F461478

General Info

Members Datasets Scaffolds Average Seq Length
542 262 1084 274

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10036188|Ga0105249_100361885
Length 312
Sequence LKIADLAKTWVLTVLPDRSAIDNLQSELRNGFMNKKPEPTKHYLLASDFDQTLSFNDSGIILSELLGAHGFGEKVAGLSNMNLVQQGGELAYLLLHDPEYRQVRKEHLIEVGKRIRLKQNIKEFLRFLEKGFDGYRFSFYVVSAAPEEVIQSALEDIVPVDHIFGTRFRYHELTGEIDSIIRVPAGYGKVAVIDQLHTNLQVSYDRIVYVGDGSSDVHVMLHVNRQEGFTVAVSEAKHIAQIAKRSVLSDDALSVLVPVLEDIVGWDSTAIRSLFESRGFLIQEWDKVRTDWLTISAIPDREESKLRLVETS

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
119 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
196 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
197 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
198 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
201 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
241 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
242 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0
Rhizoplane 5.35
Rhizosphere 87.82
Stem 0
Stem Tuber 0
Unclassified 13.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10036188 3300009553 Bacteria 4478
2 MRS1b_contig_1945423 2162886011 Unclassified 939
3 Ga0065712_10079017 3300005290 Bacteria 3270
4 Ga0065712_10082157 3300005290 Bacteria 2943
5 Ga0065715_10001124 3300005293 Bacteria 11545
6 Ga0065715_10182885 3300005293 Bacteria 1464
7 Ga0065707_10256022 3300005295 Unclassified 1111
8 Ga0070658_10006626 3300005327 Bacteria 9385
9 Ga0070658_10049886 3300005327 Bacteria 3392
10 Ga0070676_10157945 3300005328 Unclassified 1457
11 Ga0070683_100003346 3300005329 Bacteria 12977
12 Ga0070683_100491278 3300005329 Bacteria 1172
13 Ga0070690_100124009 3300005330 Bacteria 1737
14 Ga0070690_100137003 3300005330 Bacteria 1659
15 Ga0070670_100027822 3300005331 Bacteria 4864
16 Ga0070670_100142143 3300005331 Bacteria 2075
17 Ga0070677_10033156 3300005333 Bacteria 1987
18 Ga0068869_100173368 3300005334 Bacteria 1686
19 Ga0070666_10019684 3300005335 Bacteria 4360
20 Ga0070680_100007058 3300005336 Bacteria 8564
21 Ga0070680_100184325 3300005336 Bacteria 1758
22 Ga0070682_100010414 3300005337 Bacteria 5277
23 Ga0070682_100012824 3300005337 Bacteria 4810
24 Ga0070682_100160726 3300005337 Bacteria 1551
25 Ga0070682_100454489 3300005337 Bacteria 982
26 Ga0068868_100116022 3300005338 Bacteria 2180
27 Ga0068868_100315098 3300005338 Bacteria 1332
28 Ga0070660_100393781 3300005339 Bacteria 1145
29 Ga0070689_100027995 3300005340 Bacteria 4256
30 Ga0070689_100226809 3300005340 Bacteria 1534
31 Ga0070687_100269173 3300005343 Unclassified 1067
32 Ga0070687_100359132 3300005343 Bacteria 942
33 Ga0070661_100073924 3300005344 Bacteria 2510
34 Ga0070661_100370076 3300005344 Bacteria 1128
35 Ga0070668_100242149 3300005347 Bacteria 1494
36 Ga0070675_100033170 3300005354 Bacteria 4184
37 Ga0070675_100052546 3300005354 Bacteria 3350
38 Ga0070671_100132194 3300005355 Bacteria 2102
39 Ga0070671_100234861 3300005355 Bacteria 1556
40 Ga0070671_100268697 3300005355 Bacteria 1450
41 Ga0070674_100013920 3300005356 Bacteria 4988
42 Ga0070674_100019028 3300005356 Bacteria 4356
43 Ga0070673_100013458 3300005364 Bacteria 5659
44 Ga0070673_100078911 3300005364 Bacteria 2664
45 Ga0070673_100286224 3300005364 Bacteria 1447
46 Ga0070673_100589149 3300005364 Unclassified 1013
47 Ga0070688_100004821 3300005365 Bacteria 7052
48 Ga0070659_100057715 3300005366 Bacteria 3061
49 Ga0070659_100132613 3300005366 Unclassified 2024
50 Ga0070667_100013901 3300005367 Bacteria 6655
51 Ga0070667_100153622 3300005367 Unclassified 2024
52 Ga0070703_10010503 3300005406 Bacteria 2612
53 Ga0070703_10038233 3300005406 Bacteria 1483
54 Ga0070709_10001160 3300005434 Bacteria 14442
55 Ga0070714_100052347 3300005435 Bacteria 3482
56 Ga0070713_100056309 3300005436 Bacteria 3271
57 Ga0070701_10069620 3300005438 Bacteria 1877
58 Ga0070711_100000195 3300005439 Bacteria 32023
59 Ga0070711_100017138 3300005439 Bacteria 4608
60 Ga0070711_100264430 3300005439 Unclassified 1355
61 Ga0070705_100144871 3300005440 Unclassified 1568
62 Ga0070700_100003668 3300005441 Bacteria 7939
63 Ga0070700_100175037 3300005441 Bacteria 1489
64 Ga0070694_100009885 3300005444 Bacteria 5863
65 Ga0070694_100016142 3300005444 Bacteria 4700
66 Ga0070694_100056117 3300005444 Bacteria 2674
67 Ga0070708_100000165 3300005445 Bacteria 47190
68 Ga0070708_100040676 3300005445 Bacteria 4072
69 Ga0070708_100351542 3300005445 Bacteria 1389
70 Ga0070663_100015014 3300005455 Bacteria 4983
71 Ga0070663_100505203 3300005455 Bacteria 1004
72 Ga0070678_100224532 3300005456 Unclassified 1563
73 Ga0070662_100017946 3300005457 Bacteria 4778
74 Ga0070662_100166835 3300005457 Unclassified 1726
75 Ga0070681_10088708 3300005458 Bacteria 3044
76 Ga0070681_10096273 3300005458 Bacteria 2908
77 Ga0068867_100177877 3300005459 Bacteria 1690
78 Ga0068867_100182638 3300005459 Bacteria 1669
79 Ga0070685_10121223 3300005466 Unclassified 1624
80 Ga0070706_100012074 3300005467 Bacteria 8016
81 Ga0070706_100028015 3300005467 Bacteria 5183
82 Ga0070706_100042646 3300005467 Bacteria 4192
83 Ga0070706_100055100 3300005467 Bacteria 3670
84 Ga0070706_100075490 3300005467 Bacteria 3119
85 Ga0070706_100083798 3300005467 Unclassified 2954
86 Ga0070706_100133153 3300005467 Bacteria 2320
87 Ga0070707_100024301 3300005468 Bacteria 5738
