 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
292 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
293 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
294 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
295 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
296 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
297 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
298 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
302 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
303 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
304 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
305 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
306 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
307 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
310 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
311 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 0.18
Isolates 4.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.7
Nodule 2.4
Rhizoplane 3.87
Rhizosphere 78.97
Stem 0
Stem Tuber 0
Unclassified 4.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10010452 3300003215 Bacteria 4195
2 Ga0055537_1002437 3300003773 Bacteria 6251
3 Ga0055524_1004355 3300003775 Bacteria 6548
4 Ga0055528_1029862 3300003790 Bacteria 1461
5 Ga0055530_10000035 3300003791 Bacteria 117598
6 Ga0055530_10000788 3300003791 Bacteria 26395
7 Ga0055531_10001105 3300003794 Bacteria 21012
8 Ga0065165_1000688 3300005262 Bacteria 48324
9 Ga0070683_101388295 3300005329 Bacteria 675
10 Ga0070670_100000022 3300005331 Bacteria 199146
11 Ga0070670_100386869 3300005331 Bacteria 1233
12 Ga0070666_10017550 3300005335 Bacteria 4589
13 Ga0068868_100884338 3300005338 Bacteria 811
14 Ga0070660_100043678 3300005339 Bacteria 3426
15 Ga0070689_100518674 3300005340 Bacteria 1023
16 Ga0070687_100587535 3300005343 Bacteria 763
17 Ga0070661_100467991 3300005344 Bacteria 1005
18 Ga0070668_100000710 3300005347 Bacteria 22777
19 Ga0070668_100008045 3300005347 Bacteria 7832
20 Ga0070669_100166745 3300005353 Bacteria 1715
21 Ga0070669_100312166 3300005353 Bacteria 1268
22 Ga0070669_100318013 3300005353 Bacteria 1256
23 Ga0070671_100103039 3300005355 Bacteria 2394
24 Ga0070671_100344206 3300005355 Bacteria 1272
25 Ga0070674_100447700 3300005356 Bacteria 1065
26 Ga0070673_100126633 3300005364 Bacteria 2138
27 Ga0070659_100002748 3300005366 Bacteria 12524
28 Ga0070667_100005071 3300005367 Bacteria 11023
29 Ga0070667_100014322 3300005367 Bacteria 6554
30 Ga0070667_100014757 3300005367 Bacteria 6455
31 Ga0070662_100633264 3300005457 Bacteria 901
32 Ga0070681_10014375 3300005458 Bacteria 7877
33 Ga0070707_101109756 3300005468 Bacteria 757
34 Ga0068853_100472392 3300005539 Bacteria 1181
35 Ga0070665_100001038 3300005548 Bacteria 34790
36 Ga0070665_100047790 3300005548 Bacteria 4295
37 Ga0070665_100348560 3300005548 Bacteria 1486
38 Ga0070704_100043095 3300005549 Bacteria 3126
39 Ga0068856_101875578 3300005614 Bacteria 611
40 Ga0068859_100000681 3300005617 Bacteria 34110
41 Ga0068859_100003103 3300005617 Bacteria 16870
42 Ga0068859_100050876 3300005617 Bacteria 4163
43 Ga0068859_100173053 3300005617 Bacteria 2241
44 Ga0068864_100000125 3300005618 Bacteria 74686
45 Ga0068864_100000418 3300005618 Bacteria 36672
46 Ga0068864_100001709 3300005618 Bacteria 18031
47 Ga0068864_100718175 3300005618 Bacteria 977
48 Ga0068861_100014450 3300005719 Bacteria 5542
49 Ga0068861_100251115 3300005719 Bacteria 1509
50 Ga0068861_100563609 3300005719 Bacteria 1040
51 Ga0068863_100000066 3300005841 Bacteria 117816
52 Ga0068863_100000486 3300005841 Bacteria 40496
53 Ga0068863_100024022 3300005841 Bacteria 5818
54 Ga0068863_100112359 3300005841 Bacteria 2594
55 Ga0068863_100178115 3300005841 Bacteria 2041
56 Ga0068863_100456086 3300005841 Bacteria 1255
57 Ga0068858_100000136 3300005842 Bacteria 77380
58 Ga0068858_100003656 3300005842 Bacteria 15224
59 Ga0068858_100095484 3300005842 Bacteria 2770
60 Ga0068860_100000066 3300005843 Bacteria 182836
61 Ga0068860_100000136 3300005843 Bacteria 120083
62 Ga0068860_100011612 3300005843 Bacteria 8687
63 Ga0068862_100001264 3300005844 Bacteria 23790
64 Ga0068862_100022276 3300005844 Bacteria 5298
65 Ga0068862_100041185 3300005844 Bacteria 3930
66 Ga0068862_100063982 3300005844 Bacteria 3165
67 Ga0075363_100564227 3300006048 Bacteria 680
68 Ga0075366_10173624 3300006195 Bacteria 1308
69 Ga0075370_10147269 3300006353 Bacteria 1379
70 Ga0068871_100167640 3300006358 Bacteria 1881
71 Ga0068865_100894772 3300006881 Bacteria 772
72 Ga0097620_100000681 3300006931 Bacteria 34110
73 Ga0097620_100003103 3300006931 Bacteria 16870
74 Ga0097620_100050876 3300006931 Bacteria 4163
75 Ga0097620_100173061 3300006931 Bacteria 2241
76 Ga0105250_10194769 3300009092 Bacteria 854
77 Ga0105240_10098535 3300009093 Bacteria 3559
78 Ga0105240_10594003 3300009093 Bacteria 1220
79 Ga0105240_10880117 3300009093 Bacteria 965
80 Ga0111539_10016877 3300009094 Bacteria 9042
81 Ga0111539_10987774 3300009094 Bacteria 979
82 Ga0105245_10060427 3300009098 Bacteria 3413
83 Ga0105245_10074157 3300009098 Bacteria 3096
84 Ga0105247_10123383 3300009101 Bacteria 1681
85 Ga0105247_10782554 3300009101 Bacteria 726
86 Ga0105241_10780202 3300009174 Bacteria 879
87 Ga0105248_10002170 3300009177 Bacteria 21730
88 Ga0105248_10016699 3300009177 Bacteria 8080
89 Ga0105248_10028114 3300009177 Bacteria 6263
90 Ga0105248_10803756 3300009177 Bacteria 1061
91 Ga0105237_10300579 3300009545 Bacteria 1608
92 Ga0105238_10112245 3300009551 Bacteria 2705
93 Ga0105238_10128582 3300009551 Bacteria 2512
94 Ga0105238_10156461 3300009551 Bacteria 2254
95 Ga0105238_10483434 3300009551 Bacteria 1238
96 Ga0105238_10587282 3300009551 Bacteria 1121
97 Ga0105249_10000376 3300009553 Bacteria 44283
98 Ga0105249_10379628 3300009553 Bacteria 1439
99 Ga0099796_10021119 3300010159 Bacteria 2001
100 Ga0105239_10428647 3300010375 Bacteria 1499
101 Ga0157374_10003601 3300013296 Bacteria 13042
102 Ga0157374_10415412 3300013296 Bacteria 1343
103 Ga0157378_10000834 3300013297 Bacteria 28613
104 Ga0163162_10239247 3300013306 Bacteria 1946
105 Ga0163162_11238720 3300013306 Bacteria 847
106 Ga0157372_11050439 3300013307 Bacteria 943
107 Ga0157375_10344891 3300013308 Bacteria 1655
108 Ga0157375_11277334 3300013308 Bacteria 862
109 Ga0163163_10007905 3300014325 Bacteria 9402
110 Ga0163163_10065846 3300014325 Bacteria 3598
111 Ga0163163_10127627 3300014325 Bacteria 2582
112 Ga0182008_10475514 3300014497 Bacteria 683
113 Ga0157379_10003769 3300014968 Bacteria 12906
114 Ga0157379_10017570 3300014968 Bacteria 6296
115 Ga0157379_11078149 3300014968 Bacteria 769
116 Ga0157376_10485284 3300014969 Bacteria 1212
117 Ga0163161_10472031 3300017792 Unclassified 1017
118 Ga0206353_11902316 3300020082 Bacteria 679
119 Ga0228598_1000575 3300024227 Bacteria 7703
120 Ga0209026_1000567 3300025250 Bacteria 24901
121 Ga0209148_1022340 3300025254 Bacteria 1018
122 Ga0209565_1000090 3300025263 Bacteria 146540
123 Ga0209673_1001000 3300025273 Bacteria 34384
124 Ga0209675_1015077 3300025291 Bacteria 2315
125 Ga0209676_1000454 3300025292 Bacteria 69136
126 Ga0209564_1017317 3300025295 Bacteria 2816
127 Ga0209758_1000999 3300025297 Bacteria 37624
128 Ga0209758_1003056 3300025297 Bacteria 15909
129 Ga0209050_1000042 3300025298 Bacteria 402842
130 Ga0209050_1000867 3300025298 Bacteria 40877
131 Ga0209256_1002391 3300025299 Bacteria 15466
132 Ga0209256_1007405 3300025299 Bacteria 5420
133 Ga0209257_1000227 3300025304 Bacteria 133512
134 Ga0209257_1001860 3300025304 Bacteria 22903
