F461433

General Info

Members Datasets Scaffolds Average Seq Length
541 283 541 195

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0364205|Ga0501082_0364205_348_1058
Length 236
Sequence MTALGDSKADAHSPGVWTSVPSKAVSVEKGSDPLIAVLISGRGSNLQALIQAADAGRLHARIVLVISNVEGVEGIAHAERAGIETLVIPHRQFVARADFDRALVDALRSKNVALVCLAGFMRRLGPDFCRAFPNAILNIHPSLLPAFPGVDAQRQALEHGVKLTGATVHFVTPELDAGPIVLQRAVPVLDNDSAATLAARVLAVEHAIYPEAVQRVLNGQWRIVGRRVVFEDGPGG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
194 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
198 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
199 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 1.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 3.33
Rhizosphere 94.09
Stem 0
Stem Tuber 0
Unclassified 2.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10067477 3300003203 Unclassified 1133
2 rootH1_10082928 3300003323 Bacteria 8713
3 Ga0065712_10076849 3300005290 Bacteria 3591
4 Ga0065712_10079731 3300005290 Bacteria 3184
5 Ga0065715_10028950 3300005293 Unclassified 1356
6 Ga0065715_10129845 3300005293 Bacteria 2038
7 Ga0065707_10022485 3300005295 Bacteria 1857
8 Ga0070658_10535862 3300005327 Bacteria 1013
9 Ga0070683_100114159 3300005329 Bacteria 2549
10 Ga0070683_100242391 3300005329 Bacteria 1715
11 Ga0070683_100363900 3300005329 Bacteria 1377
12 Ga0068869_100020145 3300005334 Bacteria 4569
13 Ga0070680_100096408 3300005336 Bacteria 2452
14 Ga0070680_100165194 3300005336 Bacteria 1861
15 Ga0070680_100183214 3300005336 Bacteria 1764
16 Ga0070680_100212323 3300005336 Bacteria 1633
17 Ga0070680_100829489 3300005336 Bacteria 797
18 Ga0070682_100016951 3300005337 Bacteria 4241
19 Ga0070682_100021222 3300005337 Bacteria 3828
20 Ga0070682_100565630 3300005337 Bacteria 892
21 Ga0070682_101181825 3300005337 Bacteria 645
22 Ga0068868_100444075 3300005338 Unclassified 1127
23 Ga0070660_100015990 3300005339 Bacteria 5435
24 Ga0070660_100051551 3300005339 Bacteria 3169
25 Ga0070660_100157933 3300005339 Bacteria 1826
26 Ga0070689_100005731 3300005340 Bacteria 8517
27 Ga0070689_100070205 3300005340 Bacteria 2734
28 Ga0070691_10078768 3300005341 Bacteria 1610
29 Ga0070691_10144199 3300005341 Bacteria 1216
30 Ga0070687_100113439 3300005343 Bacteria 1538
31 Ga0070661_100071796 3300005344 Bacteria 2547
32 Ga0070669_100040918 3300005353 Bacteria 3369
33 Ga0070669_100131827 3300005353 Bacteria 1918
34 Ga0070669_100679240 3300005353 Bacteria 868
35 Ga0070669_100780965 3300005353 Bacteria 811
36 Ga0070675_100634958 3300005354 Unclassified 970
37 Ga0070671_100599960 3300005355 Bacteria 951
38 Ga0070673_100005605 3300005364 Bacteria 8050
39 Ga0070688_100188395 3300005365 Unclassified 1436
40 Ga0070659_100338714 3300005366 Bacteria 1260
41 Ga0070667_100061597 3300005367 Bacteria 3177
42 Ga0070703_10000078 3300005406 Bacteria 48341
43 Ga0070703_10042759 3300005406 Bacteria 1418
44 Ga0070709_10000237 3300005434 Bacteria 35643
45 Ga0070713_100061720 3300005436 Bacteria 3136
46 Ga0070701_10056091 3300005438 Bacteria 2060
47 Ga0070711_100000027 3300005439 Bacteria 108952
48 Ga0070711_101092470 3300005439 Bacteria 687
49 Ga0070705_100000397 3300005440 Bacteria 25329
50 Ga0070705_100242180 3300005440 Bacteria 1261
51 Ga0070705_100618144 3300005440 Bacteria 840
52 Ga0070700_100000170 3300005441 Bacteria 36874
53 Ga0070700_100048296 3300005441 Bacteria 2637
54 Ga0070700_100260312 3300005441 Bacteria 1249
55 Ga0070694_100135355 3300005444 Unclassified 1785
56 Ga0070708_100235611 3300005445 Unclassified 1718
57 Ga0070708_100309336 3300005445 Bacteria 1488
58 Ga0070708_100515168 3300005445 Unclassified 1128
59 Ga0070663_100152497 3300005455 Bacteria 1773
60 Ga0070663_100757966 3300005455 Bacteria 829
61 Ga0070678_100137571 3300005456 Bacteria 1950
62 Ga0070678_100630552 3300005456 Bacteria 960
63 Ga0070681_10002092 3300005458 Bacteria 18139
64 Ga0070681_10702839 3300005458 Bacteria 927
65 Ga0068867_100030558 3300005459 Bacteria 3885
66 Ga0070706_100000320 3300005467 Bacteria 58537
67 Ga0070707_100104089 3300005468 Bacteria 2751
68 Ga0070707_100105397 3300005468 Bacteria 2734
69 Ga0070707_100602523 3300005468 Bacteria 1061
70 Ga0070707_100636489 3300005468 Bacteria 1029
71 Ga0070698_100094636 3300005471 Bacteria 2966
72 Ga0070699_100000194 3300005518 Bacteria 59391
73 Ga0070699_100128227 3300005518 Bacteria 2235
74 Ga0070679_100073685 3300005530 Bacteria 3405
75 Ga0070679_100092231 3300005530 Bacteria 3017
76 Ga0070679_100184386 3300005530 Bacteria 2058
77 Ga0070684_100136286 3300005535 Bacteria 2218
78 Ga0070684_100300706 3300005535 Bacteria 1472
79 Ga0070697_100583382 3300005536 Bacteria 982
80 Ga0070686_100078311 3300005544 Bacteria 2182
81 Ga0070695_100103810 3300005545 Bacteria 1918
82 Ga0070695_100432455 3300005545 Bacteria 1004
83 Ga0070695_100686475 3300005545 Unclassified 811
84 Ga0070696_100000242 3300005546 Bacteria 32817
85 Ga0070696_100012684 3300005546 Bacteria 5659
86 Ga0070696_100034272 3300005546 Bacteria 3492
87 Ga0070696_100125214 3300005546 Bacteria 1864
88 Ga0070693_100006521 3300005547 Bacteria 5659
89 Ga0070665_100174006 3300005548 Bacteria 2153
90 Ga0070665_100387467 3300005548 Bacteria 1405
91 Ga0070704_100020419 3300005549 Plasmid 4271
92 Ga0070704_100131470 3300005549 Bacteria 1941
93 Ga0068855_100042669 3300005563 Bacteria 5374
94 Ga0068855_100046978 3300005563 Bacteria 5102
95 Ga0068855_100082698 3300005563 Bacteria 3721
96 Ga0068855_100136474 3300005563 Bacteria 2798
97 Ga0068855_100288186 3300005563 Bacteria 1821
98 Ga0068857_100108040 3300005577 Bacteria 2500
99 Ga0068856_100010271 3300005614 Bacteria 9099
100 Ga0068856_100387327 3300005614 Bacteria 1417
101 Ga0070702_100006054 3300005615 Bacteria 5697
102 Ga0068852_101303792 3300005616 Bacteria 748
103 Ga0068852_101349730 3300005616 Bacteria 735
104 Ga0068859_100031477 3300005617 Bacteria 5327
105 Ga0068859_100745773 3300005617 Bacteria 1068
106 Ga0068864_100453078 3300005618 Bacteria 1227
107 Ga0068861_100041667 3300005719 Bacteria 3439
108 Ga0068870_10116245 3300005840 Bacteria 1534
109 Ga0068860_100086874 3300005843 Bacteria 2977
110 Ga0081539_10017940 3300005985 Bacteria 4938
111 Ga0070717_10096757 3300006028 Bacteria 2501
112 Ga0070716_100030951 3300006173 Bacteria 2908
113 Ga0070712_100046551 3300006175 Bacteria 2999
114 Ga0070712_100340092 3300006175 Bacteria 1225
115 Ga0075366_10176568 3300006195 Bacteria 1297
116 Ga0097621_100770035 3300006237 Bacteria 890
117 Ga0068871_100829308 3300006358 Bacteria 854
118 Ga0075428_101223627 3300006844 Bacteria 791
119 Ga0075433_10047503 3300006852 Bacteria 3734
120 Ga0075433_10391826 3300006852 Unclassified 1226
121 Ga0075433_10749004 3300006852 Bacteria 855
122 Ga0075434_100083879 3300006871 Bacteria 3185
123 Ga0075434_100246401 3300006871 Bacteria 1806
124 Ga0075434_101243963 3300006871 Bacteria 756
125 Ga0075436_100112529 3300006914 Unclassified 1901
126 Ga0097620_100031476 3300006931 Bacteria 5327
127 Ga0097620_100745703 3300006931 Bacteria 1068
128 Ga0075435_100007214 3300007076 Bacteria 7906
129 Ga0075435_100044799 3300007076 Unclassified 3544
130 Ga0075435_100136550 3300007076 Bacteria 2055
131 Ga0075435_100703797 3300007076 Bacteria 878
132 Ga0105240_10038474 3300009093 Bacteria 6136
133 Ga0105240_10043979 3300009093 Bacteria 5679
134 Ga0105240_10059800 3300009093 Bacteria 4753
135 Ga0105240_10178015 3300009093 Bacteria 2512
136 Ga0111539_10005968 3300009094 Bacteria 15728
137 Ga0111539_10056813 3300009094 Bacteria 4650
138 Ga0111539_10064851 3300009094 Bacteria 4319
139 Ga0111539_10104832 3300009094 Bacteria 3317
140 Ga0111539_10617462 3300009094 Bacteria 1263
141 Ga0105245_10857687 3300009098 Bacteria 948
142 Ga0114129_10091695 3300009147 Bacteria 4209
143 Ga0105243_10052612 3300009148 Bacteria 3226
