F461433
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 541 | 283 | 541 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300060353|Ga0501082_0364205|Ga0501082_0364205_348_1058 |
| Length | 236 |
| Sequence | MTALGDSKADAHSPGVWTSVPSKAVSVEKGSDPLIAVLISGRGSNLQALIQAADAGRLHARIVLVISNVEGVEGIAHAERAGIETLVIPHRQFVARADFDRALVDALRSKNVALVCLAGFMRRLGPDFCRAFPNAILNIHPSLLPAFPGVDAQRQALEHGVKLTGATVHFVTPELDAGPIVLQRAVPVLDNDSAATLAARVLAVEHAIYPEAVQRVLNGQWRIVGRRVVFEDGPGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 168 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 192 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 193 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 194 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 195 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 196 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 197 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 198 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 199 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 200 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 269 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 280 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.34 |
| Metatranscriptomes | 1.66 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.55 |
| Nodule | 0 |
| Rhizoplane | 3.33 |
| Rhizosphere | 94.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10067477 | 3300003203 | Unclassified | 1133 |
| 2 | rootH1_10082928 | 3300003323 | Bacteria | 8713 |
| 3 | Ga0065712_10076849 | 3300005290 | Bacteria | 3591 |
| 4 | Ga0065712_10079731 | 3300005290 | Bacteria | 3184 |
| 5 | Ga0065715_10028950 | 3300005293 | Unclassified | 1356 |
| 6 | Ga0065715_10129845 | 3300005293 | Bacteria | 2038 |
| 7 | Ga0065707_10022485 | 3300005295 | Bacteria | 1857 |
| 8 | Ga0070658_10535862 | 3300005327 | Bacteria | 1013 |
| 9 | Ga0070683_100114159 | 3300005329 | Bacteria | 2549 |
| 10 | Ga0070683_100242391 | 3300005329 | Bacteria | 1715 |
| 11 | Ga0070683_100363900 | 3300005329 | Bacteria | 1377 |
| 12 | Ga0068869_100020145 | 3300005334 | Bacteria | 4569 |
| 13 | Ga0070680_100096408 | 3300005336 | Bacteria | 2452 |
| 14 | Ga0070680_100165194 | 3300005336 | Bacteria | 1861 |
| 15 | Ga0070680_100183214 | 3300005336 | Bacteria | 1764 |
| 16 | Ga0070680_100212323 | 3300005336 | Bacteria | 1633 |
| 17 | Ga0070680_100829489 | 3300005336 | Bacteria | 797 |
| 18 | Ga0070682_100016951 | 3300005337 | Bacteria | 4241 |
| 19 | Ga0070682_100021222 | 3300005337 | Bacteria | 3828 |
| 20 | Ga0070682_100565630 | 3300005337 | Bacteria | 892 |
| 21 | Ga0070682_101181825 | 3300005337 | Bacteria | 645 |
| 22 | Ga0068868_100444075 | 3300005338 | Unclassified | 1127 |
| 23 | Ga0070660_100015990 | 3300005339 | Bacteria | 5435 |
| 24 | Ga0070660_100051551 | 3300005339 | Bacteria | 3169 |
| 25 | Ga0070660_100157933 | 3300005339 | Bacteria | 1826 |
| 26 | Ga0070689_100005731 | 3300005340 | Bacteria | 8517 |
| 27 | Ga0070689_100070205 | 3300005340 | Bacteria | 2734 |
| 28 | Ga0070691_10078768 | 3300005341 | Bacteria | 1610 |
| 29 | Ga0070691_10144199 | 3300005341 | Bacteria | 1216 |
| 30 | Ga0070687_100113439 | 3300005343 | Bacteria | 1538 |
| 31 | Ga0070661_100071796 | 3300005344 | Bacteria | 2547 |
| 32 | Ga0070669_100040918 | 3300005353 | Bacteria | 3369 |
| 33 | Ga0070669_100131827 | 3300005353 | Bacteria | 1918 |
| 34 | Ga0070669_100679240 | 3300005353 | Bacteria | 868 |
| 35 | Ga0070669_100780965 | 3300005353 | Bacteria | 811 |
| 36 | Ga0070675_100634958 | 3300005354 | Unclassified | 970 |
| 37 | Ga0070671_100599960 | 3300005355 | Bacteria | 951 |
| 38 | Ga0070673_100005605 | 3300005364 | Bacteria | 8050 |
| 39 | Ga0070688_100188395 | 3300005365 | Unclassified | 1436 |
| 40 | Ga0070659_100338714 | 3300005366 | Bacteria | 1260 |
| 41 | Ga0070667_100061597 | 3300005367 | Bacteria | 3177 |
| 42 | Ga0070703_10000078 | 3300005406 | Bacteria | 48341 |
| 43 | Ga0070703_10042759 | 3300005406 | Bacteria | 1418 |
| 44 | Ga0070709_10000237 | 3300005434 | Bacteria | 35643 |
| 45 | Ga0070713_100061720 | 3300005436 | Bacteria | 3136 |
| 46 | Ga0070701_10056091 | 3300005438 | Bacteria | 2060 |
| 47 | Ga0070711_100000027 | 3300005439 | Bacteria | 108952 |
| 48 | Ga0070711_101092470 | 3300005439 | Bacteria | 687 |
| 49 | Ga0070705_100000397 | 3300005440 | Bacteria | 25329 |
| 50 | Ga0070705_100242180 | 3300005440 | Bacteria | 1261 |
| 51 | Ga0070705_100618144 | 3300005440 | Bacteria | 840 |
| 52 | Ga0070700_100000170 | 3300005441 | Bacteria | 36874 |
| 53 | Ga0070700_100048296 | 3300005441 | Bacteria | 2637 |
| 54 | Ga0070700_100260312 | 3300005441 | Bacteria | 1249 |
| 55 | Ga0070694_100135355 | 3300005444 | Unclassified | 1785 |
| 56 | Ga0070708_100235611 | 3300005445 | Unclassified | 1718 |
| 57 | Ga0070708_100309336 | 3300005445 | Bacteria | 1488 |
| 58 | Ga0070708_100515168 | 3300005445 | Unclassified | 1128 |
| 59 | Ga0070663_100152497 | 3300005455 | Bacteria | 1773 |
| 60 | Ga0070663_100757966 | 3300005455 | Bacteria | 829 |
| 61 | Ga0070678_100137571 | 3300005456 | Bacteria | 1950 |
| 62 | Ga0070678_100630552 | 3300005456 | Bacteria | 960 |
| 63 | Ga0070681_10002092 | 3300005458 | Bacteria | 18139 |
| 64 | Ga0070681_10702839 | 3300005458 | Bacteria | 927 |
| 65 | Ga0068867_100030558 | 3300005459 | Bacteria | 3885 |