88 Ga0070707_100052657 3300005468 Bacteria 3902
89 Ga0070707_100071497 3300005468 Bacteria 3342
90 Ga0070707_100072644 3300005468 Bacteria 3316
91 Ga0070707_100137194 3300005468 Bacteria 2380
92 Ga0070698_100000323 3300005471 Bacteria 48831
93 Ga0070698_100008013 3300005471 Bacteria 11425
94 Ga0070698_100020057 3300005471 Bacteria 7009
95 Ga0070698_100041726 3300005471 Bacteria 4710
96 Ga0070699_100004886 3300005518 Bacteria 11824
97 Ga0070699_100006075 3300005518 Bacteria 10561
98 Ga0070699_100012305 3300005518 Bacteria 7382
99 Ga0070699_100032768 3300005518 Bacteria 4487
100 Ga0070699_100054832 3300005518 Bacteria 3451
101 Ga0070699_100229891 3300005518 Bacteria 1654
102 Ga0070699_100465003 3300005518 Bacteria 1147
103 Ga0070679_100065099 3300005530 Bacteria 3633
104 Ga0070679_100071302 3300005530 Bacteria 3465
105 Ga0070684_100002450 3300005535 Bacteria 13671
106 Ga0070684_100159371 3300005535 Bacteria 2046
107 Ga0070697_100001200 3300005536 Bacteria 19608
108 Ga0070697_100004413 3300005536 Bacteria 10802
109 Ga0070697_100043174 3300005536 Bacteria 3649
110 Ga0070697_100077163 3300005536 Bacteria 2740
111 Ga0070697_100082837 3300005536 Bacteria 2645
112 Ga0070697_100155081 3300005536 Bacteria 1932
113 Ga0070697_100292798 3300005536 Archaea 1398
114 Ga0070697_100461376 3300005536 Unclassified 1107
115 Ga0068853_100017014 3300005539 Bacteria 5995
116 Ga0068853_100201908 3300005539 Bacteria 1809
117 Ga0068853_100295907 3300005539 Bacteria 1495
118 Ga0070672_100031721 3300005543 Bacteria 3980
119 Ga0070672_100084349 3300005543 Bacteria 2551
120 Ga0070672_100228869 3300005543 Unclassified 1561
121 Ga0070672_100280140 3300005543 Bacteria 1409
122 Ga0070686_100037096 3300005544 Bacteria 3022
123 Ga0070686_100073506 3300005544 Bacteria 2245
124 Ga0070686_100395451 3300005544 Bacteria 1050
125 Ga0070695_100051097 3300005545 Bacteria 2651
126 Ga0070696_100002418 3300005546 Bacteria 12368
127 Ga0070696_100108038 3300005546 Bacteria 2001
128 Ga0070693_100039519 3300005547 Bacteria 2643
129 Ga0070665_100002549 3300005548 Bacteria 20012
130 Ga0070665_100003356 3300005548 Bacteria 17131
131 Ga0070704_100003522 3300005549 Bacteria 8994
132 Ga0070704_100031827 3300005549 Bacteria 3552
133 Ga0070704_100137312 3300005549 Bacteria 1904
134 Ga0068855_100260868 3300005563 Bacteria 1930
135 Ga0068855_100428268 3300005563 Bacteria 1446
136 Ga0070664_100001232 3300005564 Bacteria 20476
137 Ga0070664_100048770 3300005564 Bacteria 3579
138 Ga0070664_100252638 3300005564 Bacteria 1585
139 Ga0068857_100050311 3300005577 Unclassified 3697
140 Ga0068854_100128872 3300005578 Unclassified 1930
141 Ga0068856_100376985 3300005614 Bacteria 1438
142 Ga0070702_100084745 3300005615 Bacteria 1907
143 Ga0070702_100375610 3300005615 Bacteria 1009
144 Ga0068852_100027081 3300005616 Bacteria 4667
145 Ga0068859_100041617 3300005617 Bacteria 4615
146 Ga0068859_100091693 3300005617 Bacteria 3089
147 Ga0068859_100115754 3300005617 Bacteria 2746
148 Ga0068859_100200630 3300005617 Bacteria 2079
149 Ga0068859_100845664 3300005617 Bacteria 1001
150 Ga0068864_100085378 3300005618 Bacteria 2775
151 Ga0068864_100162549 3300005618 Bacteria 2030
152 Ga0068864_100316960 3300005618 Bacteria 1464
153 Ga0068864_100322339 3300005618 Bacteria 1451
154 Ga0068866_10042064 3300005718 Bacteria 2272
155 Ga0068866_10102488 3300005718 Bacteria 1581
156 Ga0068866_10223438 3300005718 Bacteria 1138
157 Ga0068861_100025278 3300005719 Bacteria 4305
158 Ga0068861_100065289 3300005719 Bacteria 2803
159 Ga0068870_10019028 3300005840 Bacteria 3326
160 Ga0068870_10020288 3300005840 Bacteria 3234
161 Ga0068863_100060329 3300005841 Bacteria 3587
162 Ga0068863_100164672 3300005841 Bacteria 2126
163 Ga0068863_100393767 3300005841 Unclassified 1354
164 Ga0068858_100000368 3300005842 Bacteria 47468
165 Ga0068858_100044074 3300005842 Bacteria 4136
166 Ga0068858_100128186 3300005842 Bacteria 2378
167 Ga0068858_100572690 3300005842 Unclassified 1094
168 Ga0068860_100039559 3300005843 Bacteria 4510
169 Ga0068862_100038830 3300005844 Bacteria 4040
170 Ga0068862_100058944 3300005844 Bacteria 3295
171 Ga0070717_10162572 3300006028 Bacteria 1937
172 Ga0075364_10012845 3300006051 Bacteria 5136
173 Ga0075364_10180754 3300006051 Bacteria 1427
174 Ga0070716_100007014 3300006173 Bacteria 5527
175 Ga0070716_100055124 3300006173 Bacteria 2274
176 Ga0070716_100095888 3300006173 Unclassified 1807
177 Ga0075367_10016285 3300006178 Unclassified 4058
178 Ga0075367_10049568 3300006178 Bacteria 2475
179 Ga0075367_10125087 3300006178 Bacteria 1586
180 Ga0097621_100019033 3300006237 Bacteria 5262
181 Ga0097621_100160210 3300006237 Unclassified 1934
182 Ga0097621_100357129 3300006237 Bacteria 1301
183 Ga0075370_10077740 3300006353 Bacteria 1904
184 Ga0068871_100046511 3300006358 Bacteria 3495
185 Ga0075430_100016969 3300006846 Bacteria 6200
186 Ga0075430_100017198 3300006846 Bacteria 6158
187 Ga0075430_100358993 3300006846 Bacteria 1203
188 Ga0075431_100044300 3300006847 Unclassified 4590
189 Ga0075431_100134113 3300006847 Unclassified 2553
190 Ga0075431_100550104 3300006847 Bacteria 1142
191 Ga0075433_10000491 3300006852 Bacteria 25723
192 Ga0075433_10022061 3300006852 Bacteria 5343
193 Ga0075433_10022765 3300006852 Bacteria 5264