144 Ga0105241_10385211 3300009174 Bacteria 1226
145 Ga0105242_10003683 3300009176 Bacteria 11925
146 Ga0105242_10114118 3300009176 Bacteria 2308
147 Ga0105248_10300698 3300009177 Unclassified 1807
148 Ga0105237_10035751 3300009545 Bacteria 5025
149 Ga0105237_10060028 3300009545 Bacteria 3804
150 Ga0105238_10032775 3300009551 Bacteria 5287
151 Ga0105238_10203052 3300009551 Bacteria 1958
152 Ga0105249_10670348 3300009553 Bacteria 1096
153 Ga0105249_10744121 3300009553 Bacteria 1042
154 Ga0105239_10160945 3300010375 Bacteria 2508
155 Ga0105239_10295409 3300010375 Bacteria 1824
156 Ga0105239_10306283 3300010375 Bacteria 1790
157 Ga0105239_10515325 3300010375 Bacteria 1360
158 Ga0105246_10187530 3300011119 Bacteria 1598
159 Ga0157373_10152302 3300013100 Bacteria 1627
160 Ga0157370_10043974 3300013104 Bacteria 4297
161 Ga0157370_10045451 3300013104 Bacteria 4213
162 Ga0157370_10114752 3300013104 Bacteria 2516
163 Ga0157369_10000065 3300013105 Bacteria 144865
164 Ga0157369_10007645 3300013105 Bacteria 12431
165 Ga0157369_10128181 3300013105 Bacteria 2689
166 Ga0157369_10436001 3300013105 Bacteria 1357
167 Ga0157374_10083902 3300013296 Bacteria 3027
168 Ga0157374_10207649 3300013296 Bacteria 1920
169 Ga0157378_10341049 3300013297 Bacteria 1461
170 Ga0157378_10433698 3300013297 Unclassified 1301
171 Ga0163162_10003181 3300013306 Bacteria 15701
172 Ga0157372_10842694 3300013307 Bacteria 1064
173 Ga0163163_11142696 3300014325 Bacteria 841
174 Ga0157379_10139969 3300014968 Bacteria 2181
175 Ga0157376_10830137 3300014969 Bacteria 938
176 Ga0197907_10906224 3300020069 Bacteria 971
177 Ga0206356_10288393 3300020070 Bacteria 2100
178 Ga0206354_11178999 3300020081 Bacteria 1974
179 Ga0206353_10262045 3300020082 Bacteria 3052
180 Ga0206353_10266005 3300020082 Bacteria 4806
181 Ga0206353_10277908 3300020082 Bacteria 1684
182 Ga0206353_10708738 3300020082 Bacteria 1462
183 Ga0206353_11885480 3300020082 Bacteria 4428
184 Ga0213876_10000008 3300021384 Bacteria 506740
185 Ga0213876_10002664 3300021384 Bacteria 10424
186 Ga0224712_10288903 3300022467 Unclassified 765
187 Ga0207697_10136436 3300025315 Bacteria 1062
188 Ga0207653_10000021 3300025885 Bacteria 127411
189 Ga0207682_10026996 3300025893 Bacteria 2285
190 Ga0207680_10042140 3300025903 Bacteria 2668
191 Ga0207680_10360755 3300025903 Bacteria 1022
192 Ga0207647_10064073 3300025904 Bacteria 2234
193 Ga0207699_10000017 3300025906 Bacteria 189613
194 Ga0207643_10118423 3300025908 Bacteria 1566
195 Ga0207705_10060919 3300025909 Bacteria 2726
196 Ga0207705_10413515 3300025909 Bacteria 1044
197 Ga0207684_10000394 3300025910 Bacteria 58364
198 Ga0207684_10480375 3300025910 Bacteria 1066
199 Ga0207707_10178712 3300025912 Bacteria 1853
200 Ga0207695_10072469 3300025913 Bacteria 3514
201 Ga0207695_10214728 3300025913 Bacteria 1833
202 Ga0207671_10037220 3300025914 Bacteria 3609
203 Ga0207693_10058864 3300025915 Bacteria 3010
204 Ga0207693_10754190 3300025915 Bacteria 752
205 Ga0207663_10000006 3300025916 Bacteria 253740
206 Ga0207663_10224910 3300025916 Bacteria 1367
207 Ga0207660_10119870 3300025917 Bacteria 1991
208 Ga0207660_10279949 3300025917 Bacteria 1323
209 Ga0207660_10805134 3300025917 Bacteria 767
210 Ga0207662_10027645 3300025918 Bacteria 3274
211 Ga0207662_10231109 3300025918 Bacteria 1208
212 Ga0207657_10000275 3300025919 Bacteria 54762
213 Ga0207657_10001050 3300025919 Bacteria 29283
214 Ga0207657_10216756 3300025919 Bacteria 1535
215 Ga0207649_10770110 3300025920 Bacteria 750
216 Ga0207652_10080235 3300025921 Bacteria 2852
217 Ga0207652_10194101 3300025921 Bacteria 1826
218 Ga0207646_10087953 3300025922 Bacteria 2780
219 Ga0207646_10089140 3300025922 Bacteria 2761
220 Ga0207681_10069176 3300025923 Bacteria 2455
221 Ga0207681_10080789 3300025923 Bacteria 2294
222 Ga0207681_11006153 3300025923 Bacteria 699
223 Ga0207694_11301033 3300025924 Bacteria 615
224 Ga0207650_10477483 3300025925 Bacteria 1040
225 Ga0207659_10088672 3300025926 Bacteria 2305
226 Ga0207659_10809768 3300025926 Bacteria 805
227 Ga0207687_10000098 3300025927 Bacteria 63866
228 Ga0207687_10141413 3300025927 Bacteria 1826
229 Ga0207687_10276097 3300025927 Bacteria 1345
230 Ga0207700_10382581 3300025928 Bacteria 1231
231 Ga0207664_10608402 3300025929 Bacteria 981
232 Ga0207644_10126609 3300025931 Bacteria 1950
233 Ga0207644_10139978 3300025931 Bacteria 1862
234 Ga0207690_10083935 3300025932 Bacteria 2232
235 Ga0207690_10716518 3300025932 Bacteria 823
236 Ga0207690_10785722 3300025932 Unclassified 786
237 Ga0207706_10019700 3300025933 Bacteria 6069
238 Ga0207686_10002498 3300025934 Bacteria 9988
239 Ga0207686_10362535 3300025934 Bacteria 1094
240 Ga0207686_10461936 3300025934 Bacteria 978
241 Ga0207670_10000962 3300025936 Bacteria 15187
242 Ga0207670_10049883 3300025936 Bacteria 2802
243 Ga0207670_10058121 3300025936 Bacteria 2626
244 Ga0207669_10101462 3300025937 Bacteria 1904
245 Ga0207669_10212285 3300025937 Bacteria 1414
246 Ga0207704_10184335 3300025938 Bacteria 1512
247 Ga0207665_10021990 3300025939 Bacteria 4193
248 Ga0207691_10046985 3300025940 Bacteria 3964
249 Ga0207711_10076698 3300025941 Bacteria 2912
250 Ga0207711_10291631 3300025941 Bacteria 1504
251 Ga0207689_10036372 3300025942 Bacteria 4088
252 Ga0207661_10063829 3300025944 Bacteria 2984
253 Ga0207661_10210845 3300025944 Bacteria 1712
254 Ga0207667_10078526 3300025949 Bacteria 3421
255 Ga0207667_10079713 3300025949 Bacteria 3393
256 Ga0207667_10933317 3300025949 Bacteria 858
257 Ga0207712_10539325 3300025961 Bacteria 1002
258 Ga0207658_10038047 3300025986 Bacteria 3463
259 Ga0207658_10072971 3300025986 Bacteria 2604
260 Ga0207677_10094236 3300026023 Bacteria 2185
261 Ga0207703_10948017 3300026035 Bacteria 825
262 Ga0207703_10995858 3300026035 Bacteria 804
263 Ga0207639_10000073 3300026041 Bacteria 93577
264 Ga0207678_10329951 3300026067 Bacteria 1313
265 Ga0207708_10000409 3300026075 Bacteria 33843
266 Ga0207708_10033198 3300026075 Bacteria 3920
267 Ga0207708_10129503 3300026075 Bacteria 1972
268 Ga0207702_10194666 3300026078 Bacteria 1875
269 Ga0207702_10247904 3300026078 Bacteria 1671
270 Ga0207702_11023333 3300026078 Bacteria 820
271 Ga0207641_10302967 3300026088 Bacteria 1510
272 Ga0207648_10005814 3300026089 Bacteria 12353
273 Ga0207648_10182773 3300026089 Bacteria 1856
274 Ga0207674_10054187 3300026116 Bacteria 4084
275 Ga0207674_10186955 3300026116 Bacteria 2022
276 Ga0207675_100041575 3300026118 Bacteria 4293
277 Ga0207683_10032747 3300026121 Bacteria 4515
278 Ga0207683_11226653 3300026121 Bacteria 695
279 Ga0207698_10304438 3300026142 Bacteria 1485
280 Ga0207698_10375453 3300026142 Bacteria 1351
281 Ga0207698_10720137 3300026142 Unclassified 994
282 Ga0207428_10000998 3300027907 Bacteria 31385
283 Ga0207428_10081608 3300027907 Bacteria 2524
284 Ga0268265_10186082 3300028380 Bacteria 1789
285 Ga0268265_10735809 3300028380 Unclassified 956
286 Ga0268264_10147354 3300028381 Bacteria 2106
287 Ga0265319_1000068 3300028563 Bacteria 82808
288 Ga0265318_10000040 3300028577 Bacteria 135603
289 Ga0265318_10067405 3300028577 Archaea 1329
290 Ga0265338_10032277 3300028800 Bacteria 5112
291 Ga0265324_10064836 3300029957 Bacteria 1246
292 Ga0265330_10000065 3300031235 Bacteria 91217
293 Ga0265332_10001115 3300031238 Bacteria 15670
294 Ga0265320_10000050 3300031240 Bacteria 116002
295 Ga0265329_10000210 3300031242 Bacteria 30518
296 Ga0265329_10049422 3300031242 Bacteria 1340
297 Ga0265340_10003735 3300031247 Bacteria 8569
298 Ga0265340_10326321 3300031247 Archaea 679
299 Ga0265339_10151614 3300031249 Bacteria 1171
300 Ga0265339_10172574 3300031249 Unclassified 1081
301 Ga0265331_10000265 3300031250 Bacteria 59480
302 Ga0265331_10037927 3300031250 Bacteria 2358