| 66 | Ga0070706_100000320 | 3300005467 | Bacteria | 58537 |
| 67 | Ga0070707_100104089 | 3300005468 | Bacteria | 2751 |
| 68 | Ga0070707_100105397 | 3300005468 | Bacteria | 2734 |
| 69 | Ga0070707_100602523 | 3300005468 | Bacteria | 1061 |
| 70 | Ga0070707_100636489 | 3300005468 | Bacteria | 1029 |
| 71 | Ga0070698_100094636 | 3300005471 | Bacteria | 2966 |
| 72 | Ga0070699_100000194 | 3300005518 | Bacteria | 59391 |
| 73 | Ga0070699_100128227 | 3300005518 | Bacteria | 2235 |
| 74 | Ga0070679_100073685 | 3300005530 | Bacteria | 3405 |
| 75 | Ga0070679_100092231 | 3300005530 | Bacteria | 3017 |
| 76 | Ga0070679_100184386 | 3300005530 | Bacteria | 2058 |
| 77 | Ga0070684_100136286 | 3300005535 | Bacteria | 2218 |
| 78 | Ga0070684_100300706 | 3300005535 | Bacteria | 1472 |
| 79 | Ga0070697_100583382 | 3300005536 | Bacteria | 982 |
| 80 | Ga0070686_100078311 | 3300005544 | Bacteria | 2182 |
| 81 | Ga0070695_100103810 | 3300005545 | Bacteria | 1918 |
| 82 | Ga0070695_100432455 | 3300005545 | Bacteria | 1004 |
| 83 | Ga0070695_100686475 | 3300005545 | Unclassified | 811 |
| 84 | Ga0070696_100000242 | 3300005546 | Bacteria | 32817 |
| 85 | Ga0070696_100012684 | 3300005546 | Bacteria | 5659 |
| 86 | Ga0070696_100034272 | 3300005546 | Bacteria | 3492 |
| 87 | Ga0070696_100125214 | 3300005546 | Bacteria | 1864 |
| 88 | Ga0070693_100006521 | 3300005547 | Bacteria | 5659 |
| 89 | Ga0070665_100174006 | 3300005548 | Bacteria | 2153 |
| 90 | Ga0070665_100387467 | 3300005548 | Bacteria | 1405 |
| 91 | Ga0070704_100020419 | 3300005549 | Plasmid | 4271 |
| 92 | Ga0070704_100131470 | 3300005549 | Bacteria | 1941 |
| 93 | Ga0068855_100042669 | 3300005563 | Bacteria | 5374 |
| 94 | Ga0068855_100046978 | 3300005563 | Bacteria | 5102 |
| 95 | Ga0068855_100082698 | 3300005563 | Bacteria | 3721 |
| 96 | Ga0068855_100136474 | 3300005563 | Bacteria | 2798 |
| 97 | Ga0068855_100288186 | 3300005563 | Bacteria | 1821 |
| 98 | Ga0068857_100108040 | 3300005577 | Bacteria | 2500 |
| 99 | Ga0068856_100010271 | 3300005614 | Bacteria | 9099 |
| 100 | Ga0068856_100387327 | 3300005614 | Bacteria | 1417 |
| 101 | Ga0070702_100006054 | 3300005615 | Bacteria | 5697 |
| 102 | Ga0068852_101303792 | 3300005616 | Bacteria | 748 |
| 103 | Ga0068852_101349730 | 3300005616 | Bacteria | 735 |
| 104 | Ga0068859_100031477 | 3300005617 | Bacteria | 5327 |
| 105 | Ga0068859_100745773 | 3300005617 | Bacteria | 1068 |
| 106 | Ga0068864_100453078 | 3300005618 | Bacteria | 1227 |
| 107 | Ga0068861_100041667 | 3300005719 | Bacteria | 3439 |
| 108 | Ga0068870_10116245 | 3300005840 | Bacteria | 1534 |
| 109 | Ga0068860_100086874 | 3300005843 | Bacteria | 2977 |
| 110 | Ga0081539_10017940 | 3300005985 | Bacteria | 4938 |
| 111 | Ga0070717_10096757 | 3300006028 | Bacteria | 2501 |
| 112 | Ga0070716_100030951 | 3300006173 | Bacteria | 2908 |
| 113 | Ga0070712_100046551 | 3300006175 | Bacteria | 2999 |
| 114 | Ga0070712_100340092 | 3300006175 | Bacteria | 1225 |
| 115 | Ga0075366_10176568 | 3300006195 | Bacteria | 1297 |
| 116 | Ga0097621_100770035 | 3300006237 | Bacteria | 890 |
| 117 | Ga0068871_100829308 | 3300006358 | Bacteria | 854 |
| 118 | Ga0075428_101223627 | 3300006844 | Bacteria | 791 |
| 119 | Ga0075433_10047503 | 3300006852 | Bacteria | 3734 |
| 120 | Ga0075433_10391826 | 3300006852 | Unclassified | 1226 |
| 121 | Ga0075433_10749004 | 3300006852 | Bacteria | 855 |
| 122 | Ga0075434_100083879 | 3300006871 | Bacteria | 3185 |
| 123 | Ga0075434_100246401 | 3300006871 | Bacteria | 1806 |
| 124 | Ga0075434_101243963 | 3300006871 | Bacteria | 756 |
| 125 | Ga0075436_100112529 | 3300006914 | Unclassified | 1901 |
| 126 | Ga0097620_100031476 | 3300006931 | Bacteria | 5327 |
| 127 | Ga0097620_100745703 | 3300006931 | Bacteria | 1068 |
| 128 | Ga0075435_100007214 | 3300007076 | Bacteria | 7906 |
| 129 | Ga0075435_100044799 | 3300007076 | Unclassified | 3544 |
| 130 | Ga0075435_100136550 | 3300007076 | Bacteria | 2055 |
| 131 | Ga0075435_100703797 | 3300007076 | Bacteria | 878 |
| 132 | Ga0105240_10038474 | 3300009093 | Bacteria | 6136 |
| 133 | Ga0105240_10043979 | 3300009093 | Bacteria | 5679 |
| 134 | Ga0105240_10059800 | 3300009093 | Bacteria | 4753 |
| 135 | Ga0105240_10178015 | 3300009093 | Bacteria | 2512 |
| 136 | Ga0111539_10005968 | 3300009094 | Bacteria | 15728 |
| 137 | Ga0111539_10056813 | 3300009094 | Bacteria | 4650 |
| 138 | Ga0111539_10064851 | 3300009094 | Bacteria | 4319 |
| 139 | Ga0111539_10104832 | 3300009094 | Bacteria | 3317 |
| 140 | Ga0111539_10617462 | 3300009094 | Bacteria | 1263 |
| 141 | Ga0105245_10857687 | 3300009098 | Bacteria | 948 |
| 142 | Ga0114129_10091695 | 3300009147 | Bacteria | 4209 |
| 143 | Ga0105243_10052612 | 3300009148 | Bacteria | 3226 |
| 144 | Ga0105241_10385211 | 3300009174 | Bacteria | 1226 |
| 145 | Ga0105242_10003683 | 3300009176 | Bacteria | 11925 |
| 146 | Ga0105242_10114118 | 3300009176 | Bacteria | 2308 |
| 147 | Ga0105248_10300698 | 3300009177 | Unclassified | 1807 |
| 148 | Ga0105237_10035751 | 3300009545 | Bacteria | 5025 |
| 149 | Ga0105237_10060028 | 3300009545 | Bacteria | 3804 |
| 150 | Ga0105238_10032775 | 3300009551 | Bacteria | 5287 |
| 151 | Ga0105238_10203052 | 3300009551 | Bacteria | 1958 |
| 152 | Ga0105249_10670348 | 3300009553 | Bacteria | 1096 |