135 Ga0209257_1047283 3300025304 Bacteria 1238
136 Ga0207697_10209006 3300025315 Bacteria 860
137 Ga0207680_10016182 3300025903 Bacteria 3909
138 Ga0207680_10106582 3300025903 Bacteria 1810
139 Ga0207705_10087935 3300025909 Bacteria 2272
140 Ga0207654_10185158 3300025911 Bacteria 1361
141 Ga0207707_10179768 3300025912 Bacteria 1847
142 Ga0207695_10003289 3300025913 Bacteria 22966
143 Ga0207695_10034543 3300025913 Bacteria 5497
144 Ga0207695_10182597 3300025913 Bacteria 2018
145 Ga0207671_10445990 3300025914 Bacteria 1030
146 Ga0207671_10732328 3300025914 Bacteria 786
147 Ga0207660_10479198 3300025917 Bacteria 1008
148 Ga0207660_10910018 3300025917 Bacteria 718
149 Ga0207657_10016726 3300025919 Bacteria 7063
150 Ga0207649_10424640 3300025920 Bacteria 999
151 Ga0207681_10009307 3300025923 Bacteria 6000
152 Ga0207681_10247103 3300025923 Bacteria 1391
153 Ga0207694_10147416 3300025924 Bacteria 1895
154 Ga0207694_10151763 3300025924 Bacteria 1867
155 Ga0207694_10152522 3300025924 Bacteria 1862
156 Ga0207694_10335147 3300025924 Bacteria 1250
157 Ga0207650_10000016 3300025925 Bacteria 361958
158 Ga0207650_10032724 3300025925 Bacteria 3762
159 Ga0207650_10100576 3300025925 Bacteria 2225
160 Ga0207690_10000496 3300025932 Bacteria 25421
161 Ga0207706_10075205 3300025933 Bacteria 2970
162 Ga0207665_10300291 3300025939 Bacteria 1200
163 Ga0207711_10009460 3300025941 Bacteria 8130
164 Ga0207711_10016203 3300025941 Bacteria 6188
165 Ga0207711_10042892 3300025941 Bacteria 3856
166 Ga0207711_10541998 3300025941 Bacteria 1085
167 Ga0207711_10636461 3300025941 Bacteria 995
168 Ga0207689_10111738 3300025942 Bacteria 2246
169 Ga0207689_10572412 3300025942 Bacteria 949
170 Ga0207651_10199458 3300025960 Bacteria 1602
171 Ga0207712_10000794 3300025961 Bacteria 23385
172 Ga0207668_10000117 3300025972 Bacteria 55600
173 Ga0207668_10051933 3300025972 Bacteria 2834
174 Ga0207668_10130149 3300025972 Bacteria 1920
175 Ga0207668_10142410 3300025972 Bacteria 1845
176 Ga0207640_10349578 3300025981 Bacteria 1187
177 Ga0207658_10002457 3300025986 Bacteria 13540
178 Ga0207658_10015009 3300025986 Bacteria 5311
179 Ga0207658_10416795 3300025986 Bacteria 1183
180 Ga0207658_10484179 3300025986 Bacteria 1100
181 Ga0207703_10000065 3300026035 Bacteria 126087
182 Ga0207703_10001304 3300026035 Bacteria 23078
183 Ga0207703_10127104 3300026035 Bacteria 2196
184 Ga0207703_10228732 3300026035 Bacteria 1666
185 Ga0207703_10265198 3300026035 Bacteria 1554
186 Ga0207639_10383163 3300026041 Bacteria 1263
187 Ga0207678_10288256 3300026067 Bacteria 1410
188 Ga0207678_11199536 3300026067 Bacteria 672
189 Ga0207641_10000011 3300026088 Bacteria 384362
190 Ga0207641_10001896 3300026088 Bacteria 20073
191 Ga0207641_10009570 3300026088 Bacteria 7984
192 Ga0207641_10017742 3300026088 Bacteria 5831
193 Ga0207676_10000055 3300026095 Bacteria 124678
194 Ga0207676_10000450 3300026095 Bacteria 34793
195 Ga0207676_10003841 3300026095 Bacteria 10609
196 Ga0207676_10038403 3300026095 Bacteria 3654
197 Ga0207675_100022523 3300026118 Bacteria 5866
198 Ga0207675_100380753 3300026118 Bacteria 1387
199 Ga0209981_1000621 3300027378 Bacteria 4475
200 Ga0209999_1012440 3300027543 Bacteria 1542
201 Ga0207428_10320033 3300027907 Unclassified 1146
202 Ga0268266_10000003 3300028379 Bacteria 1701703
203 Ga0268266_10004304 3300028379 Bacteria 13704
204 Ga0268266_10137438 3300028379 Bacteria 2190
205 Ga0268266_10177101 3300028379 Bacteria 1939
206 Ga0268265_10001013 3300028380 Bacteria 25387
207 Ga0268265_10006946 3300028380 Bacteria 7658
208 Ga0268265_10052527 3300028380 Bacteria 3083
209 Ga0268265_10118524 3300028380 Bacteria 2176
210 Ga0268264_10000265 3300028381 Bacteria 92655
211 Ga0268264_10261873 3300028381 Bacteria 1611
212 Ga0268264_10889463 3300028381 Bacteria 893
213 Ga0265326_10008000 3300028558 Bacteria 3211
214 Ga0265319_1000301 3300028563 Bacteria 36705
215 Ga0265334_10090731 3300028573 Bacteria 1115
216 Ga0265318_10000122 3300028577 Bacteria 71971
217 Ga0265323_10008039 3300028653 Bacteria 4362
218 Ga0265323_10008563 3300028653 Bacteria 4215
219 Ga0265322_10090787 3300028654 Bacteria 868
220 Ga0307517_10006346 3300028786 Bacteria 17546
221 Ga0307515_10028618 3300028794 Bacteria 9465
222 Ga0307515_10242372 3300028794 Bacteria 1571
223 Ga0265338_10028732 3300028800 Bacteria 5537
224 Ga0265338_10061652 3300028800 Bacteria 3286
225 Ga0265338_10259079 3300028800 Bacteria 1279
226 Ga0265338_10269853 3300028800 Bacteria 1247
227 Ga0265338_10489968 3300028800 Bacteria 866
228 Ga0265338_10662690 3300028800 Bacteria 722
229 Ga0307511_10037163 3300030521 Bacteria 4213
230 Ga0265330_10033806 3300031235 Bacteria 2285
231 Ga0265332_10260304 3300031238 Bacteria 717
232 Ga0265320_10012449 3300031240 Bacteria 4947
233 Ga0265325_10046974 3300031241 Bacteria 2237
234 Ga0265329_10000720 3300031242 Bacteria 16786
235 Ga0265340_10033752 3300031247 Bacteria 2546
236 Ga0265331_10000028 3300031250 Bacteria 216539
237 Ga0265327_10044047 3300031251 Bacteria 2382
238 Ga0265316_10005586 3300031344 Bacteria 12190
239 Ga0265316_10021205 3300031344 Bacteria 5511
240 Ga0265316_10027007 3300031344 Bacteria 4764
241 Ga0265316_10051414 3300031344 Bacteria 3237
242 Ga0307513_10000100 3300031456 Bacteria 125183
243 Ga0307513_10009312 3300031456 Bacteria 12435
244 Ga0307513_10010426 3300031456 Bacteria 11648
245 Ga0307408_100092015 3300031548 Bacteria 2292
246 Ga0316575_10000800 3300031665 Bacteria 9520
247 Ga0316575_10049241 3300031665 Bacteria 1676
248 Ga0265314_10008476 3300031711 Bacteria 8799
249 Ga0265314_10032544 3300031711 Bacteria 3835
250 Ga0265314_10114437 3300031711 Bacteria 1709
251 Ga0265314_10248103 3300031711 Bacteria 1023
252 Ga0265342_10000161 3300031712 Bacteria 75750
253 Ga0265342_10059007 3300031712 Bacteria 2267
254 Ga0265342_10237177 3300031712 Bacteria 977
255 Ga0307516_10000113 3300031730 Bacteria 93946
256 Ga0307414_10143181 3300032004 Bacteria 1875
257 Ga0307411_10179676 3300032005 Bacteria 1605
258 Ga0316583_10004608 3300032133 Bacteria 4917
259 Ga0316583_10073615 3300032133 Bacteria 1195
260 Ga0307510_10003321 3300033180 Bacteria 18743
261 Ga0373926_0004859 3300035083 Bacteria 4418
262 Ga0373926_0051281 3300035083 Bacteria 1488
263 Ga0373944_0005748 3300035089 Bacteria 3275
264 Ga0373923_0002249 3300035111 Bacteria 5878
265 Ga0373936_0103086 3300035113 Bacteria 1205
266 Ga0373936_0274987 3300035113 Bacteria 756
267 Ga0373954_0072347 3300035118 Bacteria 1640
268 Ga0373943_0443248 3300035170 Bacteria 754
269 Ga0373946_0015865 3300035171 Bacteria 2863
270 Ga0373946_0026778 3300035171 Bacteria 2277
271 Ga0373955_0091267 3300035172 Bacteria 1736
272 Ga0316574_0095520 3300035398 Unclassified 1899
273 Ga0316574_0109912 3300035398 Unclassified 1767
274 Ga0373935_0161776 3300035692 Bacteria 1526
275 Ga0373927_0000173 3300035695 Bacteria 50996
276 Ga0373927_0003596 3300035695 Bacteria 11052
277 Ga0373933_0381710 3300035724 Bacteria 918
278 Ga0373947_0021564 3300035725 Bacteria 3729
279 Ga0373947_0061490 3300035725 Bacteria 2283
280 Ga0373937_0031018 3300036401 Bacteria 4840
281 Ga0373925_0000049 3300037068 Bacteria 128065
282 Ga0373925_0117844 3300037068 Bacteria 2058
283 Ga0395899_0000115 3300037312 Bacteria 133287
284 Ga0395899_0057825 3300037312 Bacteria 2861
285 Ga0395899_0177013 3300037312 Bacteria 1499
286 Ga0395900_0000002 3300037418 Bacteria 671103
287 Ga0395900_0230583 3300037418 Bacteria 1862
288 Ga0395900_0372942 3300037418 Bacteria 1396
289 Ga0395898_0008120 3300037466 Bacteria 11111
290 Ga0395898_0809466 3300037466 Bacteria 877