303 Ga0265327_10141441 3300031251 Bacteria 1124
304 Ga0265316_10000389 3300031344 Bacteria 50152
305 Ga0265316_10394978 3300031344 Bacteria 996
306 Ga0307513_10113520 3300031456 Bacteria 2696
307 Ga0307408_100043781 3300031548 Bacteria 3187
308 Ga0265313_10000040 3300031595 Bacteria 120713
309 Ga0307508_10089850 3300031616 Bacteria 2657
310 Ga0265314_10000117 3300031711 Bacteria 122918
311 Ga0265342_10000037 3300031712 Bacteria 140873
312 Ga0307405_10363817 3300031731 Bacteria 1120
313 Ga0307409_100103661 3300031995 Bacteria 2367
314 Ga0307416_100144226 3300032002 Bacteria 2171
315 Ga0307416_100330622 3300032002 Bacteria 1531
316 Ga0373926_0083314 3300035083 Bacteria 1184
317 Ga0373953_0086057 3300035117 Unclassified 1312
318 Ga0373943_0007236 3300035170 Bacteria 4980
319 Ga0373927_0282726 3300035695 Bacteria 1091
320 Ga0373947_0141468 3300035725 Bacteria 1543
321 Ga0395900_0117239 3300037418 Bacteria 2732
322 Ga0395900_0259520 3300037418 Bacteria 1736
323 Ga0395900_0930647 3300037418 Bacteria 791
324 Ga0395898_0032692 3300037466 Bacteria 5193
325 Ga0395898_0058671 3300037466 Bacteria 3746
326 Ga0395898_0239011 3300037466 Bacteria 1732
327 Ga0395898_0581146 3300037466 Bacteria 1063
328 Ga0395898_0767721 3300037466 Bacteria 905
329 Ga0395905_0159594 3300037471 Bacteria 2120
330 Ga0395905_0247522 3300037471 Bacteria 1665
331 Ga0395901_0025438 3300038443 Bacteria 6076
332 Ga0395901_0040004 3300038443 Bacteria 4853
333 Ga0395901_0081344 3300038443 Bacteria 3383
334 Ga0395901_0837697 3300038443 Bacteria 906
335 Ga0436365_0221520 3300039437 Bacteria 1770
336 Ga0436365_0670421 3300039437 Bacteria 180224
337 Ga0436365_1511658 3300039437 Bacteria 2360
338 Ga0436360_1049875 3300039438 Bacteria 2726
339 Ga0436362_0561287 3300039453 Bacteria 848
340 Ga0451849_0381006 3300041505 Bacteria 3239
341 Ga0451855_1116450 3300041511 Unclassified 1215
342 Ga0451853_0373412 3300041512 Bacteria 53125
343 Ga0439448_0024922 3300042005 Bacteria 1873
344 Ga0439448_0111672 3300042005 Bacteria 934
345 Ga0450894_032633 3300042131 Bacteria 730
346 Ga0450896_000960 3300042133 Bacteria 3346
347 Ga0450898_010329 3300042134 Bacteria 1509
348 Ga0451577_0002705 3300042876 Bacteria 20628
349 Ga0466963_0027851 3300044694 Bacteria 3623
350 Ga0466963_0064493 3300044694 Bacteria 2454
351 Ga0453684_0005932 3300044712 Bacteria 23693
352 Ga0466957_0007673 3300044842 Bacteria 6101
353 Ga0466957_0028907 3300044842 Bacteria 3303
354 Ga0466957_0215239 3300044842 Bacteria 1267
355 Ga0466957_0222892 3300044842 Bacteria 1246
356 Ga0466957_0664780 3300044842 Archaea 733
357 Ga0466959_0043755 3300045049 Bacteria 3300
358 Ga0451576_0108594 3300045051 Bacteria 2887
359 Ga0466958_0008302 3300045836 Bacteria 5751
360 Ga0466958_0143360 3300045836 Bacteria 1505
361 Ga0466967_0016325 3300045976 Bacteria 5852
362 Ga0466967_0018314 3300045976 Bacteria 5592
363 Ga0466967_0034350 3300045976 Bacteria 4303
364 Ga0466967_0055396 3300045976 Bacteria 3492
365 Ga0466967_0136325 3300045976 Bacteria 2283
366 Ga0466967_0143789 3300045976 Bacteria 2223
367 Ga0466967_0449728 3300045976 Archaea 1259
368 Ga0466967_0506763 3300045976 Bacteria 1185
369 Ga0466967_0640592 3300045976 Unclassified 1050
370 Ga0466967_1125492 3300045976 Bacteria 782
371 Ga0495592_0068694 3300046454 Bacteria 2586
372 Ga0495592_0092010 3300046454 Bacteria 2174
373 Ga0495592_0165046 3300046454 Bacteria 1521
374 Ga0495641_0114369 3300046461 Bacteria 1204
375 Ga0495651_0124079 3300046462 Bacteria 1893
376 Ga0495651_0131251 3300046462 Bacteria 1828
377 Ga0495605_0050203 3300046474 Bacteria 2036
378 Ga0495608_0099425 3300046511 Bacteria 1876
379 Ga0495628_0105411 3300046516 Bacteria 2172
380 Ga0495628_0169720 3300046516 Bacteria 1655
381 Ga0495630_0092367 3300046517 Bacteria 2288
382 Ga0495630_0639542 3300046517 Bacteria 815
383 Ga0495652_0724529 3300046529 Unclassified 667
384 Ga0495640_0113208 3300046533 Bacteria 1771
385 Ga0495586_0002714 3300046535 Bacteria 9580
386 Ga0495587_0021012 3300046536 Bacteria 4026
387 Ga0495645_0059021 3300046543 Bacteria 2783
388 Ga0495645_0200659 3300046543 Bacteria 1353
389 Ga0495667_0116689 3300046559 Bacteria 1724
390 Ga0495656_0059087 3300046615 Bacteria 1667
391 Ga0495657_0092967 3300046675 Bacteria 1931
392 Ga0495657_0180094 3300046675 Bacteria 1298
393 Ga0495599_0059582 3300046678 Bacteria 2388
394 Ga0495599_0070525 3300046678 Bacteria 2181
395 Ga0495599_0094469 3300046678 Bacteria 1865
396 Ga0495599_0179596 3300046678 Bacteria 1305
397 Ga0495646_0037898 3300046680 Bacteria 2980
398 Ga0495674_0102352 3300047319 Bacteria 2436
399 Ga0495676_0157983 3300047321 Bacteria 1607
400 Ga0495680_0665067 3300047322 Bacteria 691
401 Ga0495675_0139443 3300047444 Bacteria 1504
402 Ga0495602_0397090 3300048088 Bacteria 984
403 Ga0496100_0177053 3300048903 Bacteria 1540
404 Ga0496101_0007907 3300048904 Bacteria 6923
405 Ga0496102_0185020 3300048905 Archaea 1963
406 Ga0496102_0517898 3300048905 Bacteria 1115
407 Ga0496104_0199366 3300048907 Bacteria 1914
408 Ga0496107_0023681 3300048910 Bacteria 4340
409 Ga0496107_0069661 3300048910 Bacteria 2554
410 Ga0496109_0039094 3300048912 Bacteria 4293
411 Ga0496110_0206408 3300048913 Bacteria 1786
412 Ga0496110_0378370 3300048913 Bacteria 1290
413 Ga0496112_0007581 3300048915 Bacteria 9642
414 Ga0496112_0026840 3300048915 Bacteria 5549
415 Ga0496112_0729441 3300048915 Bacteria 918
416 Ga0496113_0101885 3300048916 Bacteria 2226
417 Ga0496114_0041443 3300048917 Bacteria 3816
418 Ga0496114_0046958 3300048917 Bacteria 3590
419 Ga0496114_0247390 3300048917 Bacteria 1569
420 Ga0496115_0008439 3300048918 Bacteria 7623
421 Ga0501031_0173524 3300049568 Bacteria 1409
422 Ga0501032_0004392 3300049569 Bacteria 10644
423 Ga0501032_0005707 3300049569 Bacteria 9212
424 Ga0501032_0347682 3300049569 Bacteria 955
425 Ga0501033_0298221 3300049570 Bacteria 1135
426 Ga0501034_0005150 3300049571 Bacteria 14343
427 Ga0501034_0075276 3300049571 Bacteria 3383
428 Ga0501034_0127603 3300049571 Bacteria 2528
429 Ga0501034_0142623 3300049571 Bacteria 2374
430 Ga0501036_0018437 3300049572 Bacteria 5847
431 Ga0501036_0215370 3300049572 Bacteria 1613
432 Ga0501037_0025268 3300049573 Bacteria 4388
433 Ga0501037_0182143 3300049573 Bacteria 1490
434 Ga0501037_0229273 3300049573 Bacteria 1304
435 Ga0501038_0022442 3300049574 Bacteria 5655
436 Ga0501038_0036573 3300049574 Bacteria 4308
437 Ga0501039_0031628 3300049575 Bacteria 4080
438 Ga0501039_0083973 3300049575 Bacteria 2480
439 Ga0501039_0285991 3300049575 Bacteria 1296
440 Ga0501042_0169833 3300049578 Bacteria 1574
441 Ga0501043_0012710 3300049579 Bacteria 6582
442 Ga0501043_0038391 3300049579 Bacteria 3765
443 Ga0501043_0039540 3300049579 Bacteria 3706
444 Ga0501043_0609603 3300049579 Bacteria 805
445 Ga0501046_0005157 3300049580 Bacteria 11710
446 Ga0501046_0047415 3300049580 Bacteria 3406
447 Ga0501046_0383931 3300049580 Bacteria 1016
448 Ga0501046_0436598 3300049580 Bacteria 942
449 Ga0501047_0004351 3300049581 Bacteria 13321
450 Ga0501047_0043189 3300049581 Bacteria 4354
451 Ga0501047_0075319 3300049581 Bacteria 3247
452 Ga0501047_0149332 3300049581 Bacteria 2213
453 Ga0501047_0255833 3300049581 Bacteria 1599
454 Ga0501048_0007911 3300049582 Bacteria 8050
455 Ga0501048_0083249 3300049582 Bacteria 2256
456 Ga0501048_0280253 3300049582 Bacteria 1185
457 Ga0501067_0010991 3300049583 Bacteria 5013
458 Ga0501067_0016421 3300049583 Bacteria 4090
459 Ga0501067_0298128 3300049583 Bacteria 897
460 Ga0501068_0005157 3300049584 Bacteria 7125
461 Ga0501068_0420208 3300049584 Bacteria 863
462 Ga0501069_0011667 3300049585 Bacteria 4659
463 Ga0501070_0056475 3300049586 Bacteria 3254
464 Ga0501070_0095878 3300049586 Bacteria 2454
465 Ga0501070_0280605 3300049586 Bacteria 1359
466 Ga0501070_0682880 3300049586 Bacteria 813