| 153 | Ga0105249_10744121 | 3300009553 | Bacteria | 1042 |
| 154 | Ga0105239_10160945 | 3300010375 | Bacteria | 2508 |
| 155 | Ga0105239_10295409 | 3300010375 | Bacteria | 1824 |
| 156 | Ga0105239_10306283 | 3300010375 | Bacteria | 1790 |
| 157 | Ga0105239_10515325 | 3300010375 | Bacteria | 1360 |
| 158 | Ga0105246_10187530 | 3300011119 | Bacteria | 1598 |
| 159 | Ga0157373_10152302 | 3300013100 | Bacteria | 1627 |
| 160 | Ga0157370_10043974 | 3300013104 | Bacteria | 4297 |
| 161 | Ga0157370_10045451 | 3300013104 | Bacteria | 4213 |
| 162 | Ga0157370_10114752 | 3300013104 | Bacteria | 2516 |
| 163 | Ga0157369_10000065 | 3300013105 | Bacteria | 144865 |
| 164 | Ga0157369_10007645 | 3300013105 | Bacteria | 12431 |
| 165 | Ga0157369_10128181 | 3300013105 | Bacteria | 2689 |
| 166 | Ga0157369_10436001 | 3300013105 | Bacteria | 1357 |
| 167 | Ga0157374_10083902 | 3300013296 | Bacteria | 3027 |
| 168 | Ga0157374_10207649 | 3300013296 | Bacteria | 1920 |
| 169 | Ga0157378_10341049 | 3300013297 | Bacteria | 1461 |
| 170 | Ga0157378_10433698 | 3300013297 | Unclassified | 1301 |
| 171 | Ga0163162_10003181 | 3300013306 | Bacteria | 15701 |
| 172 | Ga0157372_10842694 | 3300013307 | Bacteria | 1064 |
| 173 | Ga0163163_11142696 | 3300014325 | Bacteria | 841 |
| 174 | Ga0157379_10139969 | 3300014968 | Bacteria | 2181 |
| 175 | Ga0157376_10830137 | 3300014969 | Bacteria | 938 |
| 176 | Ga0197907_10906224 | 3300020069 | Bacteria | 971 |
| 177 | Ga0206356_10288393 | 3300020070 | Bacteria | 2100 |
| 178 | Ga0206354_11178999 | 3300020081 | Bacteria | 1974 |
| 179 | Ga0206353_10262045 | 3300020082 | Bacteria | 3052 |
| 180 | Ga0206353_10266005 | 3300020082 | Bacteria | 4806 |
| 181 | Ga0206353_10277908 | 3300020082 | Bacteria | 1684 |
| 182 | Ga0206353_10708738 | 3300020082 | Bacteria | 1462 |
| 183 | Ga0206353_11885480 | 3300020082 | Bacteria | 4428 |
| 184 | Ga0213876_10000008 | 3300021384 | Bacteria | 506740 |
| 185 | Ga0213876_10002664 | 3300021384 | Bacteria | 10424 |
| 186 | Ga0224712_10288903 | 3300022467 | Unclassified | 765 |
| 187 | Ga0207697_10136436 | 3300025315 | Bacteria | 1062 |
| 188 | Ga0207653_10000021 | 3300025885 | Bacteria | 127411 |
| 189 | Ga0207682_10026996 | 3300025893 | Bacteria | 2285 |
| 190 | Ga0207680_10042140 | 3300025903 | Bacteria | 2668 |
| 191 | Ga0207680_10360755 | 3300025903 | Bacteria | 1022 |
| 192 | Ga0207647_10064073 | 3300025904 | Bacteria | 2234 |
| 193 | Ga0207699_10000017 | 3300025906 | Bacteria | 189613 |
| 194 | Ga0207643_10118423 | 3300025908 | Bacteria | 1566 |
| 195 | Ga0207705_10060919 | 3300025909 | Bacteria | 2726 |
| 196 | Ga0207705_10413515 | 3300025909 | Bacteria | 1044 |
| 197 | Ga0207684_10000394 | 3300025910 | Bacteria | 58364 |
| 198 | Ga0207684_10480375 | 3300025910 | Bacteria | 1066 |
| 199 | Ga0207707_10178712 | 3300025912 | Bacteria | 1853 |
| 200 | Ga0207695_10072469 | 3300025913 | Bacteria | 3514 |
| 201 | Ga0207695_10214728 | 3300025913 | Bacteria | 1833 |
| 202 | Ga0207671_10037220 | 3300025914 | Bacteria | 3609 |
| 203 | Ga0207693_10058864 | 3300025915 | Bacteria | 3010 |
| 204 | Ga0207693_10754190 | 3300025915 | Bacteria | 752 |
| 205 | Ga0207663_10000006 | 3300025916 | Bacteria | 253740 |
| 206 | Ga0207663_10224910 | 3300025916 | Bacteria | 1367 |
| 207 | Ga0207660_10119870 | 3300025917 | Bacteria | 1991 |
| 208 | Ga0207660_10279949 | 3300025917 | Bacteria | 1323 |
| 209 | Ga0207660_10805134 | 3300025917 | Bacteria | 767 |
| 210 | Ga0207662_10027645 | 3300025918 | Bacteria | 3274 |
| 211 | Ga0207662_10231109 | 3300025918 | Bacteria | 1208 |
| 212 | Ga0207657_10000275 | 3300025919 | Bacteria | 54762 |
| 213 | Ga0207657_10001050 | 3300025919 | Bacteria | 29283 |
| 214 | Ga0207657_10216756 | 3300025919 | Bacteria | 1535 |
| 215 | Ga0207649_10770110 | 3300025920 | Bacteria | 750 |
| 216 | Ga0207652_10080235 | 3300025921 | Bacteria | 2852 |
| 217 | Ga0207652_10194101 | 3300025921 | Bacteria | 1826 |
| 218 | Ga0207646_10087953 | 3300025922 | Bacteria | 2780 |
| 219 | Ga0207646_10089140 | 3300025922 | Bacteria | 2761 |
| 220 | Ga0207681_10069176 | 3300025923 | Bacteria | 2455 |
| 221 | Ga0207681_10080789 | 3300025923 | Bacteria | 2294 |
| 222 | Ga0207681_11006153 | 3300025923 | Bacteria | 699 |
| 223 | Ga0207694_11301033 | 3300025924 | Bacteria | 615 |
| 224 | Ga0207650_10477483 | 3300025925 | Bacteria | 1040 |
| 225 | Ga0207659_10088672 | 3300025926 | Bacteria | 2305 |
| 226 | Ga0207659_10809768 | 3300025926 | Bacteria | 805 |
| 227 | Ga0207687_10000098 | 3300025927 | Bacteria | 63866 |
| 228 | Ga0207687_10141413 | 3300025927 | Bacteria | 1826 |
| 229 | Ga0207687_10276097 | 3300025927 | Bacteria | 1345 |
| 230 | Ga0207700_10382581 | 3300025928 | Bacteria | 1231 |
| 231 | Ga0207664_10608402 | 3300025929 | Bacteria | 981 |
| 232 | Ga0207644_10126609 | 3300025931 | Bacteria | 1950 |
| 233 | Ga0207644_10139978 | 3300025931 | Bacteria | 1862 |
| 234 | Ga0207690_10083935 | 3300025932 | Bacteria | 2232 |
| 235 | Ga0207690_10716518 | 3300025932 | Bacteria | 823 |
| 236 | Ga0207690_10785722 | 3300025932 | Unclassified | 786 |
| 237 | Ga0207706_10019700 | 3300025933 | Bacteria | 6069 |
| 238 | Ga0207686_10002498 | 3300025934 | Bacteria | 9988 |
| 239 | Ga0207686_10362535 | 3300025934 | Bacteria | 1094 |