291 Ga0395905_0021615 3300037471 Bacteria 6085
292 Ga0395905_0265671 3300037471 Bacteria 1601
293 Ga0395905_0550337 3300037471 Bacteria 1055
294 Ga0395905_0570213 3300037471 Bacteria 1033
295 Ga0395905_0598089 3300037471 Bacteria 1005
296 Ga0395901_0000021 3300038443 Bacteria 307734
297 Ga0395901_0340827 3300038443 Bacteria 1549
298 Ga0395901_0456930 3300038443 Bacteria 1305
299 Ga0436365_0820477 3300039437 Bacteria 2654
300 Ga0436361_0340319 3300039447 Bacteria 976
301 Ga0439445_0115495 3300042004 Bacteria 768
302 Ga0453684_0007109 3300044712 Bacteria 20863
303 Ga0495592_0008377 3300046454 Bacteria 7755
304 Ga0495592_0135940 3300046454 Bacteria 1715
305 Ga0495629_0153650 3300046459 Bacteria 1599
306 Ga0495638_0000293 3300046460 Bacteria 65718
307 Ga0495638_0000996 3300046460 Bacteria 28464
308 Ga0495638_0001207 3300046460 Bacteria 24665
309 Ga0495651_0000564 3300046462 Bacteria 28657
310 Ga0495651_0001572 3300046462 Bacteria 17661
311 Ga0495651_0013435 3300046462 Bacteria 6332
312 Ga0495653_0036579 3300046463 Bacteria 3865
313 Ga0495653_0157783 3300046463 Bacteria 1578
314 Ga0495650_0060642 3300046471 Bacteria 1518
315 Ga0495650_0097678 3300046471 Bacteria 1107
316 Ga0495580_0065697 3300046472 Bacteria 2540
317 Ga0495639_0170119 3300046475 Bacteria 1057
318 Ga0495664_0027415 3300046477 Bacteria 3321
319 Ga0495664_0027998 3300046477 Bacteria 3289
320 Ga0495664_0072559 3300046477 Bacteria 2057
321 Ga0495664_0197485 3300046477 Bacteria 1219
322 Ga0495584_0370082 3300046491 Bacteria 728
323 Ga0495585_0217728 3300046492 Bacteria 965
324 Ga0495594_0110543 3300046499 Bacteria 1550
325 Ga0495583_0000003 3300046506 Bacteria 709273
326 Ga0495606_0013252 3300046507 Bacteria 6537
327 Ga0495606_0056313 3300046507 Bacteria 2539
328 Ga0495606_0252638 3300046507 Bacteria 977
329 Ga0495608_0167544 3300046511 Bacteria 1394
330 Ga0495610_0000179 3300046512 Bacteria 70587
331 Ga0495610_0008936 3300046512 Bacteria 6412
332 Ga0495616_0031655 3300046513 Bacteria 2768
333 Ga0495618_0172506 3300046514 Bacteria 1376
334 Ga0495618_0323363 3300046514 Bacteria 955
335 Ga0495620_0076779 3300046515 Bacteria 1357
336 Ga0495628_0000524 3300046516 Bacteria 35187
337 Ga0495628_0019538 3300046516 Bacteria 5599
338 Ga0495628_0038837 3300046516 Bacteria 3808
339 Ga0495630_0045302 3300046517 Bacteria 3286
340 Ga0495630_0127253 3300046517 Bacteria 1934
341 Ga0495630_0247434 3300046517 Bacteria 1362
342 Ga0495637_0002909 3300046520 Bacteria 9256
343 Ga0495643_0160463 3300046522 Bacteria 1106
344 Ga0495648_0114818 3300046524 Bacteria 1458
345 Ga0495666_0011645 3300046526 Bacteria 4385
346 Ga0495642_0010307 3300046528 Bacteria 3579
347 Ga0495642_0077509 3300046528 Bacteria 1396
348 Ga0495652_0002166 3300046529 Bacteria 20646
349 Ga0495652_0004359 3300046529 Bacteria 13542
350 Ga0495665_0000718 3300046531 Bacteria 17120
351 Ga0495665_0125218 3300046531 Bacteria 1346
352 Ga0495665_0158977 3300046531 Bacteria 1178
353 Ga0495640_0028261 3300046533 Unclassified 4039
354 Ga0495640_0120869 3300046533 Bacteria 1703
355 Ga0495586_0001155 3300046535 Bacteria 14771
356 Ga0495587_0000766 3300046536 Bacteria 21421
357 Ga0495587_0106551 3300046536 Bacteria 1612
358 Ga0495609_0027662 3300046538 Bacteria 2590
359 Ga0495621_0029202 3300046539 Bacteria 1879
360 Ga0495597_0006922 3300046542 Bacteria 5816
361 Ga0495597_0050110 3300046542 Bacteria 1844
362 Ga0495645_0012695 3300046543 Bacteria 5942
363 Ga0495645_0089849 3300046543 Bacteria 2196
364 Ga0495622_0006369 3300046557 Bacteria 5479
365 Ga0495667_0000245 3300046559 Bacteria 35362
366 Ga0495667_0005502 3300046559 Bacteria 8558
367 Ga0495667_0024974 3300046559 Bacteria 4026
368 Ga0495668_0024376 3300046616 Bacteria 3442
369 Ga0495668_0063554 3300046616 Bacteria 2033
370 Ga0495668_0127685 3300046616 Bacteria 1392
371 Ga0495668_0137242 3300046616 Bacteria 1339
372 Ga0495668_0618786 3300046616 Bacteria 598
373 Ga0495634_0163469 3300046642 Unclassified 1402
374 Ga0495634_0381504 3300046642 Bacteria 840
375 Ga0495611_0001327 3300046648 Bacteria 12555
376 Ga0495611_0105737 3300046648 Bacteria 1309
377 Ga0495625_0000034 3300046660 Bacteria 225120
378 Ga0495625_0000795 3300046660 Bacteria 43736
379 Ga0495625_0012684 3300046660 Bacteria 6815
380 Ga0495625_0146514 3300046660 Bacteria 1589
381 Ga0495625_0154648 3300046660 Bacteria 1540
382 Ga0495625_0205110 3300046660 Bacteria 1299
383 Ga0495625_0625649 3300046660 Bacteria 643
384 Ga0495635_0004923 3300046663 Bacteria 9296
385 Ga0495657_0018971 3300046675 Bacteria 4968
386 Ga0495657_0040776 3300046675 Bacteria 3182
387 Ga0495657_0180765 3300046675 Bacteria 1295
388 Ga0495599_0023104 3300046678 Bacteria 3886
389 Ga0495599_0078449 3300046678 Bacteria 2062
390 Ga0495623_0003980 3300046679 Bacteria 9725
391 Ga0495623_0033400 3300046679 Unclassified 3302
392 Ga0495646_0003817 3300046680 Bacteria 9420
393 Ga0495646_0112935 3300046680 Bacteria 1545
394 Ga0495669_0006159 3300046684 Bacteria 5004
395 Ga0495669_0071002 3300046684 Bacteria 1587
396 Ga0495613_0125995 3300046689 Bacteria 1837
397 Ga0495613_0313372 3300046689 Bacteria 1084
398 Ga0495624_0004988 3300046690 Bacteria 9616
399 Ga0495624_0296258 3300046690 Bacteria 976
400 Ga0495624_0314881 3300046690 Bacteria 943
401 Ga0495649_0304497 3300046694 Bacteria 811
402 Ga0495589_0007108 3300046794 Bacteria 5867
403 Ga0495600_0022165 3300046809 Bacteria 4076
404 Ga0495600_0061032 3300046809 Bacteria 2462
405 Ga0495581_0504765 3300047315 Bacteria 703
406 Ga0495581_0522648 3300047315 Bacteria 689
407 Ga0495604_0009221 3300047317 Bacteria 7812
408 Ga0495674_0005320 3300047319 Bacteria 12347
409 Ga0495674_0027438 3300047319 Bacteria 5204
410 Ga0495674_0484661 3300047319 Bacteria 991
411 Ga0495676_0026132 3300047321 Bacteria 5030
412 Ga0495680_0000371 3300047322 Bacteria 50251
413 Ga0495680_0111886 3300047322 Bacteria 2023
414 Ga0495687_018449 3300047443 Bacteria 3449
415 Ga0495675_0000236 3300047444 Bacteria 39933
416 Ga0495675_0199468 3300047444 Bacteria 1218
417 Ga0495675_0322541 3300047444 Bacteria 913
418 Ga0495677_0023234 3300047445 Bacteria 2251
419 Ga0495673_0000053 3300047469 Bacteria 254433
420 Ga0495673_0011591 3300047469 Bacteria 4731
421 Ga0495681_0043875 3300047470 Bacteria 2153
422 Ga0495681_0084032 3300047470 Bacteria 1416
423 Ga0495684_0014989 3300047471 Bacteria 5970
424 Ga0495684_0024884 3300047471 Bacteria 4604
425 Ga0495684_0341397 3300047471 Unclassified 1066
426 Ga0495686_0000779 3300047472 Bacteria 41840
427 Ga0495686_0008203 3300047472 Bacteria 7707
428 Ga0495686_0018102 3300047472 Bacteria 4733
429 Ga0495686_0035394 3300047472 Bacteria 3210
430 Ga0495686_0056673 3300047472 Bacteria 2448
431 Ga0495686_0205512 3300047472 Bacteria 1128
432 Ga0495593_0010500 3300047673 Bacteria 5344
433 Ga0495593_0067701 3300047673 Bacteria 1859
434 Ga0495602_0020653 3300048088 Bacteria 6504
435 Ga0495602_0057608 3300048088 Bacteria 3407
436 Ga0495602_0137989 3300048088 Bacteria 1934
437 Ga0495602_0488115 3300048088 Bacteria 863
438 Ga0495614_0003221 3300048089 Bacteria 7293
439 Ga0496100_0266932 3300048903 Bacteria 1271
440 Ga0496101_0055659 3300048904 Bacteria 2858
441 Ga0496101_0167922 3300048904 Bacteria 1685
442 Ga0496101_0213658 3300048904 Bacteria 1495
443 Ga0496102_0050829 3300048905 Bacteria 3775
444 Ga0496103_0023950 3300048906 Bacteria 3683
445 Ga0496104_0178039 3300048907 Bacteria 2036
446 Ga0496106_0012556 3300048909 Bacteria 6254
447 Ga0496106_0104384 3300048909 Bacteria 2201
448 Ga0496106_0282527 3300048909 Bacteria 1330
449 Ga0496106_0421215 3300048909 Bacteria 1073