467 Ga0501071_0227525 3300049587 Bacteria 1405
468 Ga0501072_0002379 3300049588 Bacteria 14112
469 Ga0501072_0025885 3300049588 Bacteria 4571
470 Ga0501072_0191085 3300049588 Bacteria 1633
471 Ga0501072_0359158 3300049588 Bacteria 1156
472 Ga0501073_0002377 3300049589 Bacteria 14091
473 Ga0501073_0025811 3300049589 Bacteria 4209
474 Ga0501073_0035129 3300049589 Bacteria 3563
475 Ga0501073_0067440 3300049589 Bacteria 2494
476 Ga0501073_0070929 3300049589 Bacteria 2427
477 Ga0501073_0281465 3300049589 Bacteria 1147
478 Ga0501073_0290535 3300049589 Bacteria 1128
479 Ga0501074_0006600 3300049590 Bacteria 8388
480 Ga0501074_0081185 3300049590 Bacteria 2325
481 Ga0501074_0373418 3300049590 Bacteria 1012
482 Ga0501077_0064679 3300049593 Bacteria 2320
483 Ga0501077_0153051 3300049593 Bacteria 1464
484 Ga0501079_0016754 3300049741 Bacteria 5597
485 Ga0501079_0646497 3300049741 Bacteria 833
486 Ga0501080_0005425 3300049742 Bacteria 11376
487 Ga0501080_0016151 3300049742 Bacteria 6891
488 Ga0501080_0045419 3300049742 Bacteria 4089
489 Ga0501080_0141922 3300049742 Bacteria 2220
490 Ga0501080_0571774 3300049742 Bacteria 1005
491 Ga0501083_0000290 3300049744 Bacteria 31698
492 Ga0501083_0015872 3300049744 Bacteria 5271
493 Ga0501083_0030226 3300049744 Bacteria 3722
494 Ga0501083_0057701 3300049744 Bacteria 2598
495 Ga0501083_0206257 3300049744 Archaea 1282
496 Ga0501035_0047150 3300049822 Bacteria 3870
497 Ga0501035_0077967 3300049822 Bacteria 2928
498 Ga0501044_0006011 3300049823 Bacteria 13408
499 Ga0501044_0088969 3300049823 Bacteria 3117
500 Ga0501044_0632526 3300049823 Bacteria 960
501 nmdc:mga0k408_217103_c1 3300050493 Bacteria 1142
502 nmdc:mga05p37_464377_c1 3300050507 Bacteria 1462
503 nmdc:mga08y16_1686_c1 3300050511 Bacteria 22422
504 nmdc:mga08y16_580460_c1 3300050511 Bacteria 1132
505 nmdc:mga08y16_66625_c1 3300050511 Bacteria 3758
506 nmdc:mga08y16_8864_c1 3300050511 Bacteria 10559
507 nmdc:mga0n895_1202876_c1 3300050512 Bacteria 732
508 nmdc:mga0n895_262795_c1 3300050512 Bacteria 1751
509 nmdc:mga0n895_27769_c1 3300050512 Bacteria 5379
510 nmdc:mga0n895_405690_c1 3300050512 Bacteria 1378
511 nmdc:mga0n895_502071_c1 3300050512 Bacteria 1222
512 nmdc:mga0rr50_42576_c1 3300050513 Bacteria 3317
513 nmdc:mga0rr50_52486_c1 3300050513 Unclassified 3030
514 nmdc:mga08x19_130948_c1 3300050514 Unclassified 1687
515 nmdc:mga08x19_45_c1 3300050514 Bacteria 147507
516 nmdc:mga08x19_611287_c1 3300050514 Bacteria 773
517 nmdc:mga0a205_429929_c1 3300050515 Bacteria 1182
518 nmdc:mga0a205_65482_c1 3300050515 Unclassified 3511
519 nmdc:mga0a205_666735_c1 3300050515 Bacteria 891
520 Ga0495601_0309982 3300053077 Bacteria 1028
521 Ga0495601_0390612 3300053077 Bacteria 902
522 Ga0495655_0003734 3300053083 Bacteria 2540
523 Ga0495595_0005829 3300053084 Bacteria 4989
524 Ga0495619_0438655 3300053085 Bacteria 900
525 Ga0495619_0944540 3300053085 Bacteria 579
526 Ga0500616_0000595 3300053153 Bacteria 43987
527 Ga0501084_0061291 3300054114 Bacteria 3150
528 Ga0501084_0061842 3300054114 Bacteria 3135
529 Ga0501084_0089388 3300054114 Bacteria 2585
530 Ga0501084_0140170 3300054114 Bacteria 2036
531 Ga0501082_0003404 3300060353 Bacteria 13888
532 Ga0501082_0021843 3300060353 Bacteria 5516
533 Ga0501082_0163030 3300060353 Bacteria 1937
534 Ga0501082_0325654 3300060353 Bacteria 1339
535 Ga0501082_0364205 3300060353 Unclassified 1261
536 Ga0501082_0530305 3300060353 Bacteria 1029
537 Ga0501082_0778822 3300060353 Bacteria 837
538 Ga0501082_0906746 3300060353 Bacteria 771
539 Ga0501082_0987558 3300060353 Bacteria 736
540 Ga0466962_0002161 3300061719 Bacteria 9288
541 Ga0530510_0185221 3300061734 Bacteria 1545

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300029957 Ga0265324_10064836 Ga0265324_100648361 169
2 3300031242 Ga0265329_10049422 Ga0265329_100494222 169
3 3300031247 Ga0265340_10326321 Ga0265340_103263211 169
4 3300031249 Ga0265339_10151614 Ga0265339_101516141 169
5 3300031250 Ga0265331_10037927 Ga0265331_100379272 169
6 3300031251 Ga0265327_10141441 Ga0265327_101414412 169
7 3300028577 Ga0265318_10067405 Ga0265318_100674052 170
8 3300028800 Ga0265338_10032277 Ga0265338_100322773 170
9 3300031344 Ga0265316_10394978 Ga0265316_103949782 170
10 3300005329 Ga0070683_100242391 Ga0070683_1002423912 176
11 3300005329 Ga0070683_100363900 Ga0070683_1003639002 176
12 3300005535 Ga0070684_100300706 Ga0070684_1003007062 176
13 3300005563 Ga0068855_100046978 Ga0068855_1000469785 176
14 3300005563 Ga0068855_100288186 Ga0068855_1002881862 176
15 3300009093 Ga0105240_10059800 Ga0105240_100598003 176
16 3300013104 Ga0157370_10114752 Ga0157370_101147521 176
17 3300013105 Ga0157369_10007645 Ga0157369_100076455 176
18 3300020081 Ga0206354_11178999 Ga0206354_111789992 176
19 3300020082 Ga0206353_10277908 Ga0206353_102779082 176
20 3300020082 Ga0206353_11885480 Ga0206353_118854803 176
21 3300025909 Ga0207705_10060919 Ga0207705_100609194 176
22 3300025913 Ga0207695_10214728 Ga0207695_102147282 176
23 3300025944 Ga0207661_10210845 Ga0207661_102108452 176
24 3300025949 Ga0207667_10078526 Ga0207667_100785262 176
25 3300035083 Ga0373926_0083314 Ga0373926_0083314_224_754 176
26 3300035170 Ga0373943_0007236 Ga0373943_0007236_4196_4726 176
27 3300035695 Ga0373927_0282726 Ga0373927_0282726_534_1064 176
28 3300035725 Ga0373947_0141468 Ga0373947_0141468_178_708 176
29 3300050512 nmdc:mga0n895_262795_c1 nmdc:mga0n895_262795_c1_434_964 176
30 3300005436 Ga0070713_100061720 Ga0070713_1000617203 177
31 3300005439 Ga0070711_101092470 Ga0070711_1010924701 177
32 3300006175 Ga0070712_100340092 Ga0070712_1003400922 177
33 3300025917 Ga0207660_10805134 Ga0207660_108051342 177
34 3300025929 Ga0207664_10608402 Ga0207664_106084022 177
35 3300039438 Ga0436360_1049875 Ga0436360_1049875_1789_2322 177
36 3300039453 Ga0436362_0561287 Ga0436362_0561287_264_797 177
37 3300048088 Ga0495602_0397090 Ga0495602_0397090_190_723 177
38 3300048913 Ga0496110_0206408 Ga0496110_0206408_834_1370 177
39 3300005327 Ga0070658_10535862 Ga0070658_105358622 178
40 3300005329 Ga0070683_100114159 Ga0070683_1001141593 178
41 3300005336 Ga0070680_100096408 Ga0070680_1000964082 178
42 3300005336 Ga0070680_100183214 Ga0070680_1001832142 178
43 3300005336 Ga0070680_100829489 Ga0070680_1008294891 178
44 3300005337 Ga0070682_100021222 Ga0070682_1000212222 178
45 3300005337 Ga0070682_101181825 Ga0070682_1011818251 178
46 3300005339 Ga0070660_100015990 Ga0070660_1000159902 178
47 3300005339 Ga0070660_100051551 Ga0070660_1000515512 178
48 3300005339 Ga0070660_100157933 Ga0070660_1001579331 178
49 3300005341 Ga0070691_10144199 Ga0070691_101441991 178
50 3300005344 Ga0070661_100071796 Ga0070661_1000717962 178
51 3300005445 Ga0070708_100309336 Ga0070708_1003093362 178
52 3300005458 Ga0070681_10002092 Ga0070681_1000209217 178
53 3300005458 Ga0070681_10702839 Ga0070681_107028391 178
54 3300005468 Ga0070707_100104089 Ga0070707_1001040893 178
55 3300005518 Ga0070699_100128227 Ga0070699_1001282273 178
56 3300005530 Ga0070679_100073685 Ga0070679_1000736852 178
57 3300005530 Ga0070679_100092231 Ga0070679_1000922312 178
58 3300005546 Ga0070696_100034272 Ga0070696_1000342724 178
59 3300005548 Ga0070665_100174006 Ga0070665_1001740062 178
60 3300005563 Ga0068855_100042669 Ga0068855_1000426694 178
61 3300005563 Ga0068855_100082698 Ga0068855_1000826982 178
62 3300005563 Ga0068855_100136474 Ga0068855_1001364742 178
63 3300005577 Ga0068857_100108040 Ga0068857_1001080403 178
64 3300005614 Ga0068856_100010271 Ga0068856_1000102715 178
65 3300005614 Ga0068856_100387327 Ga0068856_1003873272 178
66 3300005616 Ga0068852_101303792 Ga0068852_1013037922 178
67 3300009093 Ga0105240_10038474 Ga0105240_100384742 178
68 3300009093 Ga0105240_10178015 Ga0105240_101780152 178