| 240 | Ga0207686_10461936 | 3300025934 | Bacteria | 978 |
| 241 | Ga0207670_10000962 | 3300025936 | Bacteria | 15187 |
| 242 | Ga0207670_10049883 | 3300025936 | Bacteria | 2802 |
| 243 | Ga0207670_10058121 | 3300025936 | Bacteria | 2626 |
| 244 | Ga0207669_10101462 | 3300025937 | Bacteria | 1904 |
| 245 | Ga0207669_10212285 | 3300025937 | Bacteria | 1414 |
| 246 | Ga0207704_10184335 | 3300025938 | Bacteria | 1512 |
| 247 | Ga0207665_10021990 | 3300025939 | Bacteria | 4193 |
| 248 | Ga0207691_10046985 | 3300025940 | Bacteria | 3964 |
| 249 | Ga0207711_10076698 | 3300025941 | Bacteria | 2912 |
| 250 | Ga0207711_10291631 | 3300025941 | Bacteria | 1504 |
| 251 | Ga0207689_10036372 | 3300025942 | Bacteria | 4088 |
| 252 | Ga0207661_10063829 | 3300025944 | Bacteria | 2984 |
| 253 | Ga0207661_10210845 | 3300025944 | Bacteria | 1712 |
| 254 | Ga0207667_10078526 | 3300025949 | Bacteria | 3421 |
| 255 | Ga0207667_10079713 | 3300025949 | Bacteria | 3393 |
| 256 | Ga0207667_10933317 | 3300025949 | Bacteria | 858 |
| 257 | Ga0207712_10539325 | 3300025961 | Bacteria | 1002 |
| 258 | Ga0207658_10038047 | 3300025986 | Bacteria | 3463 |
| 259 | Ga0207658_10072971 | 3300025986 | Bacteria | 2604 |
| 260 | Ga0207677_10094236 | 3300026023 | Bacteria | 2185 |
| 261 | Ga0207703_10948017 | 3300026035 | Bacteria | 825 |
| 262 | Ga0207703_10995858 | 3300026035 | Bacteria | 804 |
| 263 | Ga0207639_10000073 | 3300026041 | Bacteria | 93577 |
| 264 | Ga0207678_10329951 | 3300026067 | Bacteria | 1313 |
| 265 | Ga0207708_10000409 | 3300026075 | Bacteria | 33843 |
| 266 | Ga0207708_10033198 | 3300026075 | Bacteria | 3920 |
| 267 | Ga0207708_10129503 | 3300026075 | Bacteria | 1972 |
| 268 | Ga0207702_10194666 | 3300026078 | Bacteria | 1875 |
| 269 | Ga0207702_10247904 | 3300026078 | Bacteria | 1671 |
| 270 | Ga0207702_11023333 | 3300026078 | Bacteria | 820 |
| 271 | Ga0207641_10302967 | 3300026088 | Bacteria | 1510 |
| 272 | Ga0207648_10005814 | 3300026089 | Bacteria | 12353 |
| 273 | Ga0207648_10182773 | 3300026089 | Bacteria | 1856 |
| 274 | Ga0207674_10054187 | 3300026116 | Bacteria | 4084 |
| 275 | Ga0207674_10186955 | 3300026116 | Bacteria | 2022 |
| 276 | Ga0207675_100041575 | 3300026118 | Bacteria | 4293 |
| 277 | Ga0207683_10032747 | 3300026121 | Bacteria | 4515 |
| 278 | Ga0207683_11226653 | 3300026121 | Bacteria | 695 |
| 279 | Ga0207698_10304438 | 3300026142 | Bacteria | 1485 |
| 280 | Ga0207698_10375453 | 3300026142 | Bacteria | 1351 |
| 281 | Ga0207698_10720137 | 3300026142 | Unclassified | 994 |
| 282 | Ga0207428_10000998 | 3300027907 | Bacteria | 31385 |
| 283 | Ga0207428_10081608 | 3300027907 | Bacteria | 2524 |
| 284 | Ga0268265_10186082 | 3300028380 | Bacteria | 1789 |
| 285 | Ga0268265_10735809 | 3300028380 | Unclassified | 956 |
| 286 | Ga0268264_10147354 | 3300028381 | Bacteria | 2106 |
| 287 | Ga0265319_1000068 | 3300028563 | Bacteria | 82808 |
| 288 | Ga0265318_10000040 | 3300028577 | Bacteria | 135603 |
| 289 | Ga0265318_10067405 | 3300028577 | Archaea | 1329 |
| 290 | Ga0265338_10032277 | 3300028800 | Bacteria | 5112 |
| 291 | Ga0265324_10064836 | 3300029957 | Bacteria | 1246 |
| 292 | Ga0265330_10000065 | 3300031235 | Bacteria | 91217 |
| 293 | Ga0265332_10001115 | 3300031238 | Bacteria | 15670 |
| 294 | Ga0265320_10000050 | 3300031240 | Bacteria | 116002 |
| 295 | Ga0265329_10000210 | 3300031242 | Bacteria | 30518 |
| 296 | Ga0265329_10049422 | 3300031242 | Bacteria | 1340 |
| 297 | Ga0265340_10003735 | 3300031247 | Bacteria | 8569 |
| 298 | Ga0265340_10326321 | 3300031247 | Archaea | 679 |
| 299 | Ga0265339_10151614 | 3300031249 | Bacteria | 1171 |
| 300 | Ga0265339_10172574 | 3300031249 | Unclassified | 1081 |
| 301 | Ga0265331_10000265 | 3300031250 | Bacteria | 59480 |
| 302 | Ga0265331_10037927 | 3300031250 | Bacteria | 2358 |
| 303 | Ga0265327_10141441 | 3300031251 | Bacteria | 1124 |
| 304 | Ga0265316_10000389 | 3300031344 | Bacteria | 50152 |
| 305 | Ga0265316_10394978 | 3300031344 | Bacteria | 996 |
| 306 | Ga0307513_10113520 | 3300031456 | Bacteria | 2696 |
| 307 | Ga0307408_100043781 | 3300031548 | Bacteria | 3187 |
| 308 | Ga0265313_10000040 | 3300031595 | Bacteria | 120713 |
| 309 | Ga0307508_10089850 | 3300031616 | Bacteria | 2657 |
| 310 | Ga0265314_10000117 | 3300031711 | Bacteria | 122918 |
| 311 | Ga0265342_10000037 | 3300031712 | Bacteria | 140873 |
| 312 | Ga0307405_10363817 | 3300031731 | Bacteria | 1120 |
| 313 | Ga0307409_100103661 | 3300031995 | Bacteria | 2367 |
| 314 | Ga0307416_100144226 | 3300032002 | Bacteria | 2171 |
| 315 | Ga0307416_100330622 | 3300032002 | Bacteria | 1531 |
| 316 | Ga0373926_0083314 | 3300035083 | Bacteria | 1184 |
| 317 | Ga0373953_0086057 | 3300035117 | Unclassified | 1312 |
| 318 | Ga0373943_0007236 | 3300035170 | Bacteria | 4980 |
| 319 | Ga0373927_0282726 | 3300035695 | Bacteria | 1091 |
| 320 | Ga0373947_0141468 | 3300035725 | Bacteria | 1543 |
| 321 | Ga0395900_0117239 | 3300037418 | Bacteria | 2732 |
| 322 | Ga0395900_0259520 | 3300037418 | Bacteria | 1736 |
| 323 | Ga0395900_0930647 | 3300037418 | Bacteria | 791 |
| 324 | Ga0395898_0032692 | 3300037466 | Bacteria | 5193 |
| 325 | Ga0395898_0058671 | 3300037466 | Bacteria | 3746 |
| 326 | Ga0395898_0239011 | 3300037466 | Bacteria | 1732 |