450 Ga0496107_0000034 3300048910 Bacteria 91621
451 Ga0496108_0057239 3300048911 Bacteria 3276
452 Ga0496109_0113056 3300048912 Bacteria 2525
453 Ga0496112_0019671 3300048915 Bacteria 6379
454 Ga0496112_0310109 3300048915 Bacteria 1523
455 Ga0496113_0294046 3300048916 Bacteria 1300
456 Ga0496115_0001261 3300048918 Bacteria 18161
457 Ga0496115_0009461 3300048918 Bacteria 7239
458 Ga0496115_0259596 3300048918 Bacteria 1429
459 Ga0496115_0682936 3300048918 Bacteria 809
460 Ga0496121_0004814 3300048924 Bacteria 17781
461 Ga0496121_0160442 3300048924 Bacteria 1645
462 Ga0496125_0112129 3300048928 Bacteria 1971
463 Ga0501033_0017057 3300049570 Bacteria 5489
464 Ga0501040_0326033 3300049576 Bacteria 1099
465 Ga0501046_0138063 3300049580 Bacteria 1846
466 Ga0501046_0433573 3300049580 Bacteria 946
467 Ga0501047_0002950 3300049581 Bacteria 16124
468 Ga0501047_0030290 3300049581 Bacteria 5218
469 Ga0501047_0554708 3300049581 Bacteria 973
470 Ga0501048_0297585 3300049582 Bacteria 1148
471 Ga0501071_0310538 3300049587 Bacteria 1196
472 Ga0501072_0186359 3300049588 Bacteria 1655
473 Ga0501075_0136212 3300049591 Bacteria 1871
474 Ga0501238_000290 3300049671 Bacteria 6622
475 Ga0501238_000461 3300049671 Bacteria 4709
476 Ga0501257_004222 3300049686 Bacteria 3126
477 Ga0501266_043111 3300049763 Bacteria 677
478 Ga0501035_0232942 3300049822 Bacteria 1569
479 Ga0501044_0056897 3300049823 Bacteria 4014
480 Ga0501044_0519379 3300049823 Bacteria 1091
481 nmdc:mga0k408_201209_c1 3300050493 Bacteria 1189
482 nmdc:mga07m45_156255_c1 3300050496 Bacteria 1323
483 nmdc:mga07m45_71084_c1 3300050496 Bacteria 1980
484 nmdc:mga08y16_903916_c1 3300050511 Bacteria 869
485 nmdc:mga08y16_9776_c1 3300050511 Bacteria 10071
486 Ga0495601_0126346 3300053077 Bacteria 1663
487 Ga0495612_0002058 3300053078 Bacteria 8277
488 Ga0495619_0072552 3300053085 Bacteria 2306
489 Ga0500647_0072952 3300053091 Bacteria 1648
490 Ga0500651_0143238 3300053093 Bacteria 1439
491 Ga0500641_0005703 3300053096 Bacteria 4411
492 Ga0500554_002506 3300053102 Bacteria 3623
493 Ga0500555_002319 3300053103 Bacteria 5538
494 Ga0500555_048565 3300053103 Bacteria 1166
495 Ga0500556_0000401 3300053104 Bacteria 31673
496 Ga0500562_000596 3300053108 Bacteria 8682
497 Ga0500562_002545 3300053108 Bacteria 4545
498 Ga0500569_004229 3300053109 Bacteria 3006
499 Ga0500593_196948 3300053117 Bacteria 731
500 Ga0500595_018095 3300053119 Bacteria 2583
501 Ga0500595_022793 3300053119 Bacteria 2209
502 Ga0500608_017132 3300053122 Bacteria 3286
503 Ga0500614_002542 3300053123 Bacteria 4042
504 Ga0500614_022524 3300053123 Bacteria 1472
505 Ga0500652_000159 3300053131 Bacteria 26040
506 Ga0500658_0001449 3300053134 Bacteria 9497
507 Ga0500658_0027186 3300053134 Bacteria 2210
508 Ga0500559_0012057 3300053136 Bacteria 3681
509 Ga0500590_008191 3300053148 Bacteria 5205
510 Ga0500638_026644 3300053162 Bacteria 2771
511 Ga0500636_0003540 3300053177 Bacteria 8791
512 Ga0500636_0029250 3300053177 Bacteria 3254
513 Ga0500576_058984 3300053725 Bacteria 1684
514 Ga0500625_010904 3300053729 Bacteria 4112
515 Ga0500645_000738 3300053730 Bacteria 20146
516 Ga0500645_001858 3300053730 Bacteria 10118
517 Ga0500656_006054 3300053732 Bacteria 1215
518 Ga0501082_0912639 3300060353 Bacteria 768

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035083 Ga0373926_0004859 Ga0373926_0004859_389_895 161
2 3300035111 Ga0373923_0002249 Ga0373923_0002249_1824_2330 161
3 3300035113 Ga0373936_0274987 Ga0373936_0274987_77_583 161
4 3300035171 Ga0373946_0026778 Ga0373946_0026778_400_906 161
5 3300035172 Ga0373955_0091267 Ga0373955_0091267_653_1159 161
6 3300035695 Ga0373927_0003596 Ga0373927_0003596_8640_9146 161
7 3300035725 Ga0373947_0021564 Ga0373947_0021564_540_1046 161
8 3300036401 Ga0373937_0031018 Ga0373937_0031018_2559_3065 161
9 3300046454 Ga0495592_0008377 Ga0495592_0008377_2598_3104 161
10 3300046462 Ga0495651_0013435 Ga0495651_0013435_2903_3409 161
11 3300046463 Ga0495653_0036579 Ga0495653_0036579_3008_3514 161
12 3300046472 Ga0495580_0065697 Ga0495580_0065697_1347_1853 161
13 3300046477 Ga0495664_0027415 Ga0495664_0027415_1002_1508 161
14 3300046511 Ga0495608_0167544 Ga0495608_0167544_607_1113 161
15 3300046516 Ga0495628_0038837 Ga0495628_0038837_1830_2336 161
16 3300046529 Ga0495652_0004359 Ga0495652_0004359_8359_8865 161
17 3300046531 Ga0495665_0000718 Ga0495665_0000718_1611_2117 161
18 3300046535 Ga0495586_0001155 Ga0495586_0001155_10246_10752 161
19 3300046543 Ga0495645_0012695 Ga0495645_0012695_3530_4036 161
20 3300046559 Ga0495667_0005502 Ga0495667_0005502_1906_2412 161
21 3300046642 Ga0495634_0381504 Ga0495634_0381504_106_612 161
22 3300046663 Ga0495635_0004923 Ga0495635_0004923_3059_3565 161
23 3300046675 Ga0495657_0018971 Ga0495657_0018971_1666_2172 161
24 3300046678 Ga0495599_0023104 Ga0495599_0023104_3366_3872 161
25 3300046679 Ga0495623_0003980 Ga0495623_0003980_3756_4262 161
26 3300046680 Ga0495646_0003817 Ga0495646_0003817_3243_3749 161
27 3300046690 Ga0495624_0004988 Ga0495624_0004988_4126_4632 161
28 3300047317 Ga0495604_0009221 Ga0495604_0009221_3347_3853 161
29 3300047319 Ga0495674_0027438 Ga0495674_0027438_2919_3425 161
30 3300047321 Ga0495676_0026132 Ga0495676_0026132_2967_3473 161
31 3300047322 Ga0495680_0111886 Ga0495680_0111886_1174_1680 161
32 3300047444 Ga0495675_0199468 Ga0495675_0199468_197_703 161
33 3300047471 Ga0495684_0024884 Ga0495684_0024884_2903_3409 161
34 3300047673 Ga0495593_0010500 Ga0495593_0010500_586_1092 161
35 3300048088 Ga0495602_0020653 Ga0495602_0020653_2602_3108 161
36 3300048089 Ga0495614_0003221 Ga0495614_0003221_3313_3819 161
37 3300053077 Ga0495601_0126346 Ga0495601_0126346_210_716 161
38 3300053078 Ga0495612_0002058 Ga0495612_0002058_5570_6076 161
39 3300049576 Ga0501040_0326033 Ga0501040_0326033_402_914 168
40 3300049587 Ga0501071_0310538 Ga0501071_0310538_422_934 168
41 3300049588 Ga0501072_0186359 Ga0501072_0186359_373_885 168
42 3300049591 Ga0501075_0136212 Ga0501075_0136212_373_885 168
43 3300028800 Ga0265338_10269853 Ga0265338_102698532 169
44 3300031240 Ga0265320_10012449 Ga0265320_100124491 169
45 3300031247 Ga0265340_10033752 Ga0265340_100337521 169
46 3300031344 Ga0265316_10027007 Ga0265316_100270073 169
47 3300009098 Ga0105245_10074157 Ga0105245_100741573 174
48 3300009551 Ga0105238_10112245 Ga0105238_101122452 174
49 3300025924 Ga0207694_10147416 Ga0207694_101474162 174
50 3300047472 Ga0495686_0000779 Ga0495686_0000779_23094_23657 174
51 3300035398 Ga0316574_0109912 Ga0316574_0109912_1134_1667 176
52 3300046454 Ga0495592_0135940 Ga0495592_0135940_512_1063 176
53 3300046462 Ga0495651_0001572 Ga0495651_0001572_4470_5021 176
54 3300046463 Ga0495653_0157783 Ga0495653_0157783_1000_1551 176
55 3300046477 Ga0495664_0072559 Ga0495664_0072559_940_1491 176
56 3300046516 Ga0495628_0000524 Ga0495628_0000524_32835_33386 176
57 3300046517 Ga0495630_0247434 Ga0495630_0247434_476_1039 176
58 3300046529 Ga0495652_0002166 Ga0495652_0002166_296_847 176
59 3300046533 Ga0495640_0028261 Ga0495640_0028261_434_985 176
60 3300046536 Ga0495587_0000766 Ga0495587_0000766_18051_18602 176
61 3300046559 Ga0495667_0024974 Ga0495667_0024974_2247_2798 176
62 3300046675 Ga0495657_0040776 Ga0495657_0040776_494_1045 176
63 3300046678 Ga0495599_0078449 Ga0495599_0078449_1223_1774 176
64 3300046690 Ga0495624_0314881 Ga0495624_0314881_345_896 176
65 3300046809 Ga0495600_0022165 Ga0495600_0022165_3142_3693 176
66 3300047444 Ga0495675_0000236 Ga0495675_0000236_29025_29576 176
67 3300047471 Ga0495684_0014989 Ga0495684_0014989_450_1001 176