69 3300009174 Ga0105241_10385211 Ga0105241_103852112 178
70 3300009545 Ga0105237_10035751 Ga0105237_100357513 178
71 3300009545 Ga0105237_10060028 Ga0105237_100600282 178
72 3300009551 Ga0105238_10032775 Ga0105238_100327755 178
73 3300009551 Ga0105238_10203052 Ga0105238_102030523 178
74 3300010375 Ga0105239_10160945 Ga0105239_101609452 178
75 3300013100 Ga0157373_10152302 Ga0157373_101523022 178
76 3300013104 Ga0157370_10043974 Ga0157370_100439744 178
77 3300013104 Ga0157370_10045451 Ga0157370_100454512 178
78 3300013105 Ga0157369_10128181 Ga0157369_101281812 178
79 3300013105 Ga0157369_10436001 Ga0157369_104360012 178
80 3300013296 Ga0157374_10083902 Ga0157374_100839023 178
81 3300013307 Ga0157372_10842694 Ga0157372_108426942 178
82 3300020069 Ga0197907_10906224 Ga0197907_109062241 178
83 3300020070 Ga0206356_10288393 Ga0206356_102883933 178
84 3300020082 Ga0206353_10262045 Ga0206353_102620452 178
85 3300020082 Ga0206353_10266005 Ga0206353_102660055 178
86 3300025909 Ga0207705_10413515 Ga0207705_104135152 178
87 3300025912 Ga0207707_10178712 Ga0207707_101787121 178
88 3300025914 Ga0207671_10037220 Ga0207671_100372203 178
89 3300025917 Ga0207660_10119870 Ga0207660_101198702 178
90 3300025917 Ga0207660_10279949 Ga0207660_102799492 178
91 3300025919 Ga0207657_10000275 Ga0207657_1000027541 178
92 3300025919 Ga0207657_10001050 Ga0207657_100010505 178
93 3300025919 Ga0207657_10216756 Ga0207657_102167562 178
94 3300025920 Ga0207649_10770110 Ga0207649_107701101 178
95 3300025921 Ga0207652_10080235 Ga0207652_100802352 178
96 3300025921 Ga0207652_10194101 Ga0207652_101941012 178
97 3300025922 Ga0207646_10089140 Ga0207646_100891403 178
98 3300025924 Ga0207694_11301033 Ga0207694_113010331 178
99 3300025932 Ga0207690_10716518 Ga0207690_107165182 178
100 3300025932 Ga0207690_10785722 Ga0207690_107857222 178
101 3300025949 Ga0207667_10079713 Ga0207667_100797132 178
102 3300025949 Ga0207667_10933317 Ga0207667_109333172 178
103 3300026067 Ga0207678_10329951 Ga0207678_103299512 178
104 3300026078 Ga0207702_10194666 Ga0207702_101946662 178
105 3300026078 Ga0207702_10247904 Ga0207702_102479042 178
106 3300026116 Ga0207674_10054187 Ga0207674_100541872 178
107 3300026121 Ga0207683_11226653 Ga0207683_112266532 178
108 3300026142 Ga0207698_10304438 Ga0207698_103044382 178
109 3300026142 Ga0207698_10375453 Ga0207698_103754532 178
110 3300037418 Ga0395900_0117239 Ga0395900_0117239_1032_1568 178
111 3300037418 Ga0395900_0259520 Ga0395900_0259520_942_1478 178
112 3300037466 Ga0395898_0058671 Ga0395898_0058671_858_1394 178
113 3300037466 Ga0395898_0239011 Ga0395898_0239011_270_806 178
114 3300037466 Ga0395898_0581146 Ga0395898_0581146_394_930 178
115 3300038443 Ga0395901_0081344 Ga0395901_0081344_1099_1635 178
116 3300042005 Ga0439448_0111672 Ga0439448_0111672_175_711 178
117 3300044842 Ga0466957_0215239 Ga0466957_0215239_39_575 178
118 3300045836 Ga0466958_0143360 Ga0466958_0143360_249_788 178
119 3300045976 Ga0466967_0034350 Ga0466967_0034350_529_1068 178
120 3300045976 Ga0466967_0449728 Ga0466967_0449728_185_721 178
121 3300045976 Ga0466967_0640592 Ga0466967_0640592_388_924 178
122 3300046454 Ga0495592_0092010 Ga0495592_0092010_735_1271 178
123 3300046543 Ga0495645_0200659 Ga0495645_0200659_394_930 178
124 3300046559 Ga0495667_0116689 Ga0495667_0116689_61_597 178
125 3300046675 Ga0495657_0180094 Ga0495657_0180094_161_697 178
126 3300046678 Ga0495599_0070525 Ga0495599_0070525_1152_1688 178
127 3300047321 Ga0495676_0157983 Ga0495676_0157983_275_811 178
128 3300048903 Ga0496100_0177053 Ga0496100_0177053_681_1217 178
129 3300048904 Ga0496101_0007907 Ga0496101_0007907_5572_6108 178
130 3300048905 Ga0496102_0185020 Ga0496102_0185020_77_613 178
131 3300048905 Ga0496102_0517898 Ga0496102_0517898_109_645 178
132 3300048907 Ga0496104_0199366 Ga0496104_0199366_363_899 178
133 3300048917 Ga0496114_0041443 Ga0496114_0041443_1733_2269 178
134 3300048918 Ga0496115_0008439 Ga0496115_0008439_4602_5138 178
135 3300049590 Ga0501074_0373418 Ga0501074_0373418_152_688 178
136 3300053077 Ga0495601_0390612 Ga0495601_0390612_328_864 178
137 3300005336 Ga0070680_100165194 Ga0070680_1001651943 179
138 3300005530 Ga0070679_100184386 Ga0070679_1001843862 179
139 3300009098 Ga0105245_10857687 Ga0105245_108576872 179
140 3300013296 Ga0157374_10207649 Ga0157374_102076492 179
141 3300014968 Ga0157379_10139969 Ga0157379_101399692 179
142 3300014969 Ga0157376_10830137 Ga0157376_108301372 179
143 3300020082 Ga0206353_10708738 Ga0206353_107087382 179
144 3300022467 Ga0224712_10288903 Ga0224712_102889031 179
145 3300025986 Ga0207658_10038047 Ga0207658_100380472 179
146 3300026035 Ga0207703_10948017 Ga0207703_109480171 179
147 3300031548 Ga0307408_100043781 Ga0307408_1000437812 179
148 3300031731 Ga0307405_10363817 Ga0307405_103638172 179
149 3300031995 Ga0307409_100103661 Ga0307409_1001036613 179
150 3300032002 Ga0307416_100330622 Ga0307416_1003306222 179
151 3300037418 Ga0395900_0930647 Ga0395900_0930647_15_554 179
152 3300037466 Ga0395898_0032692 Ga0395898_0032692_3895_4434 179
153 3300037466 Ga0395898_0767721 Ga0395898_0767721_96_635 179
154 3300037471 Ga0395905_0159594 Ga0395905_0159594_1091_1630 179
155 3300037471 Ga0395905_0247522 Ga0395905_0247522_548_1087 179
156 3300038443 Ga0395901_0025438 Ga0395901_0025438_3696_4235 179
157 3300038443 Ga0395901_0040004 Ga0395901_0040004_3895_4434 179
158 3300038443 Ga0395901_0837697 Ga0395901_0837697_319_858 179
159 3300039437 Ga0436365_0221520 Ga0436365_0221520_316_855 179
160 3300044694 Ga0466963_0027851 Ga0466963_0027851_2960_3499 179
161 3300044694 Ga0466963_0064493 Ga0466963_0064493_785_1324 179
162 3300044842 Ga0466957_0007673 Ga0466957_0007673_530_1069 179
163 3300044842 Ga0466957_0028907 Ga0466957_0028907_2247_2786 179
164 3300044842 Ga0466957_0664780 Ga0466957_0664780_118_657 179
165 3300045049 Ga0466959_0043755 Ga0466959_0043755_2606_3145 179
166 3300045836 Ga0466958_0008302 Ga0466958_0008302_3054_3593 179
167 3300045976 Ga0466967_0016325 Ga0466967_0016325_4813_5352 179
168 3300045976 Ga0466967_0018314 Ga0466967_0018314_1107_1646 179
169 3300045976 Ga0466967_0055396 Ga0466967_0055396_658_1197 179
170 3300045976 Ga0466967_0136325 Ga0466967_0136325_595_1134 179
171 3300045976 Ga0466967_0506763 Ga0466967_0506763_230_769 179
172 3300046474 Ga0495605_0050203 Ga0495605_0050203_23_562 179
173 3300046533 Ga0495640_0113208 Ga0495640_0113208_1202_1741 179
174 3300048910 Ga0496107_0023681 Ga0496107_0023681_2071_2709 179
175 3300048915 Ga0496112_0007581 Ga0496112_0007581_2362_2901 179
176 3300048917 Ga0496114_0046958 Ga0496114_0046958_1958_2596 179
177 3300049586 Ga0501070_0056475 Ga0501070_0056475_1551_2090 179
178 3300049588 Ga0501072_0002379 Ga0501072_0002379_1469_2008 179
179 3300049589 Ga0501073_0035129 Ga0501073_0035129_2489_3028 179
180 3300049590 Ga0501074_0006600 Ga0501074_0006600_3880_4419 179
181 3300049741 Ga0501079_0016754 Ga0501079_0016754_1472_2011 179
182 3300049742 Ga0501080_0016151 Ga0501080_0016151_4351_4890 179
183 3300049744 Ga0501083_0000290 Ga0501083_0000290_30676_31215 179
184 3300053085 Ga0495619_0944540 Ga0495619_0944540_10_549 179
185 3300054114 Ga0501084_0140170 Ga0501084_0140170_1075_1614 179
186 3300060353 Ga0501082_0987558 Ga0501082_0987558_158_697 179
187 3300061719 Ga0466962_0002161 Ga0466962_0002161_5584_6123 179
188 3300006852 Ga0075433_10047503 Ga0075433_100475034 180
189 3300006871 Ga0075434_101243963 Ga0075434_1012439631 180
190 3300050512 nmdc:mga0n895_1202876_c1 nmdc:mga0n895_1202876_c1_178_720 180
191 3300044842 Ga0466957_0222892 Ga0466957_0222892_112_657 181
192 3300045976 Ga0466967_0143789 Ga0466967_0143789_693_1238 181
193 3300060353 Ga0501082_0778822 Ga0501082_0778822_223_768 181
194 3300061734 Ga0530510_0185221 Ga0530510_0185221_675_1220 181