| 327 | Ga0395898_0581146 | 3300037466 | Bacteria | 1063 |
| 328 | Ga0395898_0767721 | 3300037466 | Bacteria | 905 |
| 329 | Ga0395905_0159594 | 3300037471 | Bacteria | 2120 |
| 330 | Ga0395905_0247522 | 3300037471 | Bacteria | 1665 |
| 331 | Ga0395901_0025438 | 3300038443 | Bacteria | 6076 |
| 332 | Ga0395901_0040004 | 3300038443 | Bacteria | 4853 |
| 333 | Ga0395901_0081344 | 3300038443 | Bacteria | 3383 |
| 334 | Ga0395901_0837697 | 3300038443 | Bacteria | 906 |
| 335 | Ga0436365_0221520 | 3300039437 | Bacteria | 1770 |
| 336 | Ga0436365_0670421 | 3300039437 | Bacteria | 180224 |
| 337 | Ga0436365_1511658 | 3300039437 | Bacteria | 2360 |
| 338 | Ga0436360_1049875 | 3300039438 | Bacteria | 2726 |
| 339 | Ga0436362_0561287 | 3300039453 | Bacteria | 848 |
| 340 | Ga0451849_0381006 | 3300041505 | Bacteria | 3239 |
| 341 | Ga0451855_1116450 | 3300041511 | Unclassified | 1215 |
| 342 | Ga0451853_0373412 | 3300041512 | Bacteria | 53125 |
| 343 | Ga0439448_0024922 | 3300042005 | Bacteria | 1873 |
| 344 | Ga0439448_0111672 | 3300042005 | Bacteria | 934 |
| 345 | Ga0450894_032633 | 3300042131 | Bacteria | 730 |
| 346 | Ga0450896_000960 | 3300042133 | Bacteria | 3346 |
| 347 | Ga0450898_010329 | 3300042134 | Bacteria | 1509 |
| 348 | Ga0451577_0002705 | 3300042876 | Bacteria | 20628 |
| 349 | Ga0466963_0027851 | 3300044694 | Bacteria | 3623 |
| 350 | Ga0466963_0064493 | 3300044694 | Bacteria | 2454 |
| 351 | Ga0453684_0005932 | 3300044712 | Bacteria | 23693 |
| 352 | Ga0466957_0007673 | 3300044842 | Bacteria | 6101 |
| 353 | Ga0466957_0028907 | 3300044842 | Bacteria | 3303 |
| 354 | Ga0466957_0215239 | 3300044842 | Bacteria | 1267 |
| 355 | Ga0466957_0222892 | 3300044842 | Bacteria | 1246 |
| 356 | Ga0466957_0664780 | 3300044842 | Archaea | 733 |
| 357 | Ga0466959_0043755 | 3300045049 | Bacteria | 3300 |
| 358 | Ga0451576_0108594 | 3300045051 | Bacteria | 2887 |
| 359 | Ga0466958_0008302 | 3300045836 | Bacteria | 5751 |
| 360 | Ga0466958_0143360 | 3300045836 | Bacteria | 1505 |
| 361 | Ga0466967_0016325 | 3300045976 | Bacteria | 5852 |
| 362 | Ga0466967_0018314 | 3300045976 | Bacteria | 5592 |
| 363 | Ga0466967_0034350 | 3300045976 | Bacteria | 4303 |
| 364 | Ga0466967_0055396 | 3300045976 | Bacteria | 3492 |
| 365 | Ga0466967_0136325 | 3300045976 | Bacteria | 2283 |
| 366 | Ga0466967_0143789 | 3300045976 | Bacteria | 2223 |
| 367 | Ga0466967_0449728 | 3300045976 | Archaea | 1259 |
| 368 | Ga0466967_0506763 | 3300045976 | Bacteria | 1185 |
| 369 | Ga0466967_0640592 | 3300045976 | Unclassified | 1050 |
| 370 | Ga0466967_1125492 | 3300045976 | Bacteria | 782 |
| 371 | Ga0495592_0068694 | 3300046454 | Bacteria | 2586 |
| 372 | Ga0495592_0092010 | 3300046454 | Bacteria | 2174 |
| 373 | Ga0495592_0165046 | 3300046454 | Bacteria | 1521 |
| 374 | Ga0495641_0114369 | 3300046461 | Bacteria | 1204 |
| 375 | Ga0495651_0124079 | 3300046462 | Bacteria | 1893 |
| 376 | Ga0495651_0131251 | 3300046462 | Bacteria | 1828 |
| 377 | Ga0495605_0050203 | 3300046474 | Bacteria | 2036 |
| 378 | Ga0495608_0099425 | 3300046511 | Bacteria | 1876 |
| 379 | Ga0495628_0105411 | 3300046516 | Bacteria | 2172 |
| 380 | Ga0495628_0169720 | 3300046516 | Bacteria | 1655 |
| 381 | Ga0495630_0092367 | 3300046517 | Bacteria | 2288 |
| 382 | Ga0495630_0639542 | 3300046517 | Bacteria | 815 |
| 383 | Ga0495652_0724529 | 3300046529 | Unclassified | 667 |
| 384 | Ga0495640_0113208 | 3300046533 | Bacteria | 1771 |
| 385 | Ga0495586_0002714 | 3300046535 | Bacteria | 9580 |
| 386 | Ga0495587_0021012 | 3300046536 | Bacteria | 4026 |
| 387 | Ga0495645_0059021 | 3300046543 | Bacteria | 2783 |
| 388 | Ga0495645_0200659 | 3300046543 | Bacteria | 1353 |
| 389 | Ga0495667_0116689 | 3300046559 | Bacteria | 1724 |
| 390 | Ga0495656_0059087 | 3300046615 | Bacteria | 1667 |
| 391 | Ga0495657_0092967 | 3300046675 | Bacteria | 1931 |
| 392 | Ga0495657_0180094 | 3300046675 | Bacteria | 1298 |
| 393 | Ga0495599_0059582 | 3300046678 | Bacteria | 2388 |
| 394 | Ga0495599_0070525 | 3300046678 | Bacteria | 2181 |
| 395 | Ga0495599_0094469 | 3300046678 | Bacteria | 1865 |
| 396 | Ga0495599_0179596 | 3300046678 | Bacteria | 1305 |
| 397 | Ga0495646_0037898 | 3300046680 | Bacteria | 2980 |
| 398 | Ga0495674_0102352 | 3300047319 | Bacteria | 2436 |
| 399 | Ga0495676_0157983 | 3300047321 | Bacteria | 1607 |
| 400 | Ga0495680_0665067 | 3300047322 | Bacteria | 691 |
| 401 | Ga0495675_0139443 | 3300047444 | Bacteria | 1504 |
| 402 | Ga0495602_0397090 | 3300048088 | Bacteria | 984 |
| 403 | Ga0496100_0177053 | 3300048903 | Bacteria | 1540 |
| 404 | Ga0496101_0007907 | 3300048904 | Bacteria | 6923 |
| 405 | Ga0496102_0185020 | 3300048905 | Archaea | 1963 |
| 406 | Ga0496102_0517898 | 3300048905 | Bacteria | 1115 |
| 407 | Ga0496104_0199366 | 3300048907 | Bacteria | 1914 |
| 408 | Ga0496107_0023681 | 3300048910 | Bacteria | 4340 |
| 409 | Ga0496107_0069661 | 3300048910 | Bacteria | 2554 |
| 410 | Ga0496109_0039094 | 3300048912 | Bacteria | 4293 |
| 411 | Ga0496110_0206408 | 3300048913 | Bacteria | 1786 |
| 412 | Ga0496110_0378370 | 3300048913 | Bacteria | 1290 |
| 413 | Ga0496112_0007581 | 3300048915 | Bacteria | 9642 |
| 414 | Ga0496112_0026840 | 3300048915 | Bacteria | 5549 |
| 415 | Ga0496112_0729441 | 3300048915 | Bacteria | 918 |