68 3300048088 Ga0495602_0057608 Ga0495602_0057608_1971_2522 176
69 3300053085 Ga0495619_0072552 Ga0495619_0072552_365_916 176
70 iso_pu_bacteria 2834578030 2834578614 177
71 iso_pu_bacteria 2899275550 2899276948 177
72 3300003791 Ga0055530_10000035 Ga0055530_100000359 178
73 3300005719 Ga0068861_100251115 Ga0068861_1002511152 178
74 3300009094 Ga0111539_10987774 Ga0111539_109877742 178
75 3300017792 Ga0163161_10472031 Ga0163161_104720312 178
76 3300025292 Ga0209676_1000454 Ga0209676_100045414 178
77 3300025298 Ga0209050_1000042 Ga0209050_100004291 178
78 3300025304 Ga0209257_1001860 Ga0209257_100186012 178
79 3300032005 Ga0307411_10179676 Ga0307411_101796762 178
80 3300044712 Ga0453684_0007109 Ga0453684_0007109_16588_17127 178
81 3300049671 Ga0501238_000461 Ga0501238_000461_1625_2182 178
82 3300050511 nmdc:mga08y16_903916_c1 nmdc:mga08y16_903916_c1_311_853 178
83 3300005549 Ga0070704_100043095 Ga0070704_1000430951 179
84 3300009093 Ga0105240_10880117 Ga0105240_108801171 179
85 3300009094 Ga0111539_10016877 Ga0111539_100168773 179
86 3300009098 Ga0105245_10060427 Ga0105245_100604273 179
87 3300009101 Ga0105247_10123383 Ga0105247_101233832 179
88 3300009545 Ga0105237_10300579 Ga0105237_103005792 179
89 3300010159 Ga0099796_10021119 Ga0099796_100211192 179
90 3300013296 Ga0157374_10003601 Ga0157374_1000360110 179
91 3300013297 Ga0157378_10000834 Ga0157378_100008346 179
92 3300014969 Ga0157376_10485284 Ga0157376_104852842 179
93 3300024227 Ga0228598_1000575 Ga0228598_10005755 179
94 3300025914 Ga0207671_10445990 Ga0207671_104459902 179
95 3300027907 Ga0207428_10320033 Ga0207428_103200331 179
96 3300028563 Ga0265319_1000301 Ga0265319_10003015 179
97 3300028577 Ga0265318_10000122 Ga0265318_1000012255 179
98 3300028653 Ga0265323_10008039 Ga0265323_100080395 179
99 3300028653 Ga0265323_10008563 Ga0265323_100085632 179
100 3300028654 Ga0265322_10090787 Ga0265322_100907872 179
101 3300028800 Ga0265338_10061652 Ga0265338_100616524 179
102 3300028800 Ga0265338_10259079 Ga0265338_102590792 179
103 3300031235 Ga0265330_10033806 Ga0265330_100338061 179
104 3300031238 Ga0265332_10260304 Ga0265332_102603041 179
105 3300031241 Ga0265325_10046974 Ga0265325_100469743 179
106 3300031242 Ga0265329_10000720 Ga0265329_100007205 179
107 3300031250 Ga0265331_10000028 Ga0265331_1000002830 179
108 3300031344 Ga0265316_10005586 Ga0265316_100055867 179
109 3300031344 Ga0265316_10021205 Ga0265316_100212053 179
110 3300031344 Ga0265316_10051414 Ga0265316_100514143 179
111 3300031665 Ga0316575_10000800 Ga0316575_100008004 179
112 3300031665 Ga0316575_10049241 Ga0316575_100492411 179
113 3300031711 Ga0265314_10032544 Ga0265314_100325444 179
114 3300031711 Ga0265314_10114437 Ga0265314_101144372 179
115 3300031711 Ga0265314_10248103 Ga0265314_102481032 179
116 3300031712 Ga0265342_10000161 Ga0265342_1000016128 179
117 3300031712 Ga0265342_10059007 Ga0265342_100590072 179
118 3300031712 Ga0265342_10237177 Ga0265342_102371772 179
119 3300032133 Ga0316583_10004608 Ga0316583_100046084 179
120 3300032133 Ga0316583_10073615 Ga0316583_100736152 179
121 3300035118 Ga0373954_0072347 Ga0373954_0072347_889_1449 179
122 3300035170 Ga0373943_0443248 Ga0373943_0443248_120_680 179
123 3300035398 Ga0316574_0095520 Ga0316574_0095520_1308_1859 179
124 3300035724 Ga0373933_0381710 Ga0373933_0381710_167_727 179
125 3300037471 Ga0395905_0598089 Ga0395905_0598089_12_563 179
126 3300046462 Ga0495651_0000564 Ga0495651_0000564_2243_2803 179
127 3300046477 Ga0495664_0027998 Ga0495664_0027998_2683_3243 179
128 3300046499 Ga0495594_0110543 Ga0495594_0110543_250_810 179
129 3300046514 Ga0495618_0172506 Ga0495618_0172506_128_688 179
130 3300046514 Ga0495618_0323363 Ga0495618_0323363_381_941 179
131 3300046516 Ga0495628_0019538 Ga0495628_0019538_2977_3537 179
132 3300046517 Ga0495630_0045302 Ga0495630_0045302_2375_2935 179
133 3300046517 Ga0495630_0127253 Ga0495630_0127253_1163_1723 179
134 3300046526 Ga0495666_0011645 Ga0495666_0011645_2883_3443 179
135 3300046531 Ga0495665_0125218 Ga0495665_0125218_617_1177 179
136 3300046533 Ga0495640_0120869 Ga0495640_0120869_528_1088 179
137 3300046536 Ga0495587_0106551 Ga0495587_0106551_764_1324 179
138 3300046543 Ga0495645_0089849 Ga0495645_0089849_546_1106 179
139 3300046559 Ga0495667_0000245 Ga0495667_0000245_15567_16127 179
140 3300046642 Ga0495634_0163469 Ga0495634_0163469_564_1124 179
141 3300046675 Ga0495657_0180765 Ga0495657_0180765_699_1259 179
142 3300046679 Ga0495623_0033400 Ga0495623_0033400_2133_2693 179
143 3300046680 Ga0495646_0112935 Ga0495646_0112935_816_1376 179
144 3300046689 Ga0495613_0125995 Ga0495613_0125995_346_906 179
145 3300046809 Ga0495600_0061032 Ga0495600_0061032_548_1108 179
146 3300047319 Ga0495674_0005320 Ga0495674_0005320_5030_5590 179
147 3300047319 Ga0495674_0484661 Ga0495674_0484661_326_946 179
148 3300047322 Ga0495680_0000371 Ga0495680_0000371_15949_16509 179
149 3300047444 Ga0495675_0322541 Ga0495675_0322541_206_766 179
150 3300047471 Ga0495684_0341397 Ga0495684_0341397_131_691 179
151 3300048088 Ga0495602_0137989 Ga0495602_0137989_951_1511 179
152 3300048915 Ga0496112_0310109 Ga0496112_0310109_185_745 179
153 3300050511 nmdc:mga08y16_9776_c1 nmdc:mga08y16_9776_c1_4787_5374 179
154 iso_pu_bacteria 2508501042 2508697711 179
155 iso_pu_bacteria 2510917020 2511123751 179
156 iso_pu_bacteria 2643221583 2643922518 179
157 iso_pu_bacteria 2849560528 2849561297 179
158 iso_pu_bacteria 2849573788 2849577332 179
159 iso_pu_bacteria 2936055302 2936063180 179
160 iso_pu_bacteria 8016630954 8016632929 179
161 3300026067 Ga0207678_11199536 Ga0207678_111995361 180
162 3300049580 Ga0501046_0138063 Ga0501046_0138063_657_1211 180
163 iso_pu_bacteria 2643221614 2644087404 180
164 iso_pu_bacteria 2643221661 2644344552 180
165 iso_pu_bacteria 2643221666 2644366764 180
166 3300005329 Ga0070683_101388295 Ga0070683_1013882951 181
167 3300025254 Ga0209148_1022340 Ga0209148_10223402 181
168 3300028558 Ga0265326_10008000 Ga0265326_100080003 181
169 3300028573 Ga0265334_10090731 Ga0265334_100907312 181
170 3300028800 Ga0265338_10028732 Ga0265338_100287324 181
171 3300028800 Ga0265338_10489968 Ga0265338_104899682 181
172 3300028800 Ga0265338_10662690 Ga0265338_106626902 181
173 3300031251 Ga0265327_10044047 Ga0265327_100440472 181
174 3300031711 Ga0265314_10008476 Ga0265314_100084762 181
175 3300048909 Ga0496106_0421215 Ga0496106_0421215_210_773 181
176 3300005339 Ga0070660_100043678 Ga0070660_1000436782 182
177 3300005353 Ga0070669_100166745 Ga0070669_1001667452 182
178 3300005355 Ga0070671_100103039 Ga0070671_1001030392 182
179 3300005366 Ga0070659_100002748 Ga0070659_1000027485 182
180 3300005367 Ga0070667_100014757 Ga0070667_1000147573 182
181 3300005614 Ga0068856_101875578 Ga0068856_1018755781 182
182 3300005617 Ga0068859_100000681 Ga0068859_10000068132 182
183 3300005719 Ga0068861_100563609 Ga0068861_1005636092 182
184 3300005841 Ga0068863_100024022 Ga0068863_1000240226 182
185 3300005844 Ga0068862_100041185 Ga0068862_1000411853 182
186 3300006048 Ga0075363_100564227 Ga0075363_1005642271 182
187 3300006931 Ga0097620_100000681 Ga0097620_1000006816 182
188 3300009093 Ga0105240_10098535 Ga0105240_100985353 182
189 3300009177 Ga0105248_10002170 Ga0105248_100021703 182
190 3300009551 Ga0105238_10128582 Ga0105238_101285822 182
191 3300014325 Ga0163163_10007905 Ga0163163_100079055 182
192 3300014968 Ga0157379_10003769 Ga0157379_100037695 182
193 3300025909 Ga0207705_10087935 Ga0207705_100879352 182
194 3300025914 Ga0207671_10732328 Ga0207671_107323281 182
195 3300025919 Ga0207657_10016726 Ga0207657_100167264 182