195 3300005434 Ga0070709_10000237 Ga0070709_100002376 182
196 3300025906 Ga0207699_10000017 Ga0207699_10000017162 182
197 3300025915 Ga0207693_10754190 Ga0207693_107541902 182
198 3300025916 Ga0207663_10224910 Ga0207663_102249102 182
199 3300025928 Ga0207700_10382581 Ga0207700_103825812 182
200 3300035117 Ga0373953_0086057 Ga0373953_0086057_622_1170 182
201 3300045976 Ga0466967_1125492 Ga0466967_1125492_108_656 182
202 3300046454 Ga0495592_0165046 Ga0495592_0165046_376_924 182
203 3300046461 Ga0495641_0114369 Ga0495641_0114369_411_959 182
204 3300046462 Ga0495651_0131251 Ga0495651_0131251_834_1382 182
205 3300046511 Ga0495608_0099425 Ga0495608_0099425_1145_1693 182
206 3300046516 Ga0495628_0169720 Ga0495628_0169720_624_1172 182
207 3300046517 Ga0495630_0092367 Ga0495630_0092367_588_1154 182
208 3300046517 Ga0495630_0639542 Ga0495630_0639542_165_713 182
209 3300046529 Ga0495652_0724529 Ga0495652_0724529_84_632 182
210 3300046535 Ga0495586_0002714 Ga0495586_0002714_6143_6709 182
211 3300046536 Ga0495587_0021012 Ga0495587_0021012_3283_3831 182
212 3300046543 Ga0495645_0059021 Ga0495645_0059021_1565_2113 182
213 3300046675 Ga0495657_0092967 Ga0495657_0092967_62_610 182
214 3300046678 Ga0495599_0094469 Ga0495599_0094469_1122_1670 182
215 3300046678 Ga0495599_0179596 Ga0495599_0179596_79_627 182
216 3300046680 Ga0495646_0037898 Ga0495646_0037898_208_756 182
217 3300047319 Ga0495674_0102352 Ga0495674_0102352_392_958 182
218 3300047444 Ga0495675_0139443 Ga0495675_0139443_807_1355 182
219 3300048917 Ga0496114_0247390 Ga0496114_0247390_726_1274 182
220 3300050507 nmdc:mga05p37_464377_c1 nmdc:mga05p37_464377_c1_31_588 182
221 3300053077 Ga0495601_0309982 Ga0495601_0309982_233_781 182
222 3300053084 Ga0495595_0005829 Ga0495595_0005829_4016_4564 182
223 3300053085 Ga0495619_0438655 Ga0495619_0438655_62_610 182
224 3300005293 Ga0065715_10028950 Ga0065715_100289502 183
225 3300005338 Ga0068868_100444075 Ga0068868_1004440752 183
226 3300005406 Ga0070703_10000078 Ga0070703_1000007812 183
227 3300005440 Ga0070705_100000397 Ga0070705_1000003971 183
228 3300005440 Ga0070705_100618144 Ga0070705_1006181441 183
229 3300005441 Ga0070700_100260312 Ga0070700_1002603121 183
230 3300005467 Ga0070706_100000320 Ga0070706_10000032011 183
231 3300005536 Ga0070697_100583382 Ga0070697_1005833821 183
232 3300005545 Ga0070695_100686475 Ga0070695_1006864751 183
233 3300006852 Ga0075433_10391826 Ga0075433_103918262 183
234 3300006871 Ga0075434_100083879 Ga0075434_1000838794 183
235 3300006914 Ga0075436_100112529 Ga0075436_1001125292 183
236 3300007076 Ga0075435_100044799 Ga0075435_1000447992 183
237 3300007076 Ga0075435_100136550 Ga0075435_1001365502 183
238 3300025885 Ga0207653_10000021 Ga0207653_1000002187 183
239 3300025910 Ga0207684_10000394 Ga0207684_1000039411 183
240 3300047322 Ga0495680_0665067 Ga0495680_0665067_27_584 183
241 3300050512 nmdc:mga0n895_27769_c1 nmdc:mga0n895_27769_c1_79_633 183
242 3300050514 nmdc:mga08x19_130948_c1 nmdc:mga08x19_130948_c1_411_965 183
243 3300005337 Ga0070682_100565630 Ga0070682_1005656301 184
244 3300005468 Ga0070707_100636489 Ga0070707_1006364892 184
245 3300005439 Ga0070711_100000027 Ga0070711_10000002715 185
246 3300026116 Ga0207674_10186955 Ga0207674_101869551 185
247 3300050514 nmdc:mga08x19_45_c1 nmdc:mga08x19_45_c1_144185_144751 185
248 3300050514 nmdc:mga08x19_611287_c1 nmdc:mga08x19_611287_c1_110_676 185
249 3300005535 Ga0070684_100136286 Ga0070684_1001362862 186
250 3300010375 Ga0105239_10306283 Ga0105239_103062832 186
251 3300025937 Ga0207669_10101462 Ga0207669_101014622 186
252 3300025944 Ga0207661_10063829 Ga0207661_100638292 186
253 3300060353 Ga0501082_0906746 Ga0501082_0906746_104_718 186
254 3300025927 Ga0207687_10276097 Ga0207687_102760972 187
255 3300005353 Ga0070669_100040918 Ga0070669_1000409183 188
256 3300005456 Ga0070678_100630552 Ga0070678_1006305521 188
257 3300025903 Ga0207680_10042140 Ga0207680_100421402 188
258 3300025923 Ga0207681_10069176 Ga0207681_100691763 188
259 3300025926 Ga0207659_10088672 Ga0207659_100886722 188
260 3300026089 Ga0207648_10182773 Ga0207648_101827732 188
261 3300026121 Ga0207683_10032747 Ga0207683_100327473 188
262 3300005290 Ga0065712_10076849 Ga0065712_100768492 189
263 3300005293 Ga0065715_10129845 Ga0065715_101298453 189
264 3300009094 Ga0111539_10056813 Ga0111539_100568134 189
265 3300009553 Ga0105249_10670348 Ga0105249_106703482 189
266 3300013306 Ga0163162_10003181 Ga0163162_1000318118 189
267 3300025927 Ga0207687_10000098 Ga0207687_1000009824 189
268 3300025961 Ga0207712_10539325 Ga0207712_105393252 189
269 3300005840 Ga0068870_10116245 Ga0068870_101162452 190
270 3300025908 Ga0207643_10118423 Ga0207643_101184232 190
271 3300041505 Ga0451849_0381006 Ga0451849_0381006_2362_2949 190
272 3300041511 Ga0451855_1116450 Ga0451855_1116450_322_909 190
273 3300041512 Ga0451853_0373412 Ga0451853_0373412_20695_21282 190
274 3300006028 Ga0070717_10096757 Ga0070717_100967572 191
275 3300006195 Ga0075366_10176568 Ga0075366_101765682 191
276 3300049568 Ga0501031_0173524 Ga0501031_0173524_735_1355 191
277 3300049583 Ga0501067_0016421 Ga0501067_0016421_2429_3025 191
278 3300050493 nmdc:mga0k408_217103_c1 nmdc:mga0k408_217103_c1_239_835 191
279 3300046615 Ga0495656_0059087 Ga0495656_0059087_257_841 192
280 3300003323 rootH1_10082928 rootH1_100829286 195
281 3300009147 Ga0114129_10091695 Ga0114129_100916955 195
282 3300009177 Ga0105248_10300698 Ga0105248_103006982 195
283 3300025925 Ga0207650_10477483 Ga0207650_104774832 195
284 3300026078 Ga0207702_11023333 Ga0207702_110233332 195
285 3300050515 nmdc:mga0a205_429929_c1 nmdc:mga0a205_429929_c1_44_649 195
286 3300005295 Ga0065707_10022485 Ga0065707_100224852 196
287 3300005336 Ga0070680_100212323 Ga0070680_1002123232 196
288 3300005343 Ga0070687_100113439 Ga0070687_1001134392 196
289 3300005353 Ga0070669_100780965 Ga0070669_1007809651 196
290 3300005441 Ga0070700_100000170 Ga0070700_10000017034 196
291 3300005445 Ga0070708_100235611 Ga0070708_1002356112 196
292 3300005468 Ga0070707_100105397 Ga0070707_1001053972 196
293 3300005518 Ga0070699_100000194 Ga0070699_10000019455 196
294 3300005545 Ga0070695_100103810 Ga0070695_1001038102 196
295 3300005546 Ga0070696_100000242 Ga0070696_1000002427 196
296 3300005546 Ga0070696_100012684 Ga0070696_1000126842 196
297 3300005547 Ga0070693_100006521 Ga0070693_1000065212 196
298 3300005616 Ga0068852_101349730 Ga0068852_1013497302 196
299 3300006358 Ga0068871_100829308 Ga0068871_1008293082 196
300 3300006844 Ga0075428_101223627 Ga0075428_1012236272 196
301 3300006852 Ga0075433_10749004 Ga0075433_107490041 196
302 3300009093 Ga0105240_10043979 Ga0105240_100439792 196
303 3300009094 Ga0111539_10104832 Ga0111539_101048323 196
304 3300009176 Ga0105242_10003683 Ga0105242_1000368313 196
305 3300011119 Ga0105246_10187530 Ga0105246_101875302 196
306 3300013105 Ga0157369_10000065 Ga0157369_1000006561 196
307 3300013297 Ga0157378_10433698 Ga0157378_104336982 196
308 3300014325 Ga0163163_11142696 Ga0163163_111426961 196
309 3300021384 Ga0213876_10000008 Ga0213876_10000008391 196
310 3300025913 Ga0207695_10072469 Ga0207695_100724692 196
311 3300025918 Ga0207662_10027645 Ga0207662_100276454 196
312 3300025922 Ga0207646_10087953 Ga0207646_100879532 196
313 3300025934 Ga0207686_10002498 Ga0207686_1000249813 196
314 3300025941 Ga0207711_10291631 Ga0207711_102916312 196
315 3300026041 Ga0207639_10000073 Ga0207639_1000007374 196
316 3300026075 Ga0207708_10000409 Ga0207708_100004097 196
317 3300028380 Ga0268265_10186082 Ga0268265_101860822 196
318 3300031616 Ga0307508_10089850 Ga0307508_100898502 196
319 3300039437 Ga0436365_0670421 Ga0436365_0670421_7403_8002 196
320 3300042876 Ga0451577_0002705 Ga0451577_0002705_8360_8959 196