| 416 | Ga0496113_0101885 | 3300048916 | Bacteria | 2226 |
| 417 | Ga0496114_0041443 | 3300048917 | Bacteria | 3816 |
| 418 | Ga0496114_0046958 | 3300048917 | Bacteria | 3590 |
| 419 | Ga0496114_0247390 | 3300048917 | Bacteria | 1569 |
| 420 | Ga0496115_0008439 | 3300048918 | Bacteria | 7623 |
| 421 | Ga0501031_0173524 | 3300049568 | Bacteria | 1409 |
| 422 | Ga0501032_0004392 | 3300049569 | Bacteria | 10644 |
| 423 | Ga0501032_0005707 | 3300049569 | Bacteria | 9212 |
| 424 | Ga0501032_0347682 | 3300049569 | Bacteria | 955 |
| 425 | Ga0501033_0298221 | 3300049570 | Bacteria | 1135 |
| 426 | Ga0501034_0005150 | 3300049571 | Bacteria | 14343 |
| 427 | Ga0501034_0075276 | 3300049571 | Bacteria | 3383 |
| 428 | Ga0501034_0127603 | 3300049571 | Bacteria | 2528 |
| 429 | Ga0501034_0142623 | 3300049571 | Bacteria | 2374 |
| 430 | Ga0501036_0018437 | 3300049572 | Bacteria | 5847 |
| 431 | Ga0501036_0215370 | 3300049572 | Bacteria | 1613 |
| 432 | Ga0501037_0025268 | 3300049573 | Bacteria | 4388 |
| 433 | Ga0501037_0182143 | 3300049573 | Bacteria | 1490 |
| 434 | Ga0501037_0229273 | 3300049573 | Bacteria | 1304 |
| 435 | Ga0501038_0022442 | 3300049574 | Bacteria | 5655 |
| 436 | Ga0501038_0036573 | 3300049574 | Bacteria | 4308 |
| 437 | Ga0501039_0031628 | 3300049575 | Bacteria | 4080 |
| 438 | Ga0501039_0083973 | 3300049575 | Bacteria | 2480 |
| 439 | Ga0501039_0285991 | 3300049575 | Bacteria | 1296 |
| 440 | Ga0501042_0169833 | 3300049578 | Bacteria | 1574 |
| 441 | Ga0501043_0012710 | 3300049579 | Bacteria | 6582 |
| 442 | Ga0501043_0038391 | 3300049579 | Bacteria | 3765 |
| 443 | Ga0501043_0039540 | 3300049579 | Bacteria | 3706 |
| 444 | Ga0501043_0609603 | 3300049579 | Bacteria | 805 |
| 445 | Ga0501046_0005157 | 3300049580 | Bacteria | 11710 |
| 446 | Ga0501046_0047415 | 3300049580 | Bacteria | 3406 |
| 447 | Ga0501046_0383931 | 3300049580 | Bacteria | 1016 |
| 448 | Ga0501046_0436598 | 3300049580 | Bacteria | 942 |
| 449 | Ga0501047_0004351 | 3300049581 | Bacteria | 13321 |
| 450 | Ga0501047_0043189 | 3300049581 | Bacteria | 4354 |
| 451 | Ga0501047_0075319 | 3300049581 | Bacteria | 3247 |
| 452 | Ga0501047_0149332 | 3300049581 | Bacteria | 2213 |
| 453 | Ga0501047_0255833 | 3300049581 | Bacteria | 1599 |
| 454 | Ga0501048_0007911 | 3300049582 | Bacteria | 8050 |
| 455 | Ga0501048_0083249 | 3300049582 | Bacteria | 2256 |
| 456 | Ga0501048_0280253 | 3300049582 | Bacteria | 1185 |
| 457 | Ga0501067_0010991 | 3300049583 | Bacteria | 5013 |
| 458 | Ga0501067_0016421 | 3300049583 | Bacteria | 4090 |
| 459 | Ga0501067_0298128 | 3300049583 | Bacteria | 897 |
| 460 | Ga0501068_0005157 | 3300049584 | Bacteria | 7125 |
| 461 | Ga0501068_0420208 | 3300049584 | Bacteria | 863 |
| 462 | Ga0501069_0011667 | 3300049585 | Bacteria | 4659 |
| 463 | Ga0501070_0056475 | 3300049586 | Bacteria | 3254 |
| 464 | Ga0501070_0095878 | 3300049586 | Bacteria | 2454 |
| 465 | Ga0501070_0280605 | 3300049586 | Bacteria | 1359 |
| 466 | Ga0501070_0682880 | 3300049586 | Bacteria | 813 |
| 467 | Ga0501071_0227525 | 3300049587 | Bacteria | 1405 |
| 468 | Ga0501072_0002379 | 3300049588 | Bacteria | 14112 |
| 469 | Ga0501072_0025885 | 3300049588 | Bacteria | 4571 |
| 470 | Ga0501072_0191085 | 3300049588 | Bacteria | 1633 |
| 471 | Ga0501072_0359158 | 3300049588 | Bacteria | 1156 |
| 472 | Ga0501073_0002377 | 3300049589 | Bacteria | 14091 |
| 473 | Ga0501073_0025811 | 3300049589 | Bacteria | 4209 |
| 474 | Ga0501073_0035129 | 3300049589 | Bacteria | 3563 |
| 475 | Ga0501073_0067440 | 3300049589 | Bacteria | 2494 |
| 476 | Ga0501073_0070929 | 3300049589 | Bacteria | 2427 |
| 477 | Ga0501073_0281465 | 3300049589 | Bacteria | 1147 |
| 478 | Ga0501073_0290535 | 3300049589 | Bacteria | 1128 |
| 479 | Ga0501074_0006600 | 3300049590 | Bacteria | 8388 |
| 480 | Ga0501074_0081185 | 3300049590 | Bacteria | 2325 |
| 481 | Ga0501074_0373418 | 3300049590 | Bacteria | 1012 |
| 482 | Ga0501077_0064679 | 3300049593 | Bacteria | 2320 |
| 483 | Ga0501077_0153051 | 3300049593 | Bacteria | 1464 |
| 484 | Ga0501079_0016754 | 3300049741 | Bacteria | 5597 |
| 485 | Ga0501079_0646497 | 3300049741 | Bacteria | 833 |
| 486 | Ga0501080_0005425 | 3300049742 | Bacteria | 11376 |
| 487 | Ga0501080_0016151 | 3300049742 | Bacteria | 6891 |
| 488 | Ga0501080_0045419 | 3300049742 | Bacteria | 4089 |
| 489 | Ga0501080_0141922 | 3300049742 | Bacteria | 2220 |
| 490 | Ga0501080_0571774 | 3300049742 | Bacteria | 1005 |
| 491 | Ga0501083_0000290 | 3300049744 | Bacteria | 31698 |
| 492 | Ga0501083_0015872 | 3300049744 | Bacteria | 5271 |
| 493 | Ga0501083_0030226 | 3300049744 | Bacteria | 3722 |
| 494 | Ga0501083_0057701 | 3300049744 | Bacteria | 2598 |
| 495 | Ga0501083_0206257 | 3300049744 | Archaea | 1282 |
| 496 | Ga0501035_0047150 | 3300049822 | Bacteria | 3870 |
| 497 | Ga0501035_0077967 | 3300049822 | Bacteria | 2928 |
| 498 | Ga0501044_0006011 | 3300049823 | Bacteria | 13408 |
| 499 | Ga0501044_0088969 | 3300049823 | Bacteria | 3117 |
| 500 | Ga0501044_0632526 | 3300049823 | Bacteria | 960 |
| 501 | nmdc:mga0k408_217103_c1 | 3300050493 | Bacteria | 1142 |
| 502 | nmdc:mga05p37_464377_c1 | 3300050507 | Bacteria | 1462 |
| 503 | nmdc:mga08y16_1686_c1 | 3300050511 | Bacteria | 22422 |
| 504 | nmdc:mga08y16_580460_c1 | 3300050511 | Bacteria | 1132 |