196 3300025923 Ga0207681_10009307 Ga0207681_100093076 182
197 3300025924 Ga0207694_10152522 Ga0207694_101525222 182
198 3300025932 Ga0207690_10000496 Ga0207690_1000049628 182
199 3300025941 Ga0207711_10009460 Ga0207711_100094605 182
200 3300025986 Ga0207658_10015009 Ga0207658_100150095 182
201 3300026035 Ga0207703_10127104 Ga0207703_101271043 182
202 3300026041 Ga0207639_10383163 Ga0207639_103831632 182
203 3300026088 Ga0207641_10009570 Ga0207641_100095707 182
204 3300026118 Ga0207675_100380753 Ga0207675_1003807532 182
205 3300028379 Ga0268266_10000003 Ga0268266_100000031184 182
206 3300028380 Ga0268265_10118524 Ga0268265_101185242 182
207 3300028381 Ga0268264_10261873 Ga0268264_102618732 182
208 3300046471 Ga0495650_0097678 Ga0495650_0097678_284_832 182
209 3300048904 Ga0496101_0213658 Ga0496101_0213658_107_658 182
210 3300048918 Ga0496115_0009461 Ga0496115_0009461_3850_4398 182
211 3300003215 JGI25153J46596_10010452 JGI25153J46596_100104523 183
212 3300003773 Ga0055537_1002437 Ga0055537_10024374 183
213 3300003775 Ga0055524_1004355 Ga0055524_10043555 183
214 3300003790 Ga0055528_1029862 Ga0055528_10298621 183
215 3300003791 Ga0055530_10000788 Ga0055530_1000078814 183
216 3300003794 Ga0055531_10001105 Ga0055531_100011058 183
217 3300005262 Ga0065165_1000688 Ga0065165_100068815 183
218 3300005331 Ga0070670_100000022 Ga0070670_100000022113 183
219 3300005331 Ga0070670_100386869 Ga0070670_1003868692 183
220 3300005335 Ga0070666_10017550 Ga0070666_100175502 183
221 3300005338 Ga0068868_100884338 Ga0068868_1008843381 183
222 3300005340 Ga0070689_100518674 Ga0070689_1005186741 183
223 3300005343 Ga0070687_100587535 Ga0070687_1005875351 183
224 3300005344 Ga0070661_100467991 Ga0070661_1004679911 183
225 3300005347 Ga0070668_100000710 Ga0070668_1000007109 183
226 3300005347 Ga0070668_100008045 Ga0070668_1000080453 183
227 3300005353 Ga0070669_100312166 Ga0070669_1003121662 183
228 3300005353 Ga0070669_100318013 Ga0070669_1003180132 183
229 3300005355 Ga0070671_100344206 Ga0070671_1003442062 183
230 3300005356 Ga0070674_100447700 Ga0070674_1004477002 183
231 3300005364 Ga0070673_100126633 Ga0070673_1001266332 183
232 3300005367 Ga0070667_100005071 Ga0070667_10000507111 183
233 3300005367 Ga0070667_100014322 Ga0070667_1000143222 183
234 3300005457 Ga0070662_100633264 Ga0070662_1006332642 183
235 3300005458 Ga0070681_10014375 Ga0070681_100143757 183
236 3300005468 Ga0070707_101109756 Ga0070707_1011097561 183
237 3300005539 Ga0068853_100472392 Ga0068853_1004723922 183
238 3300005548 Ga0070665_100001038 Ga0070665_1000010382 183
239 3300005548 Ga0070665_100047790 Ga0070665_1000477902 183
240 3300005548 Ga0070665_100348560 Ga0070665_1003485602 183
241 3300005617 Ga0068859_100003103 Ga0068859_10000310322 183
242 3300005617 Ga0068859_100050876 Ga0068859_1000508765 183
243 3300005617 Ga0068859_100173053 Ga0068859_1001730532 183
244 3300005618 Ga0068864_100000125 Ga0068864_10000012558 183
245 3300005618 Ga0068864_100000418 Ga0068864_10000041819 183
246 3300005618 Ga0068864_100001709 Ga0068864_1000017096 183
247 3300005618 Ga0068864_100718175 Ga0068864_1007181752 183
248 3300005719 Ga0068861_100014450 Ga0068861_1000144506 183
249 3300005841 Ga0068863_100000066 Ga0068863_10000006617 183
250 3300005841 Ga0068863_100000486 Ga0068863_10000048642 183
251 3300005841 Ga0068863_100112359 Ga0068863_1001123593 183
252 3300005841 Ga0068863_100178115 Ga0068863_1001781152 183
253 3300005841 Ga0068863_100456086 Ga0068863_1004560862 183
254 3300005842 Ga0068858_100000136 Ga0068858_1000001365 183
255 3300005842 Ga0068858_100003656 Ga0068858_1000036565 183
256 3300005842 Ga0068858_100095484 Ga0068858_1000954843 183
257 3300005843 Ga0068860_100000066 Ga0068860_100000066173 183
258 3300005843 Ga0068860_100000136 Ga0068860_10000013689 183
259 3300005843 Ga0068860_100011612 Ga0068860_1000116129 183
260 3300005844 Ga0068862_100001264 Ga0068862_10000126410 183
261 3300005844 Ga0068862_100022276 Ga0068862_1000222765 183
262 3300005844 Ga0068862_100063982 Ga0068862_1000639823 183
263 3300006195 Ga0075366_10173624 Ga0075366_101736242 183
264 3300006353 Ga0075370_10147269 Ga0075370_101472692 183
265 3300006358 Ga0068871_100167640 Ga0068871_1001676403 183
266 3300006881 Ga0068865_100894772 Ga0068865_1008947721 183
267 3300006931 Ga0097620_100003103 Ga0097620_10000310322 183
268 3300006931 Ga0097620_100050876 Ga0097620_1000508765 183
269 3300006931 Ga0097620_100173061 Ga0097620_1001730612 183
270 3300009092 Ga0105250_10194769 Ga0105250_101947691 183
271 3300009093 Ga0105240_10594003 Ga0105240_105940032 183
272 3300009101 Ga0105247_10782554 Ga0105247_107825542 183
273 3300009174 Ga0105241_10780202 Ga0105241_107802022 183
274 3300009177 Ga0105248_10016699 Ga0105248_100166994 183
275 3300009177 Ga0105248_10028114 Ga0105248_100281143 183
276 3300009177 Ga0105248_10803756 Ga0105248_108037562 183
277 3300009551 Ga0105238_10156461 Ga0105238_101564613 183
278 3300009551 Ga0105238_10483434 Ga0105238_104834342 183
279 3300009551 Ga0105238_10587282 Ga0105238_105872822 183
280 3300009553 Ga0105249_10000376 Ga0105249_1000037631 183
281 3300009553 Ga0105249_10379628 Ga0105249_103796282 183
282 3300010375 Ga0105239_10428647 Ga0105239_104286472 183
283 3300013296 Ga0157374_10415412 Ga0157374_104154121 183
284 3300013306 Ga0163162_10239247 Ga0163162_102392472 183
285 3300013306 Ga0163162_11238720 Ga0163162_112387202 183
286 3300013307 Ga0157372_11050439 Ga0157372_110504392 183
287 3300013308 Ga0157375_10344891 Ga0157375_103448912 183
288 3300013308 Ga0157375_11277334 Ga0157375_112773342 183
289 3300014325 Ga0163163_10065846 Ga0163163_100658463 183
290 3300014325 Ga0163163_10127627 Ga0163163_101276272 183
291 3300014497 Ga0182008_10475514 Ga0182008_104755141 183
292 3300014968 Ga0157379_10017570 Ga0157379_100175703 183
293 3300014968 Ga0157379_11078149 Ga0157379_110781492 183
294 3300020082 Ga0206353_11902316 Ga0206353_119023161 183
295 3300025250 Ga0209026_1000567 Ga0209026_10005673 183
296 3300025263 Ga0209565_1000090 Ga0209565_100009059 183
297 3300025273 Ga0209673_1001000 Ga0209673_100100022 183
298 3300025291 Ga0209675_1015077 Ga0209675_10150772 183
299 3300025295 Ga0209564_1017317 Ga0209564_10173173 183
300 3300025297 Ga0209758_1000999 Ga0209758_100099922 183
301 3300025297 Ga0209758_1003056 Ga0209758_100305612 183
302 3300025298 Ga0209050_1000867 Ga0209050_100086736 183
303 3300025299 Ga0209256_1002391 Ga0209256_10023918 183
304 3300025299 Ga0209256_1007405 Ga0209256_10074053 183
305 3300025304 Ga0209257_1000227 Ga0209257_1000227135 183
306 3300025304 Ga0209257_1047283 Ga0209257_10472832 183
307 3300025315 Ga0207697_10209006 Ga0207697_102090062 183
308 3300025903 Ga0207680_10016182 Ga0207680_100161824 183
309 3300025903 Ga0207680_10106582 Ga0207680_101065822 183
310 3300025911 Ga0207654_10185158 Ga0207654_101851581 183
311 3300025912 Ga0207707_10179768 Ga0207707_101797682 183
312 3300025913 Ga0207695_10003289 Ga0207695_100032899 183
313 3300025913 Ga0207695_10034543 Ga0207695_100345435 183
314 3300025913 Ga0207695_10182597 Ga0207695_101825973 183
315 3300025917 Ga0207660_10479198 Ga0207660_104791982 183
316 3300025917 Ga0207660_10910018 Ga0207660_109100181 183
317 3300025920 Ga0207649_10424640 Ga0207649_104246402 183
318 3300025923 Ga0207681_10247103 Ga0207681_102471032 183
319 3300025924 Ga0207694_10151763 Ga0207694_101517632 183
320 3300025924 Ga0207694_10335147 Ga0207694_103351472 183
321 3300025925 Ga0207650_10000016 Ga0207650_1000001633 183
322 3300025925 Ga0207650_10032724 Ga0207650_100327241 183