194 Ga0075433_10033787 3300006852 Bacteria 4387
195 Ga0075434_100001808 3300006871 Bacteria 18502
196 Ga0075434_100063157 3300006871 Bacteria 3686
197 Ga0075434_100163714 3300006871 Bacteria 2244
198 Ga0075434_100699627 3300006871 Unclassified 1031
199 Ga0075429_100030546 3300006880 Bacteria 4681
200 Ga0068865_100028512 3300006881 Bacteria 3697
201 Ga0068865_100282070 3300006881 Bacteria 1323
202 Ga0075436_100006065 3300006914 Bacteria 8296
203 Ga0075436_100008315 3300006914 Bacteria 7098
204 Ga0075436_100048632 3300006914 Bacteria 2926
205 Ga0075436_100074286 3300006914 Bacteria 2354
206 Ga0097620_100041617 3300006931 Bacteria 4615
207 Ga0097620_100091692 3300006931 Bacteria 3089
208 Ga0097620_100115757 3300006931 Bacteria 2746
209 Ga0097620_100200630 3300006931 Bacteria 2079
210 Ga0097620_100845823 3300006931 Bacteria 1001
211 Ga0075435_100003788 3300007076 Bacteria 10306
212 Ga0075435_100021359 3300007076 Bacteria 4977
213 Ga0099794_10042432 3300007265 Bacteria 2169
214 Ga0099794_10061583 3300007265 Unclassified 1824
215 Ga0105240_10038547 3300009093 Bacteria 6129
216 Ga0105240_10046028 3300009093 Bacteria 5531
217 Ga0111539_10036630 3300009094 Bacteria 5929
218 Ga0111539_10062081 3300009094 Unclassified 4425
219 Ga0111539_10076640 3300009094 Bacteria 3937
220 Ga0111539_10268802 3300009094 Bacteria 1985
221 Ga0111539_10381559 3300009094 Bacteria 1641
222 Ga0105245_10018160 3300009098 Bacteria 6149
223 Ga0114129_10001626 3300009147 Bacteria 30488
224 Ga0114129_10021237 3300009147 Bacteria 9219
225 Ga0114129_10168481 3300009147 Bacteria 2987
226 Ga0114129_10243422 3300009147 Unclassified 2417
227 Ga0114129_10254510 3300009147 Bacteria 2356
228 Ga0114129_11043687 3300009147 Bacteria 1027
229 Ga0105243_10152053 3300009148 Bacteria 1986
230 Ga0105243_10171246 3300009148 Unclassified 1881
231 Ga0105241_10134230 3300009174 Bacteria 2007
232 Ga0105242_10099252 3300009176 Bacteria 2465
233 Ga0105242_10140228 3300009176 Bacteria 2097
234 Ga0105242_10149216 3300009176 Unclassified 2037
235 Ga0105242_10295452 3300009176 Bacteria 1477
236 Ga0105248_10065909 3300009177 Bacteria 4066
237 Ga0105248_10079995 3300009177 Bacteria 3673
238 Ga0105237_10026416 3300009545 Bacteria 5934
239 Ga0105237_10078805 3300009545 Bacteria 3284
240 Ga0105237_10079125 3300009545 Bacteria 3277
241 Ga0105238_10045193 3300009551 Bacteria 4449
242 Ga0105249_10068501 3300009553 Bacteria 3273
243 Ga0105249_10368232 3300009553 Unclassified 1460
244 Ga0105239_10352961 3300010375 Bacteria 1661
245 Ga0105239_10563585 3300010375 Bacteria 1298
246 Ga0105239_10641659 3300010375 Bacteria 1212
247 Ga0105246_10106968 3300011119 Bacteria 2047
248 Ga0157371_10382076 3300013102 Unclassified 1028
249 Ga0157369_10053783 3300013105 Bacteria 4349
250 Ga0157374_10031631 3300013296 Bacteria 4812
251 Ga0157374_10052539 3300013296 Bacteria 3796
252 Ga0157374_10168526 3300013296 Bacteria 2136
253 Ga0157374_10183569 3300013296 Bacteria 2045
254 Ga0157374_10307479 3300013296 Viruses 1569
255 Ga0157378_10023604 3300013297 Bacteria 5409
256 Ga0163162_10023938 3300013306 Bacteria 6026
257 Ga0163162_10024428 3300013306 Bacteria 5965
258 Ga0163162_10174248 3300013306 Unclassified 2276
259 Ga0157372_10184862 3300013307 Bacteria 2413
260 Ga0157375_10096019 3300013308 Unclassified 3036
261 Ga0157375_10815086 3300013308 Bacteria 1081
262 Ga0163163_10007635 3300014325 Bacteria 9551
263 Ga0163163_10766509 3300014325 Bacteria 1028
264 Ga0157380_10007576 3300014326 Bacteria 7712
265 Ga0157380_10061285 3300014326 Unclassified 3010
266 Ga0157380_10120204 3300014326 Bacteria 2224
267 Ga0157380_10335018 3300014326 Bacteria 1409
268 Ga0157380_10395749 3300014326 Unclassified 1309
269 Ga0157377_10167992 3300014745 Unclassified 1369
270 Ga0157379_10150771 3300014968 Bacteria 2097
271 Ga0157376_10056515 3300014969 Bacteria 3278
272 Ga0157376_10286562 3300014969 Bacteria 1553
273 Ga0157376_10431005 3300014969 Unclassified 1282
274 Ga0157376_10531835 3300014969 Bacteria 1160
275 Ga0163161_10054297 3300017792 Bacteria 2907
276 Ga0163161_10280319 3300017792 Bacteria 1307
277 Ga0163161_10465876 3300017792 Bacteria 1024
278 Ga0224572_1004491 3300024225 Unclassified 2431
279 Ga0228598_1000070 3300024227 Bacteria 15225
280 Ga0207697_10000564 3300025315 Bacteria 21037
281 Ga0207697_10005597 3300025315 Bacteria 5816
282 Ga0207653_10002656 3300025885 Bacteria 5673
283 Ga0207653_10008826 3300025885 Bacteria 3143
284 Ga0207653_10083155 3300025885 Bacteria 1111
285 Ga0207682_10002324 3300025893 Bacteria 8566
286 Ga0207682_10003921 3300025893 Bacteria 6353
287 Ga0207642_10045032 3300025899 Unclassified 1956
288 Ga0207710_10003317 3300025900 Bacteria 7190
289 Ga0207680_10119374 3300025903 Bacteria 1722
290 Ga0207699_10001633 3300025906 Bacteria 10623
291 Ga0207643_10007214 3300025908 Bacteria 5966
292 Ga0207643_10028397 3300025908 Bacteria 3107
293 Ga0207705_10024979 3300025909 Bacteria 4265
294 Ga0207705_10296592 3300025909 Unclassified 1239
295 Ga0207684_10001813 3300025910 Bacteria 22328
296 Ga0207684_10006271 3300025910 Bacteria 10851
297 Ga0207684_10040297 3300025910 Bacteria 3960
298 Ga0207684_10042800 3300025910 Bacteria 3840
299 Ga0207684_10064517 3300025910 Bacteria 3109
300 Ga0207684_10134163 3300025910 Bacteria 2125
301 Ga0207684_10189671 3300025910 Bacteria 1773