| 505 | nmdc:mga08y16_66625_c1 | 3300050511 | Bacteria | 3758 |
| 506 | nmdc:mga08y16_8864_c1 | 3300050511 | Bacteria | 10559 |
| 507 | nmdc:mga0n895_1202876_c1 | 3300050512 | Bacteria | 732 |
| 508 | nmdc:mga0n895_262795_c1 | 3300050512 | Bacteria | 1751 |
| 509 | nmdc:mga0n895_27769_c1 | 3300050512 | Bacteria | 5379 |
| 510 | nmdc:mga0n895_405690_c1 | 3300050512 | Bacteria | 1378 |
| 511 | nmdc:mga0n895_502071_c1 | 3300050512 | Bacteria | 1222 |
| 512 | nmdc:mga0rr50_42576_c1 | 3300050513 | Bacteria | 3317 |
| 513 | nmdc:mga0rr50_52486_c1 | 3300050513 | Unclassified | 3030 |
| 514 | nmdc:mga08x19_130948_c1 | 3300050514 | Unclassified | 1687 |
| 515 | nmdc:mga08x19_45_c1 | 3300050514 | Bacteria | 147507 |
| 516 | nmdc:mga08x19_611287_c1 | 3300050514 | Bacteria | 773 |
| 517 | nmdc:mga0a205_429929_c1 | 3300050515 | Bacteria | 1182 |
| 518 | nmdc:mga0a205_65482_c1 | 3300050515 | Unclassified | 3511 |
| 519 | nmdc:mga0a205_666735_c1 | 3300050515 | Bacteria | 891 |
| 520 | Ga0495601_0309982 | 3300053077 | Bacteria | 1028 |
| 521 | Ga0495601_0390612 | 3300053077 | Bacteria | 902 |
| 522 | Ga0495655_0003734 | 3300053083 | Bacteria | 2540 |
| 523 | Ga0495595_0005829 | 3300053084 | Bacteria | 4989 |
| 524 | Ga0495619_0438655 | 3300053085 | Bacteria | 900 |
| 525 | Ga0495619_0944540 | 3300053085 | Bacteria | 579 |
| 526 | Ga0500616_0000595 | 3300053153 | Bacteria | 43987 |
| 527 | Ga0501084_0061291 | 3300054114 | Bacteria | 3150 |
| 528 | Ga0501084_0061842 | 3300054114 | Bacteria | 3135 |
| 529 | Ga0501084_0089388 | 3300054114 | Bacteria | 2585 |
| 530 | Ga0501084_0140170 | 3300054114 | Bacteria | 2036 |
| 531 | Ga0501082_0003404 | 3300060353 | Bacteria | 13888 |
| 532 | Ga0501082_0021843 | 3300060353 | Bacteria | 5516 |
| 533 | Ga0501082_0163030 | 3300060353 | Bacteria | 1937 |
| 534 | Ga0501082_0325654 | 3300060353 | Bacteria | 1339 |
| 535 | Ga0501082_0364205 | 3300060353 | Unclassified | 1261 |
| 536 | Ga0501082_0530305 | 3300060353 | Bacteria | 1029 |
| 537 | Ga0501082_0778822 | 3300060353 | Bacteria | 837 |
| 538 | Ga0501082_0906746 | 3300060353 | Bacteria | 771 |
| 539 | Ga0501082_0987558 | 3300060353 | Bacteria | 736 |
| 540 | Ga0466962_0002161 | 3300061719 | Bacteria | 9288 |
| 541 | Ga0530510_0185221 | 3300061734 | Bacteria | 1545 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300029957 | Ga0265324_10064836 | Ga0265324_100648361 | 169 |
| 2 | 3300031242 | Ga0265329_10049422 | Ga0265329_100494222 | 169 |
| 3 | 3300031247 | Ga0265340_10326321 | Ga0265340_103263211 | 169 |
| 4 | 3300031249 | Ga0265339_10151614 | Ga0265339_101516141 | 169 |
| 5 | 3300031250 | Ga0265331_10037927 | Ga0265331_100379272 | 169 |
| 6 | 3300031251 | Ga0265327_10141441 | Ga0265327_101414412 | 169 |
| 7 | 3300028577 | Ga0265318_10067405 | Ga0265318_100674052 | 170 |
| 8 | 3300028800 | Ga0265338_10032277 | Ga0265338_100322773 | 170 |
| 9 | 3300031344 | Ga0265316_10394978 | Ga0265316_103949782 | 170 |
| 10 | 3300005329 | Ga0070683_100242391 | Ga0070683_1002423912 | 176 |
| 11 | 3300005329 | Ga0070683_100363900 | Ga0070683_1003639002 | 176 |
| 12 | 3300005535 | Ga0070684_100300706 | Ga0070684_1003007062 | 176 |
| 13 | 3300005563 | Ga0068855_100046978 | Ga0068855_1000469785 | 176 |
| 14 | 3300005563 | Ga0068855_100288186 | Ga0068855_1002881862 | 176 |
| 15 | 3300009093 | Ga0105240_10059800 | Ga0105240_100598003 | 176 |
| 16 | 3300013104 | Ga0157370_10114752 | Ga0157370_101147521 | 176 |
| 17 | 3300013105 | Ga0157369_10007645 | Ga0157369_100076455 | 176 |
| 18 | 3300020081 | Ga0206354_11178999 | Ga0206354_111789992 | 176 |
| 19 | 3300020082 | Ga0206353_10277908 | Ga0206353_102779082 | 176 |
| 20 | 3300020082 | Ga0206353_11885480 | Ga0206353_118854803 | 176 |
| 21 | 3300025909 | Ga0207705_10060919 | Ga0207705_100609194 | 176 |
| 22 | 3300025913 | Ga0207695_10214728 | Ga0207695_102147282 | 176 |
| 23 | 3300025944 | Ga0207661_10210845 | Ga0207661_102108452 | 176 |
| 24 | 3300025949 | Ga0207667_10078526 | Ga0207667_100785262 | 176 |
| 25 | 3300035083 | Ga0373926_0083314 | Ga0373926_0083314_224_754 | 176 |
| 26 | 3300035170 | Ga0373943_0007236 | Ga0373943_0007236_4196_4726 | 176 |
| 27 | 3300035695 | Ga0373927_0282726 | Ga0373927_0282726_534_1064 | 176 |
| 28 | 3300035725 | Ga0373947_0141468 | Ga0373947_0141468_178_708 | 176 |
| 29 | 3300050512 | nmdc:mga0n895_262795_c1 | nmdc:mga0n895_262795_c1_434_964 | 176 |
| 30 | 3300005436 | Ga0070713_100061720 | Ga0070713_1000617203 | 177 |
| 31 | 3300005439 | Ga0070711_101092470 | Ga0070711_1010924701 | 177 |
| 32 | 3300006175 | Ga0070712_100340092 | Ga0070712_1003400922 | 177 |
| 33 | 3300025917 | Ga0207660_10805134 | Ga0207660_108051342 | 177 |
| 34 | 3300025929 | Ga0207664_10608402 | Ga0207664_106084022 | 177 |
| 35 | 3300039438 | Ga0436360_1049875 | Ga0436360_1049875_1789_2322 | 177 |
| 36 | 3300039453 | Ga0436362_0561287 | Ga0436362_0561287_264_797 | 177 |
| 37 | 3300048088 | Ga0495602_0397090 | Ga0495602_0397090_190_723 | 177 |
| 38 | 3300048913 | Ga0496110_0206408 | Ga0496110_0206408_834_1370 | 177 |
| 39 | 3300005327 | Ga0070658_10535862 | Ga0070658_105358622 | 178 |
| 40 | 3300005329 | Ga0070683_100114159 | Ga0070683_1001141593 | 178 |
| 41 | 3300005336 | Ga0070680_100096408 | Ga0070680_1000964082 | 178 |
| 42 | 3300005336 | Ga0070680_100183214 | Ga0070680_1001832142 | 178 |