323 3300025925 Ga0207650_10100576 Ga0207650_101005761 183
324 3300025933 Ga0207706_10075205 Ga0207706_100752052 183
325 3300025939 Ga0207665_10300291 Ga0207665_103002912 183
326 3300025941 Ga0207711_10016203 Ga0207711_100162035 183
327 3300025941 Ga0207711_10042892 Ga0207711_100428923 183
328 3300025941 Ga0207711_10541998 Ga0207711_105419982 183
329 3300025941 Ga0207711_10636461 Ga0207711_106364612 183
330 3300025942 Ga0207689_10111738 Ga0207689_101117383 183
331 3300025942 Ga0207689_10572412 Ga0207689_105724122 183
332 3300025960 Ga0207651_10199458 Ga0207651_101994582 183
333 3300025961 Ga0207712_10000794 Ga0207712_100007944 183
334 3300025972 Ga0207668_10000117 Ga0207668_1000011711 183
335 3300025972 Ga0207668_10051933 Ga0207668_100519332 183
336 3300025972 Ga0207668_10130149 Ga0207668_101301492 183
337 3300025972 Ga0207668_10142410 Ga0207668_101424102 183
338 3300025981 Ga0207640_10349578 Ga0207640_103495782 183
339 3300025986 Ga0207658_10002457 Ga0207658_100024573 183
340 3300025986 Ga0207658_10416795 Ga0207658_104167952 183
341 3300025986 Ga0207658_10484179 Ga0207658_104841792 183
342 3300026035 Ga0207703_10000065 Ga0207703_1000006584 183
343 3300026035 Ga0207703_10001304 Ga0207703_1000130413 183
344 3300026035 Ga0207703_10228732 Ga0207703_102287322 183
345 3300026035 Ga0207703_10265198 Ga0207703_102651982 183
346 3300026067 Ga0207678_10288256 Ga0207678_102882562 183
347 3300026088 Ga0207641_10000011 Ga0207641_10000011372 183
348 3300026088 Ga0207641_10001896 Ga0207641_100018965 183
349 3300026088 Ga0207641_10017742 Ga0207641_100177422 183
350 3300026095 Ga0207676_10000055 Ga0207676_10000055100 183
351 3300026095 Ga0207676_10000450 Ga0207676_1000045041 183
352 3300026095 Ga0207676_10003841 Ga0207676_100038416 183
353 3300026095 Ga0207676_10038403 Ga0207676_100384034 183
354 3300026118 Ga0207675_100022523 Ga0207675_1000225236 183
355 3300027378 Ga0209981_1000621 Ga0209981_10006215 183
356 3300027543 Ga0209999_1012440 Ga0209999_10124402 183
357 3300028379 Ga0268266_10004304 Ga0268266_100043042 183
358 3300028379 Ga0268266_10137438 Ga0268266_101374382 183
359 3300028379 Ga0268266_10177101 Ga0268266_101771012 183
360 3300028380 Ga0268265_10001013 Ga0268265_1000101319 183
361 3300028380 Ga0268265_10006946 Ga0268265_100069462 183
362 3300028380 Ga0268265_10052527 Ga0268265_100525273 183
363 3300028381 Ga0268264_10000265 Ga0268264_1000026524 183
364 3300028381 Ga0268264_10889463 Ga0268264_108894632 183
365 3300028786 Ga0307517_10006346 Ga0307517_100063464 183
366 3300028794 Ga0307515_10028618 Ga0307515_100286184 183
367 3300028794 Ga0307515_10242372 Ga0307515_102423722 183
368 3300030521 Ga0307511_10037163 Ga0307511_100371635 183
369 3300031456 Ga0307513_10000100 Ga0307513_1000010035 183
370 3300031456 Ga0307513_10009312 Ga0307513_100093122 183
371 3300031456 Ga0307513_10010426 Ga0307513_100104262 183
372 3300031548 Ga0307408_100092015 Ga0307408_1000920153 183
373 3300031730 Ga0307516_10000113 Ga0307516_100001139 183
374 3300032004 Ga0307414_10143181 Ga0307414_101431813 183
375 3300033180 Ga0307510_10003321 Ga0307510_100033218 183
376 3300035083 Ga0373926_0051281 Ga0373926_0051281_69_725 183
377 3300035089 Ga0373944_0005748 Ga0373944_0005748_2065_2619 183
378 3300035113 Ga0373936_0103086 Ga0373936_0103086_302_856 183
379 3300035171 Ga0373946_0015865 Ga0373946_0015865_1383_1937 183
380 3300035692 Ga0373935_0161776 Ga0373935_0161776_270_824 183
381 3300035695 Ga0373927_0000173 Ga0373927_0000173_18366_18920 183
382 3300035725 Ga0373947_0061490 Ga0373947_0061490_957_1511 183
383 3300037068 Ga0373925_0000049 Ga0373925_0000049_50089_50643 183
384 3300037068 Ga0373925_0117844 Ga0373925_0117844_1307_1861 183
385 3300037312 Ga0395899_0000115 Ga0395899_0000115_49834_50388 183
386 3300037312 Ga0395899_0057825 Ga0395899_0057825_1634_2188 183
387 3300037312 Ga0395899_0177013 Ga0395899_0177013_345_899 183
388 3300037418 Ga0395900_0000002 Ga0395900_0000002_87164_87718 183
389 3300037418 Ga0395900_0230583 Ga0395900_0230583_1194_1748 183
390 3300037418 Ga0395900_0372942 Ga0395900_0372942_318_872 183
391 3300037466 Ga0395898_0008120 Ga0395898_0008120_6785_7339 183
392 3300037466 Ga0395898_0809466 Ga0395898_0809466_275_829 183
393 3300037471 Ga0395905_0021615 Ga0395905_0021615_5231_5785 183
394 3300037471 Ga0395905_0265671 Ga0395905_0265671_406_960 183
395 3300037471 Ga0395905_0550337 Ga0395905_0550337_131_685 183
396 3300037471 Ga0395905_0570213 Ga0395905_0570213_447_1001 183
397 3300038443 Ga0395901_0000021 Ga0395901_0000021_207191_207745 183
398 3300038443 Ga0395901_0340827 Ga0395901_0340827_623_1177 183
399 3300038443 Ga0395901_0456930 Ga0395901_0456930_101_655 183
400 3300039437 Ga0436365_0820477 Ga0436365_0820477_489_1049 183
401 3300039447 Ga0436361_0340319 Ga0436361_0340319_301_855 183
402 3300042004 Ga0439445_0115495 Ga0439445_0115495_20_577 183
403 3300046459 Ga0495629_0153650 Ga0495629_0153650_684_1271 183
404 3300046460 Ga0495638_0000293 Ga0495638_0000293_13509_14081 183
405 3300046460 Ga0495638_0000996 Ga0495638_0000996_12483_13055 183
406 3300046460 Ga0495638_0001207 Ga0495638_0001207_11457_12029 183
407 3300046471 Ga0495650_0060642 Ga0495650_0060642_450_1019 183
408 3300046475 Ga0495639_0170119 Ga0495639_0170119_89_676 183
409 3300046477 Ga0495664_0197485 Ga0495664_0197485_29_583 183
410 3300046491 Ga0495584_0370082 Ga0495584_0370082_125_715 183
411 3300046492 Ga0495585_0217728 Ga0495585_0217728_178_732 183
412 3300046506 Ga0495583_0000003 Ga0495583_0000003_615446_616018 183
413 3300046507 Ga0495606_0013252 Ga0495606_0013252_1771_2343 183
414 3300046507 Ga0495606_0056313 Ga0495606_0056313_172_726 183
415 3300046507 Ga0495606_0252638 Ga0495606_0252638_32_598 183
416 3300046512 Ga0495610_0000179 Ga0495610_0000179_14594_15166 183
417 3300046512 Ga0495610_0008936 Ga0495610_0008936_1319_1888 183
418 3300046513 Ga0495616_0031655 Ga0495616_0031655_600_1172 183
419 3300046515 Ga0495620_0076779 Ga0495620_0076779_130_720 183
420 3300046520 Ga0495637_0002909 Ga0495637_0002909_1595_2167 183
421 3300046522 Ga0495643_0160463 Ga0495643_0160463_209_799 183
422 3300046524 Ga0495648_0114818 Ga0495648_0114818_311_883 183
423 3300046528 Ga0495642_0010307 Ga0495642_0010307_1357_1911 183
424 3300046528 Ga0495642_0077509 Ga0495642_0077509_627_1181 183
425 3300046531 Ga0495665_0158977 Ga0495665_0158977_542_1096 183
426 3300046538 Ga0495609_0027662 Ga0495609_0027662_67_657 183
427 3300046539 Ga0495621_0029202 Ga0495621_0029202_302_856 183
428 3300046542 Ga0495597_0006922 Ga0495597_0006922_3001_3591 183
429 3300046542 Ga0495597_0050110 Ga0495597_0050110_1209_1760 183
430 3300046557 Ga0495622_0006369 Ga0495622_0006369_2333_2899 183
431 3300046616 Ga0495668_0024376 Ga0495668_0024376_2789_3343 183
432 3300046616 Ga0495668_0063554 Ga0495668_0063554_793_1347 183
433 3300046616 Ga0495668_0127685 Ga0495668_0127685_756_1307 183
434 3300046616 Ga0495668_0137242 Ga0495668_0137242_247_819 183
435 3300046616 Ga0495668_0618786 Ga0495668_0618786_24_578 183
436 3300046648 Ga0495611_0001327 Ga0495611_0001327_330_884 183
437 3300046648 Ga0495611_0105737 Ga0495611_0105737_184_774 183
438 3300046660 Ga0495625_0000034 Ga0495625_0000034_105095_105667 183
439 3300046660 Ga0495625_0000795 Ga0495625_0000795_5298_5885 183
440 3300046660 Ga0495625_0012684 Ga0495625_0012684_1663_2235 183
441 3300046660 Ga0495625_0146514 Ga0495625_0146514_707_1294 183
442 3300046660 Ga0495625_0154648 Ga0495625_0154648_869_1441 183
443 3300046660 Ga0495625_0205110 Ga0495625_0205110_359_910 183
444 3300046660 Ga0495625_0625649 Ga0495625_0625649_33_587 183