302 Ga0207684_10283736 3300025910 Unclassified 1428
303 Ga0207684_10303888 3300025910 Bacteria 1375
304 Ga0207707_10010640 3300025912 Bacteria 7991
305 Ga0207707_10038534 3300025912 Bacteria 4176
306 Ga0207695_10089625 3300025913 Bacteria 3092
307 Ga0207671_10009653 3300025914 Bacteria 8043
308 Ga0207671_10079053 3300025914 Bacteria 2464
309 Ga0207671_10230174 3300025914 Bacteria 1454
310 Ga0207663_10000052 3300025916 Bacteria 62649
311 Ga0207663_10233375 3300025916 Bacteria 1345
312 Ga0207660_10027546 3300025917 Bacteria 3879
313 Ga0207660_10027736 3300025917 Bacteria 3868
314 Ga0207657_10359067 3300025919 Bacteria 1149
315 Ga0207649_10037764 3300025920 Bacteria 2920
316 Ga0207652_10013391 3300025921 Bacteria 6640
317 Ga0207646_10002097 3300025922 Bacteria 23908
318 Ga0207646_10021514 3300025922 Bacteria 5959
319 Ga0207646_10029001 3300025922 Bacteria 5033
320 Ga0207646_10068682 3300025922 Bacteria 3165
321 Ga0207681_10053327 3300025923 Bacteria 2745
322 Ga0207681_10557110 3300025923 Bacteria 944
323 Ga0207650_10085824 3300025925 Bacteria 2395
324 Ga0207650_10167437 3300025925 Bacteria 1745
325 Ga0207650_10220557 3300025925 Unclassified 1526
326 Ga0207700_10000090 3300025928 Bacteria 55960
327 Ga0207700_10083720 3300025928 Unclassified 2498
328 Ga0207664_10067366 3300025929 Bacteria 2873
329 Ga0207644_10307076 3300025931 Bacteria 1280
330 Ga0207690_10161300 3300025932 Bacteria 1671
331 Ga0207706_10145133 3300025933 Bacteria 2087
332 Ga0207686_10067594 3300025934 Bacteria 2287
333 Ga0207709_10077675 3300025935 Bacteria 2129
334 Ga0207709_10204358 3300025935 Bacteria 1413
335 Ga0207670_10225315 3300025936 Unclassified 1437
336 Ga0207704_10459064 3300025938 Unclassified 1018
337 Ga0207665_10003319 3300025939 Bacteria 10776
338 Ga0207665_10015934 3300025939 Bacteria 4935
339 Ga0207665_10175836 3300025939 Unclassified 1548
340 Ga0207691_10010573 3300025940 Bacteria 8852
341 Ga0207691_10022290 3300025940 Bacteria 5975
342 Ga0207691_10165752 3300025940 Bacteria 1936
343 Ga0207691_10204309 3300025940 Bacteria 1718
344 Ga0207711_10101063 3300025941 Bacteria 2552
345 Ga0207689_10009693 3300025942 Bacteria 8295
346 Ga0207689_10012448 3300025942 Bacteria 7268
347 Ga0207689_10050879 3300025942 Unclassified 3415
348 Ga0207661_10105222 3300025944 Bacteria 2377
349 Ga0207661_10300925 3300025944 Bacteria 1438
350 Ga0207679_10037340 3300025945 Bacteria 3452
351 Ga0207679_10068729 3300025945 Bacteria 2662
352 Ga0207651_10016621 3300025960 Bacteria 4317
353 Ga0207712_10069881 3300025961 Bacteria 2521
354 Ga0207668_10054824 3300025972 Bacteria 2769
355 Ga0207668_10670895 3300025972 Bacteria 909
356 Ga0207640_10216360 3300025981 Bacteria 1464
357 Ga0207640_10253651 3300025981 Bacteria 1367
358 Ga0207658_10073907 3300025986 Bacteria 2589
359 Ga0207658_10339276 3300025986 Bacteria 1306
360 Ga0207677_10052999 3300026023 Bacteria 2759
361 Ga0207703_10003410 3300026035 Bacteria 13339
362 Ga0207703_10458424 3300026035 Unclassified 1192
363 Ga0207703_10553848 3300026035 Bacteria 1084
364 Ga0207639_10095493 3300026041 Bacteria 2389
365 Ga0207639_10189617 3300026041 Bacteria 1755
366 Ga0207639_10285208 3300026041 Unclassified 1454
367 Ga0207639_10450376 3300026041 Bacteria 1168
368 Ga0207678_10076098 3300026067 Bacteria 2875
369 Ga0207678_10399220 3300026067 Bacteria 1190
370 Ga0207678_10420922 3300026067 Unclassified 1158
371 Ga0207708_10008491 3300026075 Bacteria 7604
372 Ga0207708_10234462 3300026075 Bacteria 1474
373 Ga0207641_10000662 3300026088 Bacteria 37505
374 Ga0207641_10068976 3300026088 Bacteria 3033
375 Ga0207641_10120778 3300026088 Bacteria 2338
376 Ga0207641_10156403 3300026088 Bacteria 2069
377 Ga0207641_10369795 3300026088 Bacteria 1371
378 Ga0207648_10062866 3300026089 Bacteria 3236
379 Ga0207648_10285223 3300026089 Bacteria 1477
380 Ga0207676_10139971 3300026095 Bacteria 2070
381 Ga0207676_10157635 3300026095 Bacteria 1963
382 Ga0207674_10000978 3300026116 Bacteria 37377
383 Ga0207675_100129400 3300026118 Unclassified 2393
384 Ga0207675_100171971 3300026118 Bacteria 2071
385 Ga0207675_100203987 3300026118 Bacteria 1900
386 Ga0207683_10000888 3300026121 Bacteria 27470
387 Ga0207683_10051464 3300026121 Bacteria 3608
388 Ga0207683_10061609 3300026121 Bacteria 3302
389 Ga0207698_10025410 3300026142 Bacteria 4172
390 Ga0209588_1010606 3300027671 Bacteria 2774
391 Ga0209971_1004403 3300027682 Bacteria 3345
392 Ga0265354_1002819 3300028016 Bacteria 2069
393 Ga0268266_10006654 3300028379 Bacteria 10545
394 Ga0268266_10423246 3300028379 Bacteria 1262
395 Ga0268265_10099759 3300028380 Bacteria 2342
396 Ga0268265_10109579 3300028380 Bacteria 2251
397 Ga0268265_10440229 3300028380 Unclassified 1215
398 Ga0268264_10000122 3300028381 Bacteria 189690
399 Ga0268264_10497449 3300028381 Bacteria 1188
400 Ga0265338_10022157 3300028800 Bacteria 6592
401 Ga0265760_10005710 3300031090 Bacteria 3559
402 Ga0265331_10016580 3300031250 Bacteria 3865
403 Ga0265331_10097091 3300031250 Bacteria 1358
404 Ga0307513_10012824 3300031456 Bacteria 10322
405 Ga0307513_10021372 3300031456 Bacteria 7642
406 Ga0307513_10045864 3300031456 Bacteria 4773
407 Ga0307513_10090994 3300031456 Unclassified 3110
408 Ga0307408_100000682 3300031548 Bacteria 28011
409 Ga0307408_100012219 3300031548 Bacteria 5682