321 3300044712 Ga0453684_0005932 Ga0453684_0005932_12118_12717 196
322 3300045051 Ga0451576_0108594 Ga0451576_0108594_1495_2094 196
323 3300049569 Ga0501032_0347682 Ga0501032_0347682_128_736 196
324 3300050511 nmdc:mga08y16_66625_c1 nmdc:mga08y16_66625_c1_2267_2875 196
325 3300050513 nmdc:mga0rr50_52486_c1 nmdc:mga0rr50_52486_c1_1462_2067 196
326 3300050515 nmdc:mga0a205_65482_c1 nmdc:mga0a205_65482_c1_2356_2964 196
327 3300050515 nmdc:mga0a205_666735_c1 nmdc:mga0a205_666735_c1_173_781 196
328 3300053083 Ga0495655_0003734 Ga0495655_0003734_321_920 196
329 3300005337 Ga0070682_100016951 Ga0070682_1000169512 197
330 3300025934 Ga0207686_10461936 Ga0207686_104619361 197
331 3300026142 Ga0207698_10720137 Ga0207698_107201372 197
332 3300042131 Ga0450894_032633 Ga0450894_032633_26_625 197
333 3300042133 Ga0450896_000960 Ga0450896_000960_1348_1947 197
334 3300042134 Ga0450898_010329 Ga0450898_010329_96_695 197
335 3300048915 Ga0496112_0729441 Ga0496112_0729441_155_748 197
336 3300005340 Ga0070689_100070205 Ga0070689_1000702053 198
337 3300005354 Ga0070675_100634958 Ga0070675_1006349581 198
338 3300005365 Ga0070688_100188395 Ga0070688_1001883952 198
339 3300005444 Ga0070694_100135355 Ga0070694_1001353551 198
340 3300005544 Ga0070686_100078311 Ga0070686_1000783112 198
341 3300006871 Ga0075434_100246401 Ga0075434_1002464012 198
342 3300009094 Ga0111539_10064851 Ga0111539_100648512 198
343 3300025916 Ga0207663_10000006 Ga0207663_1000000697 198
344 3300025936 Ga0207670_10058121 Ga0207670_100581212 198
345 3300026075 Ga0207708_10129503 Ga0207708_101295032 198
346 3300028380 Ga0268265_10735809 Ga0268265_107358091 198
347 3300046454 Ga0495592_0068694 Ga0495592_0068694_1292_1897 198
348 3300046462 Ga0495651_0124079 Ga0495651_0124079_328_933 198
349 3300046516 Ga0495628_0105411 Ga0495628_0105411_875_1480 198
350 3300046678 Ga0495599_0059582 Ga0495599_0059582_1561_2166 198
351 3300050512 nmdc:mga0n895_405690_c1 nmdc:mga0n895_405690_c1_705_1328 198
352 3300005340 Ga0070689_100005731 Ga0070689_1000057313 199
353 3300005445 Ga0070708_100515168 Ga0070708_1005151682 199
354 3300006173 Ga0070716_100030951 Ga0070716_1000309512 199
355 3300006175 Ga0070712_100046551 Ga0070712_1000465513 199
356 3300009094 Ga0111539_10617462 Ga0111539_106174622 199
357 3300025915 Ga0207693_10058864 Ga0207693_100588642 199
358 3300025936 Ga0207670_10000962 Ga0207670_100009623 199
359 3300025939 Ga0207665_10021990 Ga0207665_100219902 199
360 3300042005 Ga0439448_0024922 Ga0439448_0024922_76_780 199
361 3300049741 Ga0501079_0646497 Ga0501079_0646497_132_758 199
362 3300050511 nmdc:mga08y16_580460_c1 nmdc:mga08y16_580460_c1_393_1061 199
363 3300005471 Ga0070698_100094636 Ga0070698_1000946363 200
364 3300005549 Ga0070704_100020419 Ga0070704_1000204193 200
365 3300009094 Ga0111539_10005968 Ga0111539_100059689 200
366 3300010375 Ga0105239_10515325 Ga0105239_105153252 200
367 3300027907 Ga0207428_10081608 Ga0207428_100816082 200
368 3300049569 Ga0501032_0004392 Ga0501032_0004392_2856_3500 200
369 3300049569 Ga0501032_0005707 Ga0501032_0005707_8397_9044 200
370 3300049570 Ga0501033_0298221 Ga0501033_0298221_337_984 200
371 3300049571 Ga0501034_0005150 Ga0501034_0005150_3033_3677 200
372 3300049571 Ga0501034_0075276 Ga0501034_0075276_1902_2549 200
373 3300049571 Ga0501034_0127603 Ga0501034_0127603_527_1147 200
374 3300049571 Ga0501034_0142623 Ga0501034_0142623_1725_2345 200
375 3300049572 Ga0501036_0018437 Ga0501036_0018437_1975_2619 200
376 3300049572 Ga0501036_0215370 Ga0501036_0215370_364_984 200
377 3300049573 Ga0501037_0025268 Ga0501037_0025268_631_1275 200
378 3300049573 Ga0501037_0182143 Ga0501037_0182143_737_1384 200
379 3300049573 Ga0501037_0229273 Ga0501037_0229273_596_1216 200
380 3300049574 Ga0501038_0022442 Ga0501038_0022442_1855_2499 200
381 3300049574 Ga0501038_0036573 Ga0501038_0036573_1562_2209 200
382 3300049575 Ga0501039_0031628 Ga0501039_0031628_1581_2225 200
383 3300049575 Ga0501039_0083973 Ga0501039_0083973_1645_2292 200
384 3300049575 Ga0501039_0285991 Ga0501039_0285991_560_1180 200
385 3300049578 Ga0501042_0169833 Ga0501042_0169833_705_1325 200
386 3300049579 Ga0501043_0012710 Ga0501043_0012710_1994_2614 200
387 3300049579 Ga0501043_0038391 Ga0501043_0038391_1622_2266 200
388 3300049579 Ga0501043_0039540 Ga0501043_0039540_1416_2063 200
389 3300049579 Ga0501043_0609603 Ga0501043_0609603_80_700 200
390 3300049580 Ga0501046_0005157 Ga0501046_0005157_2339_2983 200
391 3300049580 Ga0501046_0047415 Ga0501046_0047415_1655_2302 200
392 3300049580 Ga0501046_0383931 Ga0501046_0383931_237_857 200
393 3300049580 Ga0501046_0436598 Ga0501046_0436598_155_775 200
394 3300049581 Ga0501047_0004351 Ga0501047_0004351_2098_2742 200
395 3300049581 Ga0501047_0043189 Ga0501047_0043189_874_1521 200
396 3300049581 Ga0501047_0075319 Ga0501047_0075319_2084_2704 200
397 3300049581 Ga0501047_0149332 Ga0501047_0149332_1487_2107 200
398 3300049581 Ga0501047_0255833 Ga0501047_0255833_636_1256 200
399 3300049582 Ga0501048_0007911 Ga0501048_0007911_797_1441 200
400 3300049582 Ga0501048_0083249 Ga0501048_0083249_141_788 200
401 3300049582 Ga0501048_0280253 Ga0501048_0280253_106_726 200
402 3300049583 Ga0501067_0010991 Ga0501067_0010991_4083_4730 200
403 3300049583 Ga0501067_0298128 Ga0501067_0298128_245_865 200
404 3300049584 Ga0501068_0005157 Ga0501068_0005157_5098_5742 200
405 3300049584 Ga0501068_0420208 Ga0501068_0420208_67_687 200
406 3300049585 Ga0501069_0011667 Ga0501069_0011667_1873_2517 200
407 3300049586 Ga0501070_0095878 Ga0501070_0095878_157_777 200
408 3300049586 Ga0501070_0280605 Ga0501070_0280605_419_1039 200
409 3300049586 Ga0501070_0682880 Ga0501070_0682880_94_741 200
410 3300049588 Ga0501072_0025885 Ga0501072_0025885_3302_3922 200
411 3300049588 Ga0501072_0359158 Ga0501072_0359158_397_1041 200
412 3300049589 Ga0501073_0002377 Ga0501073_0002377_1995_2639 200
413 3300049589 Ga0501073_0025811 Ga0501073_0025811_230_850 200
414 3300049589 Ga0501073_0067440 Ga0501073_0067440_1522_2169 200
415 3300049589 Ga0501073_0070929 Ga0501073_0070929_1672_2292 200
416 3300049589 Ga0501073_0281465 Ga0501073_0281465_463_1083 200
417 3300049590 Ga0501074_0081185 Ga0501074_0081185_243_863 200
418 3300049593 Ga0501077_0064679 Ga0501077_0064679_766_1410 200
419 3300049593 Ga0501077_0153051 Ga0501077_0153051_680_1300 200
420 3300049742 Ga0501080_0005425 Ga0501080_0005425_8714_9358 200
421 3300049742 Ga0501080_0045419 Ga0501080_0045419_1913_2560 200
422 3300049742 Ga0501080_0141922 Ga0501080_0141922_363_983 200
423 3300049742 Ga0501080_0571774 Ga0501080_0571774_196_816 200
424 3300049744 Ga0501083_0015872 Ga0501083_0015872_3264_3884 200
425 3300049744 Ga0501083_0030226 Ga0501083_0030226_1220_1840 200
426 3300049744 Ga0501083_0057701 Ga0501083_0057701_1085_1732 200
427 3300049822 Ga0501035_0047150 Ga0501035_0047150_1396_2040 200
428 3300049822 Ga0501035_0077967 Ga0501035_0077967_1757_2404 200
429 3300049823 Ga0501044_0006011 Ga0501044_0006011_10667_11311 200
430 3300049823 Ga0501044_0088969 Ga0501044_0088969_1735_2382 200
431 3300049823 Ga0501044_0632526 Ga0501044_0632526_107_727 200
432 3300050511 nmdc:mga08y16_8864_c1 nmdc:mga08y16_8864_c1_1855_2493 200
433 3300054114 Ga0501084_0061291 Ga0501084_0061291_1260_1880 200
434 3300054114 Ga0501084_0061842 Ga0501084_0061842_619_1263 200
435 3300054114 Ga0501084_0089388 Ga0501084_0089388_341_961 200
436 3300060353 Ga0501082_0003404 Ga0501082_0003404_12407_13054 200
437 3300060353 Ga0501082_0021843 Ga0501082_0021843_1582_2226 200
438 3300060353 Ga0501082_0163030 Ga0501082_0163030_1069_1689 200
439 3300060353 Ga0501082_0530305 Ga0501082_0530305_330_950 200
440 3300005290 Ga0065712_10079731 Ga0065712_100797312 201
441 3300005617 Ga0068859_100745773 Ga0068859_1007457732 201