445 3300046684 Ga0495669_0006159 Ga0495669_0006159_665_1219 183
446 3300046684 Ga0495669_0071002 Ga0495669_0071002_307_861 183
447 3300046689 Ga0495613_0313372 Ga0495613_0313372_305_859 183
448 3300046690 Ga0495624_0296258 Ga0495624_0296258_94_660 183
449 3300046694 Ga0495649_0304497 Ga0495649_0304497_31_621 183
450 3300046794 Ga0495589_0007108 Ga0495589_0007108_2309_2881 183
451 3300047315 Ga0495581_0504765 Ga0495581_0504765_102_656 183
452 3300047315 Ga0495581_0522648 Ga0495581_0522648_106_669 183
453 3300047443 Ga0495687_018449 Ga0495687_018449_1309_1899 183
454 3300047445 Ga0495677_0023234 Ga0495677_0023234_1184_1738 183
455 3300047469 Ga0495673_0000053 Ga0495673_0000053_45987_46559 183
456 3300047469 Ga0495673_0011591 Ga0495673_0011591_398_970 183
457 3300047470 Ga0495681_0043875 Ga0495681_0043875_1337_1924 183
458 3300047470 Ga0495681_0084032 Ga0495681_0084032_156_710 183
459 3300047472 Ga0495686_0008203 Ga0495686_0008203_4692_5243 183
460 3300047472 Ga0495686_0018102 Ga0495686_0018102_4128_4700 183
461 3300047472 Ga0495686_0035394 Ga0495686_0035394_379_951 183
462 3300047472 Ga0495686_0056673 Ga0495686_0056673_659_1222 183
463 3300047472 Ga0495686_0205512 Ga0495686_0205512_33_587 183
464 3300047673 Ga0495593_0067701 Ga0495593_0067701_815_1402 183
465 3300048088 Ga0495602_0488115 Ga0495602_0488115_223_813 183
466 3300048903 Ga0496100_0266932 Ga0496100_0266932_464_1018 183
467 3300048904 Ga0496101_0055659 Ga0496101_0055659_33_602 183
468 3300048904 Ga0496101_0167922 Ga0496101_0167922_659_1213 183
469 3300048905 Ga0496102_0050829 Ga0496102_0050829_2274_2828 183
470 3300048906 Ga0496103_0023950 Ga0496103_0023950_287_841 183
471 3300048907 Ga0496104_0178039 Ga0496104_0178039_285_839 183
472 3300048909 Ga0496106_0012556 Ga0496106_0012556_3047_3616 183
473 3300048909 Ga0496106_0104384 Ga0496106_0104384_490_1044 183
474 3300048909 Ga0496106_0282527 Ga0496106_0282527_702_1256 183
475 3300048910 Ga0496107_0000034 Ga0496107_0000034_75775_76344 183
476 3300048911 Ga0496108_0057239 Ga0496108_0057239_1795_2349 183
477 3300048912 Ga0496109_0113056 Ga0496109_0113056_964_1518 183
478 3300048915 Ga0496112_0019671 Ga0496112_0019671_2270_2824 183
479 3300048916 Ga0496113_0294046 Ga0496113_0294046_624_1178 183
480 3300048918 Ga0496115_0001261 Ga0496115_0001261_16154_16711 183
481 3300048918 Ga0496115_0259596 Ga0496115_0259596_578_1135 183
482 3300048918 Ga0496115_0682936 Ga0496115_0682936_183_740 183
483 3300048924 Ga0496121_0004814 Ga0496121_0004814_3687_4256 183
484 3300048924 Ga0496121_0160442 Ga0496121_0160442_536_1108 183
485 3300048928 Ga0496125_0112129 Ga0496125_0112129_164_718 183
486 3300049570 Ga0501033_0017057 Ga0501033_0017057_3605_4159 183
487 3300049580 Ga0501046_0433573 Ga0501046_0433573_218_772 183
488 3300049581 Ga0501047_0002950 Ga0501047_0002950_1310_1864 183
489 3300049581 Ga0501047_0030290 Ga0501047_0030290_339_896 183
490 3300049581 Ga0501047_0554708 Ga0501047_0554708_300_854 183
491 3300049582 Ga0501048_0297585 Ga0501048_0297585_289_843 183
492 3300049671 Ga0501238_000290 Ga0501238_000290_2695_3264 183
493 3300049686 Ga0501257_004222 Ga0501257_004222_490_1047 183
494 3300049763 Ga0501266_043111 Ga0501266_043111_103_660 183
495 3300049822 Ga0501035_0232942 Ga0501035_0232942_828_1382 183
496 3300049823 Ga0501044_0056897 Ga0501044_0056897_1883_2437 183
497 3300049823 Ga0501044_0519379 Ga0501044_0519379_319_876 183
498 3300050493 nmdc:mga0k408_201209_c1 nmdc:mga0k408_201209_c1_465_1022 183
499 3300050496 nmdc:mga07m45_156255_c1 nmdc:mga07m45_156255_c1_538_1095 183
500 3300050496 nmdc:mga07m45_71084_c1 nmdc:mga07m45_71084_c1_1240_1794 183
501 3300053091 Ga0500647_0072952 Ga0500647_0072952_489_1043 183
502 3300053093 Ga0500651_0143238 Ga0500651_0143238_511_1077 183
503 3300053096 Ga0500641_0005703 Ga0500641_0005703_2633_3187 183
504 3300053102 Ga0500554_002506 Ga0500554_002506_1584_2156 183
505 3300053103 Ga0500555_002319 Ga0500555_002319_1985_2539 183
506 3300053103 Ga0500555_048565 Ga0500555_048565_543_1100 183
507 3300053104 Ga0500556_0000401 Ga0500556_0000401_11424_11996 183
508 3300053108 Ga0500562_000596 Ga0500562_000596_7925_8497 183
509 3300053108 Ga0500562_002545 Ga0500562_002545_104_658 183
510 3300053109 Ga0500569_004229 Ga0500569_004229_93_683 183
511 3300053117 Ga0500593_196948 Ga0500593_196948_137_709 183
512 3300053119 Ga0500595_018095 Ga0500595_018095_1182_1736 183
513 3300053119 Ga0500595_022793 Ga0500595_022793_1277_1867 183
514 3300053122 Ga0500608_017132 Ga0500608_017132_2465_3055 183
515 3300053123 Ga0500614_002542 Ga0500614_002542_2335_2925 183
516 3300053123 Ga0500614_022524 Ga0500614_022524_178_750 183
517 3300053131 Ga0500652_000159 Ga0500652_000159_10726_11289 183
518 3300053134 Ga0500658_0001449 Ga0500658_0001449_4348_4920 183
519 3300053134 Ga0500658_0027186 Ga0500658_0027186_128_718 183
520 3300053136 Ga0500559_0012057 Ga0500559_0012057_1652_2242 183
521 3300053148 Ga0500590_008191 Ga0500590_008191_370_960 183
522 3300053162 Ga0500638_026644 Ga0500638_026644_1897_2451 183
523 3300053177 Ga0500636_0003540 Ga0500636_0003540_164_718 183
524 3300053177 Ga0500636_0029250 Ga0500636_0029250_2475_3041 183
525 3300053725 Ga0500576_058984 Ga0500576_058984_1080_1646 183
526 3300053729 Ga0500625_010904 Ga0500625_010904_3102_3692 183
527 3300053730 Ga0500645_000738 Ga0500645_000738_4292_4843 183
528 3300053730 Ga0500645_001858 Ga0500645_001858_4811_5383 183
529 3300053732 Ga0500656_006054 Ga0500656_006054_358_912 183
530 3300060353 Ga0501082_0912639 Ga0501082_0912639_198_758 183
531 iso_pu_bacteria 2513237161 2514013543 183
532 iso_pu_bacteria 2922368715 2922372156 183
533 iso_pu_bacteria 2935665750 2935674612 183
534 iso_pu_bacteria 2935908558 2935914541 183
535 iso_pu_bacteria 2935926038 2935932079 183
536 iso_pu_bacteria 2935934488 2935940676 183
537 iso_pu_bacteria 2935942939 2935948737 183
538 iso_pu_bacteria 2935951376 2935957156 183
539 iso_pu_bacteria 2935967501 2935973872 183
540 iso_pu_bacteria 3000405567 3000408218 183
541 iso_pu_bacteria 8019619141 8019626151 183
542 iso_pu_bacteria 8019687851 8019688045 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

40

212

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9756 2 177
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9711 2 174
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9693 2 177
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.9657 1 177
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9643 1 183
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.965 2 177 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9578 2 174 2.60.120.10
2b9uD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9514 2 177 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9497 2 183 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9397 1 177 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2N3CCT1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9861 2 178 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1G5QZS5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9856 1 177 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7X8CSM9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9854 1 176 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1G0UV91-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9854 42 178 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A0J7NA76-F1-model_v4 Dtdp-4-dehydrorhamnose-epimerase 0.9845 42 182 GO:0000271
GO:0005829
GO:0008830

Feature Viewer

pLDDT pTM Quality
97.22 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map