410 Ga0307408_100070793 3300031548 Bacteria 2576
411 Ga0307408_100320511 3300031548 Bacteria 1305
412 Ga0265342_10059746 3300031712 Bacteria 2251
413 Ga0307405_10000099 3300031731 Bacteria 35821
414 Ga0307413_10191998 3300031824 Bacteria 1467
415 Ga0307412_10000273 3300031911 Bacteria 32931
416 Ga0307409_100000161 3300031995 Bacteria 25847
417 Ga0307409_100856728 3300031995 Bacteria 920
418 Ga0307416_100000254 3300032002 Bacteria 28510
419 Ga0307416_100132733 3300032002 Bacteria 2245
420 Ga0307416_100191118 3300032002 Bacteria 1931
421 Ga0307411_10000063 3300032005 Bacteria 32128
422 Ga0307510_10000001 3300033180 Bacteria 1172244
423 Ga0307510_10044569 3300033180 Unclassified 4803
424 Ga0373955_0157308 3300035172 Unclassified 1339
425 Ga0436361_1008353 3300039447 Bacteria 2006
426 Ga0436363_0567565 3300039450 Bacteria 1539
427 Ga0436363_1003189 3300039450 Bacteria 2060
428 Ga0451789_0667279 3300041443 Bacteria 2264
429 Ga0451791_0234732 3300041451 Bacteria 1161
430 Ga0451800_0355439 3300041459 Bacteria 1685
431 Ga0451802_0996640 3300041460 Bacteria 3595
432 Ga0451807_1522411 3300041486 Bacteria 2979
433 Ga0439450_012597 3300042008 Bacteria 1681
434 Ga0439459_0030017 3300042438 Bacteria 1100
435 Ga0451577_0094291 3300042876 Bacteria 2673
436 Ga0466969_0044280 3300044656 Bacteria 2215
437 Ga0453683_0020390 3300044673 Bacteria 4236
438 Ga0453683_0134268 3300044673 Unclassified 1560
439 Ga0453683_0276211 3300044673 Bacteria 1073
440 Ga0466963_0134474 3300044694 Unclassified 1710
441 Ga0453684_0726629 3300044712 Unclassified 1077
442 Ga0466959_0072118 3300045049 Bacteria 2500
443 Ga0495638_0002426 3300046460 Bacteria 15237
444 Ga0495638_0069155 3300046460 Bacteria 2164
445 Ga0495638_0080516 3300046460 Bacteria 1979
446 Ga0495648_0088245 3300046524 Bacteria 1744
447 Ga0495625_0155610 3300046660 Bacteria 1534
448 Ga0495635_0091466 3300046663 Unclassified 2081
449 Ga0495589_0170980 3300046794 Bacteria 1033
450 Ga0495600_0143845 3300046809 Bacteria 1546
451 Ga0495672_0199106 3300047320 Unclassified 1003
452 Ga0496101_0442720 3300048904 Bacteria 1025
453 Ga0496102_0013583 3300048905 Bacteria 7058
454 Ga0496102_0295895 3300048905 Unclassified 1526
455 Ga0496104_0015811 3300048907 Bacteria 6845
456 Ga0496104_0118534 3300048907 Bacteria 2541
457 Ga0496104_0169834 3300048907 Bacteria 2091
458 Ga0496105_0070944 3300048908 Bacteria 2879
459 Ga0496105_0396946 3300048908 Unclassified 1095
460 Ga0496105_0461770 3300048908 Bacteria 1001
461 Ga0496106_0194497 3300048909 Bacteria 1613
462 Ga0496106_0196045 3300048909 Bacteria 1607
463 Ga0496108_0054000 3300048911 Bacteria 3371
464 Ga0496109_0001987 3300048912 Bacteria 16952
465 Ga0496110_0061179 3300048913 Bacteria 3323
466 Ga0496110_0458620 3300048913 Unclassified 1161
467 Ga0496111_0009789 3300048914 Bacteria 6408
468 Ga0496112_0000728 3300048915 Bacteria 22872
469 Ga0496112_0048837 3300048915 Bacteria 4146
470 Ga0496112_0074186 3300048915 Bacteria 3364
471 Ga0496113_0046689 3300048916 Bacteria 3216
472 Ga0496114_0033044 3300048917 Bacteria 4261
473 Ga0496114_0193815 3300048917 Bacteria 1778
474 Ga0496115_0011554 3300048918 Bacteria 6619
475 Ga0496115_0072993 3300048918 Bacteria 2785
476 Ga0496116_0030827 3300048919 Unclassified 3848
477 Ga0496117_0000012 3300048920 Bacteria 608530
478 Ga0496118_0000003 3300048921 Bacteria 773148
479 Ga0496119_0000232 3300048922 Bacteria 78129
480 Ga0496120_0000061 3300048923 Bacteria 172817
481 Ga0496120_0067941 3300048923 Unclassified 1967
482 Ga0496121_0015314 3300048924 Bacteria 8050
483 Ga0496125_0001449 3300048928 Bacteria 34527
484 Ga0496126_0002535 3300048929 Bacteria 24445
485 Ga0496126_0028728 3300048929 Bacteria 5295
486 Ga0496126_0069232 3300048929 Unclassified 3148
487 Ga0501292_012215 3300049515 Bacteria 1309
488 Ga0501070_0094979 3300049586 Bacteria 2467
489 Ga0501070_0356953 3300049586 Bacteria 1186
490 Ga0501074_0060085 3300049590 Bacteria 2738
491 Ga0501076_0277057 3300049592 Bacteria 1374
492 Ga0501216_008480 3300049660 Bacteria 1619
493 Ga0501217_005638 3300049661 Bacteria 2624
494 Ga0501233_030959 3300049668 Bacteria 1209
495 Ga0501079_0294651 3300049741 Bacteria 1269
496 Ga0501079_0507414 3300049741 Bacteria 948
497 nmdc:mga03683_128653_c1 3300050489 Bacteria 1131
498 nmdc:mga00v17_27200_c1 3300050491 Bacteria 3338
499 nmdc:mga00v17_343269_c1 3300050491 Bacteria 971
500 nmdc:mga00v17_81872_c1 3300050491 Bacteria 2017
501 nmdc:mga0k408_15981_c1 3300050493 Bacteria 4156
502 nmdc:mga06z11_25466_c1 3300050494 Bacteria 2804
503 nmdc:mga06z11_64196_c1 3300050494 Bacteria 1923
504 nmdc:mga07m45_44302_c1 3300050496 Bacteria 2497
505 nmdc:mga05p37_151249_c1 3300050507 Bacteria 2839
506 nmdc:mga05p37_200572_c1 3300050507 Bacteria 2417
507 nmdc:mga05p37_495648_c1 3300050507 Unclassified 1403
508 nmdc:mga05p37_497362_c1 3300050507 Bacteria 1400
509 nmdc:mga05p37_920_c1 3300050507 Bacteria 33204
510 nmdc:mga09592_15686_c1 3300050508 Bacteria 6190
511 nmdc:mga09592_200898_c1 3300050508 Bacteria 1726
512 nmdc:mga09592_273250_c1 3300050508 Bacteria 1466
513 nmdc:mga09592_8520_c1 3300050508 Bacteria 8341
514 nmdc:mga0qj67_1834_c1 3300050509 Bacteria 15051
515 nmdc:mga0qj67_41438_c1 3300050509 Unclassified 3622
516 nmdc:mga06r32_10976_c1 3300050510 Bacteria 8156
517 nmdc:mga06r32_120437_c1 3300050510 Unclassified 2588