442 3300006931 Ga0097620_100745703 Ga0097620_1007457032 201
443 3300028563 Ga0265319_1000068 Ga0265319_100006826 201
444 3300028577 Ga0265318_10000040 Ga0265318_100000409 201
445 3300031235 Ga0265330_10000065 Ga0265330_1000006548 201
446 3300031238 Ga0265332_10001115 Ga0265332_1000111510 201
447 3300031240 Ga0265320_10000050 Ga0265320_1000005045 201
448 3300031242 Ga0265329_10000210 Ga0265329_1000021015 201
449 3300031247 Ga0265340_10003735 Ga0265340_100037356 201
450 3300031249 Ga0265339_10172574 Ga0265339_101725742 201
451 3300031250 Ga0265331_10000265 Ga0265331_1000026522 201
452 3300031344 Ga0265316_10000389 Ga0265316_1000038915 201
453 3300031456 Ga0307513_10113520 Ga0307513_101135202 201
454 3300031595 Ga0265313_10000040 Ga0265313_1000004053 201
455 3300031711 Ga0265314_10000117 Ga0265314_1000011730 201
456 3300031712 Ga0265342_10000037 Ga0265342_1000003783 201
457 3300049587 Ga0501071_0227525 Ga0501071_0227525_330_968 201
458 3300049589 Ga0501073_0290535 Ga0501073_0290535_433_1071 201
459 3300026088 Ga0207641_10302967 Ga0207641_103029673 202
460 3300032002 Ga0307416_100144226 Ga0307416_1001442262 202
461 3300048912 Ga0496109_0039094 Ga0496109_0039094_444_1109 202
462 3300048913 Ga0496110_0378370 Ga0496110_0378370_343_1008 202
463 3300048915 Ga0496112_0026840 Ga0496112_0026840_4217_4882 202
464 3300048916 Ga0496113_0101885 Ga0496113_0101885_1167_1832 202
465 3300049588 Ga0501072_0191085 Ga0501072_0191085_202_834 202
466 3300005438 Ga0070701_10056091 Ga0070701_100560912 203
467 3300005440 Ga0070705_100242180 Ga0070705_1002421802 203
468 3300005455 Ga0070663_100757966 Ga0070663_1007579661 203
469 3300007076 Ga0075435_100703797 Ga0075435_1007037972 203
470 3300021384 Ga0213876_10002664 Ga0213876_100026644 203
471 3300027907 Ga0207428_10000998 Ga0207428_100009983 203
472 3300039437 Ga0436365_1511658 Ga0436365_1511658_165_806 203
473 3300049744 Ga0501083_0206257 Ga0501083_0206257_83_745 203
474 3300050512 nmdc:mga0n895_502071_c1 nmdc:mga0n895_502071_c1_22_642 203
475 3300060353 Ga0501082_0325654 Ga0501082_0325654_270_932 203
476 3300005353 Ga0070669_100679240 Ga0070669_1006792402 204
477 3300005468 Ga0070707_100602523 Ga0070707_1006025232 204
478 3300005548 Ga0070665_100387467 Ga0070665_1003874672 204
479 3300005617 Ga0068859_100031477 Ga0068859_1000314773 204
480 3300005618 Ga0068864_100453078 Ga0068864_1004530782 204
481 3300006931 Ga0097620_100031476 Ga0097620_1000314764 204
482 3300025903 Ga0207680_10360755 Ga0207680_103607552 204
483 3300025923 Ga0207681_11006153 Ga0207681_110061531 204
484 3300060353 Ga0501082_0364205 Ga0501082_0364205_348_1058 204
485 3300050511 nmdc:mga08y16_1686_c1 nmdc:mga08y16_1686_c1_1885_2538 205
486 3300003203 JGI25406J46586_10067477 JGI25406J46586_100674772 206
487 3300005334 Ga0068869_100020145 Ga0068869_1000201452 206
488 3300005341 Ga0070691_10078768 Ga0070691_100787681 206
489 3300005353 Ga0070669_100131827 Ga0070669_1001318273 206
490 3300005355 Ga0070671_100599960 Ga0070671_1005999601 206
491 3300005364 Ga0070673_100005605 Ga0070673_1000056053 206
492 3300005366 Ga0070659_100338714 Ga0070659_1003387142 206
493 3300005367 Ga0070667_100061597 Ga0070667_1000615972 206
494 3300005406 Ga0070703_10042759 Ga0070703_100427592 206
495 3300005441 Ga0070700_100048296 Ga0070700_1000482963 206
496 3300005455 Ga0070663_100152497 Ga0070663_1001524972 206
497 3300005456 Ga0070678_100137571 Ga0070678_1001375711 206
498 3300005459 Ga0068867_100030558 Ga0068867_1000305582 206
499 3300005545 Ga0070695_100432455 Ga0070695_1004324552 206
500 3300005546 Ga0070696_100125214 Ga0070696_1001252143 206
501 3300005549 Ga0070704_100131470 Ga0070704_1001314703 206
502 3300005615 Ga0070702_100006054 Ga0070702_1000060543 206
503 3300005719 Ga0068861_100041667 Ga0068861_1000416673 206
504 3300005843 Ga0068860_100086874 Ga0068860_1000868742 206
505 3300005985 Ga0081539_10017940 Ga0081539_100179402 206
506 3300006237 Ga0097621_100770035 Ga0097621_1007700352 206
507 3300007076 Ga0075435_100007214 Ga0075435_1000072146 206
508 3300009148 Ga0105243_10052612 Ga0105243_100526123 206
509 3300009176 Ga0105242_10114118 Ga0105242_101141183 206
510 3300009553 Ga0105249_10744121 Ga0105249_107441212 206
511 3300010375 Ga0105239_10295409 Ga0105239_102954091 206
512 3300013297 Ga0157378_10341049 Ga0157378_103410492 206
513 3300025315 Ga0207697_10136436 Ga0207697_101364362 206
514 3300025893 Ga0207682_10026996 Ga0207682_100269963 206
515 3300025904 Ga0207647_10064073 Ga0207647_100640735 206
516 3300025910 Ga0207684_10480375 Ga0207684_104803751 206
517 3300025918 Ga0207662_10231109 Ga0207662_102311092 206
518 3300025923 Ga0207681_10080789 Ga0207681_100807893 206
519 3300025926 Ga0207659_10809768 Ga0207659_108097681 206
520 3300025927 Ga0207687_10141413 Ga0207687_101414132 206
521 3300025931 Ga0207644_10126609 Ga0207644_101266092 206
522 3300025931 Ga0207644_10139978 Ga0207644_101399783 206
523 3300025932 Ga0207690_10083935 Ga0207690_100839353 206
524 3300025933 Ga0207706_10019700 Ga0207706_100197004 206
525 3300025934 Ga0207686_10362535 Ga0207686_103625352 206
526 3300025936 Ga0207670_10049883 Ga0207670_100498833 206
527 3300025937 Ga0207669_10212285 Ga0207669_102122852 206
528 3300025938 Ga0207704_10184335 Ga0207704_101843352 206
529 3300025940 Ga0207691_10046985 Ga0207691_100469854 206
530 3300025941 Ga0207711_10076698 Ga0207711_100766983 206
531 3300025942 Ga0207689_10036372 Ga0207689_100363721 206
532 3300025986 Ga0207658_10072971 Ga0207658_100729713 206
533 3300026023 Ga0207677_10094236 Ga0207677_100942363 206
534 3300026035 Ga0207703_10995858 Ga0207703_109958581 206
535 3300026075 Ga0207708_10033198 Ga0207708_100331984 206
536 3300026089 Ga0207648_10005814 Ga0207648_100058145 206
537 3300026118 Ga0207675_100041575 Ga0207675_1000415754 206
538 3300028381 Ga0268264_10147354 Ga0268264_101473543 206
539 3300048910 Ga0496107_0069661 Ga0496107_0069661_411_1037 206
540 3300050513 nmdc:mga0rr50_42576_c1 nmdc:mga0rr50_42576_c1_2330_2956 206
541 3300053153 Ga0500616_0000595 Ga0500616_0000595_13808_14431 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

34

213

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9863 4 200
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9803 4 200
3p9x-assembly1.cif.gz_B crystal structure of phosphoribosylglycinamide formyltransferase from bacillus halodurans 0.9735 4 187
3av3-assembly1.cif.gz_A crystal structure of glycinamide ribonucleotide transformylase 1 from geobacillus kaustophilus 0.9676 1 187
4s1n-assembly1.cif.gz_A the crystal structure of phosphoribosylglycinamide formyltransferase from streptococcus pneumoniae tigr4 0.9666 3 187
ID Description Score Start End Superfamily
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9863 4 200 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9799 4 200 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9718 4 187 3.40.50.170
3av3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9718 3 186 3.40.50.170
4s1nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9662 4 187 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A2V6BKH7-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9977 84 188 GO:0004644
GO:0005829
GO:0006189
AF-A0A350CZ61-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) 0.9928 4 177 GO:0004644
GO:0005829
GO:0006189
AF-A0A2V6XK53-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) 0.991 4 159 GO:0004644
GO:0005829
GO:0006189
AF-A0A2V8B6E4-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9895 1 204 GO:0004644
GO:0005829
GO:0006189
AF-A0A7V9CNL6-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9886 2 92 GO:0004644
GO:0005737
GO:0006189

Feature Viewer

pLDDT pTM Quality
95.53 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map