518 nmdc:mga06r32_45749_c2 3300050510 Bacteria 3166
519 nmdc:mga06r32_76226_c1 3300050510 Unclassified 3256
520 nmdc:mga06r32_81484_c1 3300050510 Bacteria 3151
521 nmdc:mga08y16_123_c1 3300050511 Bacteria 67229
522 nmdc:mga08y16_141598_c1 3300050511 Bacteria 2500
523 nmdc:mga0n895_11028_c1 3300050512 Bacteria 8035
524 nmdc:mga0n895_194386_c1 3300050512 Bacteria 2060
525 nmdc:mga0n895_37655_c1 3300050512 Bacteria 4681
526 nmdc:mga0n895_58562_c1 3300050512 Bacteria 3798
527 nmdc:mga0n895_69166_c1 3300050512 Bacteria 3498
528 nmdc:mga0n895_9896_c1 3300050512 Bacteria 8384
529 nmdc:mga08x19_14084_c1 3300050514 Bacteria 4847
530 nmdc:mga08x19_38370_c1 3300050514 Bacteria 3044
531 nmdc:mga08x19_8137_c1 3300050514 Bacteria 6230
532 nmdc:mga08x19_92678_c1 3300050514 Bacteria 1996
533 nmdc:mga0a205_23918_c2 3300050515 Bacteria 4907
534 nmdc:mga0a205_3439_c1 3300050515 Bacteria 14126
535 nmdc:mga0a205_651739_c1 3300050515 Bacteria 904
536 nmdc:mga0a205_7178_c1 3300050515 Bacteria 10070
537 Ga0500555_000692 3300053103 Bacteria 12751
538 Ga0500568_0008647 3300053139 Bacteria 4889
539 Ga0500616_0000603 3300053153 Bacteria 43497
540 Ga0500645_000048 3300053730 Bacteria 103273
541 Ga0501084_0522506 3300054114 Bacteria 1003
542 Ga0501082_0550158 3300060353 Bacteria 1009
543 Ga0105249_10036188
544 MRS1b_contig_1945423
545 Ga0065712_10079017
546 Ga0065712_10082157
547 Ga0065715_10001124
548 Ga0065715_10182885
549 Ga0065707_10256022
550 Ga0070658_10006626
551 Ga0070658_10049886
552 Ga0070676_10157945
553 Ga0070683_100003346
554 Ga0070683_100491278
555 Ga0070690_100124009
556 Ga0070690_100137003
557 Ga0070670_100027822
558 Ga0070670_100142143
559 Ga0070677_10033156
560 Ga0068869_100173368
561 Ga0070666_10019684
562 Ga0070680_100007058
563 Ga0070680_100184325
564 Ga0070682_100010414
565 Ga0070682_100012824
566 Ga0070682_100160726
567 Ga0070682_100454489
568 Ga0068868_100116022
569 Ga0068868_100315098
570 Ga0070660_100393781
571 Ga0070689_100027995
572 Ga0070689_100226809
573 Ga0070687_100269173
574 Ga0070687_100359132
575 Ga0070661_100073924
576 Ga0070661_100370076
577 Ga0070668_100242149
578 Ga0070675_100033170
579 Ga0070675_100052546
580 Ga0070671_100132194
581 Ga0070671_100234861
582 Ga0070671_100268697
583 Ga0070674_100013920
584 Ga0070674_100019028
585 Ga0070673_100013458
586 Ga0070673_100078911
587 Ga0070673_100286224
588 Ga0070673_100589149
589 Ga0070688_100004821
590 Ga0070659_100057715
591 Ga0070659_100132613
592 Ga0070667_100013901
593 Ga0070667_100153622
594 Ga0070703_10010503
595 Ga0070703_10038233
596 Ga0070709_10001160
597 Ga0070714_100052347
598 Ga0070713_100056309
599 Ga0070701_10069620
600 Ga0070711_100000195
601 Ga0070711_100017138
602 Ga0070711_100264430
603 Ga0070705_100144871
604 Ga0070700_100003668
605 Ga0070700_100175037
606 Ga0070694_100009885
607 Ga0070694_100016142
608 Ga0070694_100056117
609 Ga0070708_100000165
610 Ga0070708_100040676
611 Ga0070708_100351542
612 Ga0070663_100015014
613 Ga0070663_100505203
614 Ga0070678_100224532
615 Ga0070662_100017946
616 Ga0070662_100166835
617 Ga0070681_10088708
618 Ga0070681_10096273
619 Ga0068867_100177877
620 Ga0068867_100182638
621 Ga0070685_10121223
622 Ga0070706_100012074
623 Ga0070706_100028015
624 Ga0070706_100042646
625 Ga0070706_100055100
626 Ga0070706_100075490
627 Ga0070706_100083798
628 Ga0070706_100133153
629 Ga0070707_100024301
630 Ga0070707_100052657
631 Ga0070707_100071497
632 Ga0070707_100072644
633 Ga0070707_100137194
634 Ga0070698_100000323
635 Ga0070698_100008013
636 Ga0070698_100020057
637 Ga0070698_100041726
638 Ga0070699_100004886
639 Ga0070699_100006075
640 Ga0070699_100012305
641 Ga0070699_100032768
642 Ga0070699_100054832
643 Ga0070699_100229891
644 Ga0070699_100465003
645 Ga0070679_100065099
646 Ga0070679_100071302
647 Ga0070684_100002450
648 Ga0070684_100159371
649 Ga0070697_100001200
650 Ga0070697_100004413
651 Ga0070697_100043174
652 Ga0070697_100077163
653 Ga0070697_100082837
654 Ga0070697_100155081
655 Ga0070697_100292798
656 Ga0070697_100461376
657 Ga0068853_100017014
658 Ga0068853_100201908
659 Ga0068853_100295907
660 Ga0070672_100031721
661 Ga0070672_100084349
662 Ga0070672_100228869
663 Ga0070672_100280140
664 Ga0070686_100037096
665 Ga0070686_100073506
666 Ga0070686_100395451
667 Ga0070695_100051097
668 Ga0070696_100002418
669 Ga0070696_100108038
670 Ga0070693_100039519
671 Ga0070665_100002549
672 Ga0070665_100003356
673 Ga0070704_100003522
674 Ga0070704_100031827
675 Ga0070704_100137312
676 Ga0068855_100260868
677 Ga0068855_100428268
678 Ga0070664_100001232
679 Ga0070664_100048770
680 Ga0070664_100252638
681 Ga0068857_100050311
682 Ga0068854_100128872
683 Ga0068856_100376985
684 Ga0070702_100084745
685 Ga0070702_100375610
686 Ga0068852_100027081
687 Ga0068859_100041617
688 Ga0068859_100091693
689 Ga0068859_100115754
690 Ga0068859_100200630
691 Ga0068859_100845664
692 Ga0068864_100085378
693 Ga0068864_100162549
694 Ga0068864_100316960
695 Ga0068864_100322339
696 Ga0068866_10042064
697 Ga0068866_10102488
698 Ga0068866_10223438
699 Ga0068861_100025278
700 Ga0068861_100065289
701 Ga0068870_10019028
702 Ga0068870_10020288
703 Ga0068863_100060329
704 Ga0068863_100164672
705 Ga0068863_100393767
706 Ga0068858_100000368
707 Ga0068858_100044074
708 Ga0068858_100128186
709 Ga0068858_100572690
710 Ga0068860_100039559
711 Ga0068862_100038830
712 Ga0068862_100058944
713 Ga0070717_10162572
714 Ga0075364_10012845
715 Ga0075364_10180754
716 Ga0070716_100007014
717 Ga0070716_100055124
718 Ga0070716_100095888
719 Ga0075367_10016285
720 Ga0075367_10049568
721 Ga0075367_10125087
722 Ga0097621_100019033
723 Ga0097621_100160210
724 Ga0097621_100357129
725 Ga0075370_10077740
726 Ga0068871_100046511
727 Ga0075430_100016969
728 Ga0075430_100017198
729 Ga0075430_100358993
730 Ga0075431_100044300
731 Ga0075431_100134113
732 Ga0075431_100550104
733 Ga0075433_10000491
734 Ga0075433_10022061
735 Ga0075433_10022765
736 Ga0075433_10033787
737 Ga0075434_100001808
738 Ga0075434_100063157
739 Ga0075434_100163714
740 Ga0075434_100699627
741 Ga0075429_100030546
742 Ga0068865_100028512
743 Ga0068865_100282070
744 Ga0075436_100006065
745 Ga0075436_100008315
746 Ga0075436_100048632
747 Ga0075436_100074286
748 Ga0097620_100041617
749 Ga0097620_100091692
750 Ga0097620_100115757
751 Ga0097620_100200630
752 Ga0097620_100845823
753 Ga0075435_100003788
754 Ga0075435_100021359
755 Ga0099794_10042432
756 Ga0099794_10061583
757 Ga0105240_10038547
758 Ga0105240_10046028
759 Ga0111539_10036630
760 Ga0111539_10062081
761 Ga0111539_10076640
762 Ga0111539_10268802
763 Ga0111539_10381559
764 Ga0105245_10018160
765 Ga0114129_10001626
766 Ga0114129_10021237
767 Ga0114129_10168481
768 Ga0114129_10243422
769 Ga0114129_10254510
770 Ga0114129_11043687
771 Ga0105243_10152053
772 Ga0105243_10171246
773 Ga0105241_10134230
774 Ga0105242_10099252
775 Ga0105242_10140228
776 Ga0105242_10149216
777 Ga0105242_10295452
778 Ga0105248_10065909
779 Ga0105248_10079995
780 Ga0105237_10026416
781 Ga0105237_10078805
782 Ga0105237_10079125
783 Ga0105238_10045193
784 Ga0105249_10068501
785 Ga0105249_10368232
786 Ga0105239_10352961
787 Ga0105239_10563585
788 Ga0105239_10641659
789 Ga0105246_10106968
790 Ga0157371_10382076
791 Ga0157369_10053783
792 Ga0157374_10031631
793 Ga0157374_10052539
794 Ga0157374_10168526
795 Ga0157374_10183569
796 Ga0157374_10307479
797 Ga0157378_10023604
798 Ga0163162_10023938
799 Ga0163162_10024428
800 Ga0163162_10174248
801 Ga0157372_10184862
802 Ga0157375_10096019
803 Ga0157375_10815086
804 Ga0163163_10007635
805 Ga0163163_10766509
806 Ga0157380_10007576
807 Ga0157380_10061285
808 Ga0157380_10120204
809 Ga0157380_10335018
810 Ga0157380_10395749
811 Ga0157377_10167992
812 Ga0157379_10150771
813 Ga0157376_10056515
814 Ga0157376_10286562
815 Ga0157376_10431005
816 Ga0157376_10531835
817 Ga0163161_10054297
818 Ga0163161_10280319
819 Ga0163161_10465876
820 Ga0224572_1004491
821 Ga0228598_1000070
822 Ga0207697_10000564
823 Ga0207697_10005597
824 Ga0207653_10002656
825 Ga0207653_10008826
826 Ga0207653_10083155
827 Ga0207682_10002324
828 Ga0207682_10003921
829 Ga0207642_10045032
830 Ga0207710_10003317
831 Ga0207680_10119374
832 Ga0207699_10001633
833 Ga0207643_10007214
834 Ga0207643_10028397
835 Ga0207705_10024979
836 Ga0207705_10296592
837 Ga0207684_10001813
838 Ga0207684_10006271
839 Ga0207684_10040297
840 Ga0207684_10042800
841 Ga0207684_10064517
842 Ga0207684_10134163
843 Ga0207684_10189671
844 Ga0207684_10283736
845 Ga0207684_10303888
846 Ga0207707_10010640
847 Ga0207707_10038534
848 Ga0207695_10089625
849 Ga0207671_10009653
850 Ga0207671_10079053
851 Ga0207671_10230174
852 Ga0207663_10000052
853 Ga0207663_10233375
854 Ga0207660_10027546
855 Ga0207660_10027736
856 Ga0207657_10359067
857 Ga0207649_10037764
858 Ga0207652_10013391
859 Ga0207646_10002097
860 Ga0207646_10021514
861 Ga0207646_10029001
862 Ga0207646_10068682
863 Ga0207681_10053327
864 Ga0207681_10557110
865 Ga0207650_10085824
866 Ga0207650_10167437
867 Ga0207650_10220557
868 Ga0207700_10000090
869 Ga0207700_10083720
870 Ga0207664_10067366
871 Ga0207644_10307076
872 Ga0207690_10161300
873 Ga0207706_10145133
874 Ga0207686_10067594
875 Ga0207709_10077675
876 Ga0207709_10204358
877 Ga0207670_10225315
878 Ga0207704_10459064
879 Ga0207665_10003319
880 Ga0207665_10015934
881 Ga0207665_10175836
882 Ga0207691_10010573
883 Ga0207691_10022290
884 Ga0207691_10165752
885 Ga0207691_10204309
886 Ga0207711_10101063
887 Ga0207689_10009693
888 Ga0207689_10012448
889 Ga0207689_10050879
890 Ga0207661_10105222
891 Ga0207661_10300925
892 Ga0207679_10037340
893 Ga0207679_10068729
894 Ga0207651_10016621
895 Ga0207712_10069881
896 Ga0207668_10054824
897 Ga0207668_10670895
898 Ga0207640_10216360
899 Ga0207640_10253651
900 Ga0207658_10073907
901 Ga0207658_10339276
902 Ga0207677_10052999
903 Ga0207703_10003410
904 Ga0207703_10458424
905 Ga0207703_10553848
906 Ga0207639_10095493
907 Ga0207639_10189617
908 Ga0207639_10285208
909 Ga0207639_10450376
910 Ga0207678_10076098
911 Ga0207678_10399220
912 Ga0207678_10420922
913 Ga0207708_10008491
914 Ga0207708_10234462
915 Ga0207641_10000662
916 Ga0207641_10068976
917 Ga0207641_10120778
918 Ga0207641_10156403
919 Ga0207641_10369795
920 Ga0207648_10062866
921 Ga0207648_10285223
922 Ga0207676_10139971
923 Ga0207676_10157635
924 Ga0207674_10000978
925 Ga0207675_100129400
926 Ga0207675_100171971
927 Ga0207675_100203987
928 Ga0207683_10000888
929 Ga0207683_10051464
930 Ga0207683_10061609
931 Ga0207698_10025410
932 Ga0209588_1010606
933 Ga0209971_1004403
934 Ga0265354_1002819
935 Ga0268266_10006654
936 Ga0268266_10423246
937 Ga0268265_10099759
938 Ga0268265_10109579
939 Ga0268265_10440229
940 Ga0268264_10000122
941 Ga0268264_10497449
942 Ga0265338_10022157
943 Ga0265760_10005710
944 Ga0265331_10016580
945 Ga0265331_10097091
946 Ga0307513_10012824
947 Ga0307513_10021372
948 Ga0307513_10045864
949 Ga0307513_10090994
950 Ga0307408_100000682
951 Ga0307408_100012219
952 Ga0307408_100070793
953 Ga0307408_100320511
954 Ga0265342_10059746
955 Ga0307405_10000099
956 Ga0307413_10191998
957 Ga0307412_10000273
958 Ga0307409_100000161
959 Ga0307409_100856728
960 Ga0307416_100000254
961 Ga0307416_100132733
962 Ga0307416_100191118
963 Ga0307411_10000063
964 Ga0307510_10000001
965 Ga0307510_10044569
966 Ga0373955_0157308
967 Ga0436361_1008353
968 Ga0436363_0567565
969 Ga0436363_1003189
970 Ga0451789_0667279
971 Ga0451791_0234732
972 Ga0451800_0355439
973 Ga0451802_0996640
974 Ga0451807_1522411
975 Ga0439450_012597
976 Ga0439459_0030017
977 Ga0451577_0094291
978 Ga0466969_0044280
979 Ga0453683_0020390
980 Ga0453683_0134268
981 Ga0453683_0276211
982 Ga0466963_0134474
983 Ga0453684_0726629
984 Ga0466959_0072118
985 Ga0495638_0002426
986 Ga0495638_0069155
987 Ga0495638_0080516
988 Ga0495648_0088245
989 Ga0495625_0155610
990 Ga0495635_0091466
991 Ga0495589_0170980
992 Ga0495600_0143845
993 Ga0495672_0199106
994 Ga0496101_0442720
995 Ga0496102_0013583
996 Ga0496102_0295895
997 Ga0496104_0015811
998 Ga0496104_0118534
999 Ga0496104_0169834
1000 Ga0496105_0070944
1001 Ga0496105_0396946
1002 Ga0496105_0461770
1003 Ga0496106_0194497
1004 Ga0496106_0196045
1005 Ga0496108_0054000
1006 Ga0496109_0001987
1007 Ga0496110_0061179
1008 Ga0496110_0458620
1009 Ga0496111_0009789
1010 Ga0496112_0000728
1011 Ga0496112_0048837
1012 Ga0496112_0074186
1013 Ga0496113_0046689
1014 Ga0496114_0033044
1015 Ga0496114_0193815
1016 Ga0496115_0011554
1017 Ga0496115_0072993
1018 Ga0496116_0030827
1019 Ga0496117_0000012
1020 Ga0496118_0000003
1021 Ga0496119_0000232
1022 Ga0496120_0000061
1023 Ga0496120_0067941
1024 Ga0496121_0015314
1025 Ga0496125_0001449
1026 Ga0496126_0002535
1027 Ga0496126_0028728
1028 Ga0496126_0069232
1029 Ga0501292_012215
1030 Ga0501070_0094979
1031 Ga0501070_0356953
1032 Ga0501074_0060085
1033 Ga0501076_0277057
1034 Ga0501216_008480
1035 Ga0501217_005638
1036 Ga0501233_030959
1037 Ga0501079_0294651
1038 Ga0501079_0507414
1039 nmdc:mga03683_128653_c1
1040 nmdc:mga00v17_27200_c1
1041 nmdc:mga00v17_343269_c1
1042 nmdc:mga00v17_81872_c1
1043 nmdc:mga0k408_15981_c1
1044 nmdc:mga06z11_25466_c1
1045 nmdc:mga06z11_64196_c1
1046 nmdc:mga07m45_44302_c1
1047 nmdc:mga05p37_151249_c1
1048 nmdc:mga05p37_200572_c1
1049 nmdc:mga05p37_495648_c1
1050 nmdc:mga05p37_497362_c1
1051 nmdc:mga05p37_920_c1
1052 nmdc:mga09592_15686_c1
1053 nmdc:mga09592_200898_c1
1054 nmdc:mga09592_273250_c1
1055 nmdc:mga09592_8520_c1
1056 nmdc:mga0qj67_1834_c1
1057 nmdc:mga0qj67_41438_c1
1058 nmdc:mga06r32_10976_c1
1059 nmdc:mga06r32_120437_c1
1060 nmdc:mga06r32_45749_c2
1061 nmdc:mga06r32_76226_c1
1062 nmdc:mga06r32_81484_c1
1063 nmdc:mga08y16_123_c1
1064 nmdc:mga08y16_141598_c1
1065 nmdc:mga0n895_11028_c1
1066 nmdc:mga0n895_194386_c1
1067 nmdc:mga0n895_37655_c1
1068 nmdc:mga0n895_58562_c1
1069 nmdc:mga0n895_69166_c1
1070 nmdc:mga0n895_9896_c1
1071 nmdc:mga08x19_14084_c1
1072 nmdc:mga08x19_38370_c1
1073 nmdc:mga08x19_8137_c1
1074 nmdc:mga08x19_92678_c1
1075 nmdc:mga0a205_23918_c2
1076 nmdc:mga0a205_3439_c1
1077 nmdc:mga0a205_651739_c1
1078 nmdc:mga0a205_7178_c1
1079 Ga0500555_000692
1080 Ga0500568_0008647
1081 Ga0500616_0000603
1082 Ga0500645_000048
1083 Ga0501084_0522506
1084 Ga0501082_0550158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12710

HAD

haloacid dehalogenase-like hydrolase

45

221

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eze-assembly2.cif.gz_B crystal structure of had family hydrolase t0658 from salmonella enterica subsp. enterica serovar typhi (target efi-501419) 0.8195 5 223
4eze-assembly1.cif.gz_A crystal structure of had family hydrolase t0658 from salmonella enterica subsp. enterica serovar typhi (target efi-501419) 0.8185 4 199
1l7n-assembly1.cif.gz_A transition state analogue of phosphoserine phosphatase (aluminum fluoride complex) 0.8167 7 223
5t41-assembly1.cif.gz_A crystal structure of mycobacterium avium serb2 mutant s275a/r279a at ph 6.6 with ethylene glycol bound at act- i domain 0.8123 9 243
5jlp-assembly1.cif.gz_A crystal structure of mycobacterium avium serb2 in complex with serine at act domain 0.8122 9 243
ID Description Score Start End Superfamily
af_Q58989_1_211_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8261 7 223 3.40.50.1000
4ezeB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8195 5 223 3.40.50.1000
af_Q2R0W7_141_295_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8116 82 223 3.40.50.1000
af_Q5A0H3_6_290_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8045 6 222 3.40.50.1000
af_Q58989_1_211_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8014 7 223 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A317I6M0-F1-model_v4 deleted 0.9668 6 256
AF-A0A2V8HHX1-F1-model_v4 Haloacid dehalogenase 0.9617 5 130
AF-A0A317I6M0-F1-model_v4 deleted 0.9593 6 256
AF-A0A1G1J2X5-F1-model_v4 Haloacid dehalogenase 0.9552 6 257
AF-A0A2J0KT75-F1-model_v4 Haloacid dehalogenase 0.95 6 257

Map