| 43 | 3300005336 | Ga0070680_100829489 | Ga0070680_1008294891 | 178 |
| 44 | 3300005337 | Ga0070682_100021222 | Ga0070682_1000212222 | 178 |
| 45 | 3300005337 | Ga0070682_101181825 | Ga0070682_1011818251 | 178 |
| 46 | 3300005339 | Ga0070660_100015990 | Ga0070660_1000159902 | 178 |
| 47 | 3300005339 | Ga0070660_100051551 | Ga0070660_1000515512 | 178 |
| 48 | 3300005339 | Ga0070660_100157933 | Ga0070660_1001579331 | 178 |
| 49 | 3300005341 | Ga0070691_10144199 | Ga0070691_101441991 | 178 |
| 50 | 3300005344 | Ga0070661_100071796 | Ga0070661_1000717962 | 178 |
| 51 | 3300005445 | Ga0070708_100309336 | Ga0070708_1003093362 | 178 |
| 52 | 3300005458 | Ga0070681_10002092 | Ga0070681_1000209217 | 178 |
| 53 | 3300005458 | Ga0070681_10702839 | Ga0070681_107028391 | 178 |
| 54 | 3300005468 | Ga0070707_100104089 | Ga0070707_1001040893 | 178 |
| 55 | 3300005518 | Ga0070699_100128227 | Ga0070699_1001282273 | 178 |
| 56 | 3300005530 | Ga0070679_100073685 | Ga0070679_1000736852 | 178 |
| 57 | 3300005530 | Ga0070679_100092231 | Ga0070679_1000922312 | 178 |
| 58 | 3300005546 | Ga0070696_100034272 | Ga0070696_1000342724 | 178 |
| 59 | 3300005548 | Ga0070665_100174006 | Ga0070665_1001740062 | 178 |
| 60 | 3300005563 | Ga0068855_100042669 | Ga0068855_1000426694 | 178 |
| 61 | 3300005563 | Ga0068855_100082698 | Ga0068855_1000826982 | 178 |
| 62 | 3300005563 | Ga0068855_100136474 | Ga0068855_1001364742 | 178 |
| 63 | 3300005577 | Ga0068857_100108040 | Ga0068857_1001080403 | 178 |
| 64 | 3300005614 | Ga0068856_100010271 | Ga0068856_1000102715 | 178 |
| 65 | 3300005614 | Ga0068856_100387327 | Ga0068856_1003873272 | 178 |
| 66 | 3300005616 | Ga0068852_101303792 | Ga0068852_1013037922 | 178 |
| 67 | 3300009093 | Ga0105240_10038474 | Ga0105240_100384742 | 178 |
| 68 | 3300009093 | Ga0105240_10178015 | Ga0105240_101780152 | 178 |
| 69 | 3300009174 | Ga0105241_10385211 | Ga0105241_103852112 | 178 |
| 70 | 3300009545 | Ga0105237_10035751 | Ga0105237_100357513 | 178 |
| 71 | 3300009545 | Ga0105237_10060028 | Ga0105237_100600282 | 178 |
| 72 | 3300009551 | Ga0105238_10032775 | Ga0105238_100327755 | 178 |
| 73 | 3300009551 | Ga0105238_10203052 | Ga0105238_102030523 | 178 |
| 74 | 3300010375 | Ga0105239_10160945 | Ga0105239_101609452 | 178 |
| 75 | 3300013100 | Ga0157373_10152302 | Ga0157373_101523022 | 178 |
| 76 | 3300013104 | Ga0157370_10043974 | Ga0157370_100439744 | 178 |
| 77 | 3300013104 | Ga0157370_10045451 | Ga0157370_100454512 | 178 |
| 78 | 3300013105 | Ga0157369_10128181 | Ga0157369_101281812 | 178 |
| 79 | 3300013105 | Ga0157369_10436001 | Ga0157369_104360012 | 178 |
| 80 | 3300013296 | Ga0157374_10083902 | Ga0157374_100839023 | 178 |
| 81 | 3300013307 | Ga0157372_10842694 | Ga0157372_108426942 | 178 |
| 82 | 3300020069 | Ga0197907_10906224 | Ga0197907_109062241 | 178 |
| 83 | 3300020070 | Ga0206356_10288393 | Ga0206356_102883933 | 178 |
| 84 | 3300020082 | Ga0206353_10262045 | Ga0206353_102620452 | 178 |
| 85 | 3300020082 | Ga0206353_10266005 | Ga0206353_102660055 | 178 |
| 86 | 3300025909 | Ga0207705_10413515 | Ga0207705_104135152 | 178 |
| 87 | 3300025912 | Ga0207707_10178712 | Ga0207707_101787121 | 178 |
| 88 | 3300025914 | Ga0207671_10037220 | Ga0207671_100372203 | 178 |
| 89 | 3300025917 | Ga0207660_10119870 | Ga0207660_101198702 | 178 |
| 90 | 3300025917 | Ga0207660_10279949 | Ga0207660_102799492 | 178 |
| 91 | 3300025919 | Ga0207657_10000275 | Ga0207657_1000027541 | 178 |
| 92 | 3300025919 | Ga0207657_10001050 | Ga0207657_100010505 | 178 |
| 93 | 3300025919 | Ga0207657_10216756 | Ga0207657_102167562 | 178 |
| 94 | 3300025920 | Ga0207649_10770110 | Ga0207649_107701101 | 178 |
| 95 | 3300025921 | Ga0207652_10080235 | Ga0207652_100802352 | 178 |
| 96 | 3300025921 | Ga0207652_10194101 | Ga0207652_101941012 | 178 |
| 97 | 3300025922 | Ga0207646_10089140 | Ga0207646_100891403 | 178 |
| 98 | 3300025924 | Ga0207694_11301033 | Ga0207694_113010331 | 178 |
| 99 | 3300025932 | Ga0207690_10716518 | Ga0207690_107165182 | 178 |
| 100 | 3300025932 | Ga0207690_10785722 | Ga0207690_107857222 | 178 |
| 101 | 3300025949 | Ga0207667_10079713 | Ga0207667_100797132 | 178 |
| 102 | 3300025949 | Ga0207667_10933317 | Ga0207667_109333172 | 178 |
| 103 | 3300026067 | Ga0207678_10329951 | Ga0207678_103299512 | 178 |
| 104 | 3300026078 | Ga0207702_10194666 | Ga0207702_101946662 | 178 |
| 105 | 3300026078 | Ga0207702_10247904 | Ga0207702_102479042 | 178 |
| 106 | 3300026116 | Ga0207674_10054187 | Ga0207674_100541872 | 178 |
| 107 | 3300026121 | Ga0207683_11226653 | Ga0207683_112266532 | 178 |
| 108 | 3300026142 | Ga0207698_10304438 | Ga0207698_103044382 | 178 |
| 109 | 3300026142 | Ga0207698_10375453 | Ga0207698_103754532 | 178 |
| 110 | 3300037418 | Ga0395900_0117239 | Ga0395900_0117239_1032_1568 | 178 |
| 111 | 3300037418 | Ga0395900_0259520 | Ga0395900_0259520_942_1478 | 178 |
| 112 | 3300037466 | Ga0395898_0058671 | Ga0395898_0058671_858_1394 | 178 |
| 113 | 3300037466 | Ga0395898_0239011 | Ga0395898_0239011_270_806 | 178 |
| 114 | 3300037466 | Ga0395898_0581146 | Ga0395898_0581146_394_930 | 178 |
| 115 | 3300038443 | Ga0395901_0081344 | Ga0395901_0081344_1099_1635 | 178 |
| 116 | 3300042005 | Ga0439448_0111672 | Ga0439448_0111672_175_711 | 178 |
| 117 | 3300044842 | Ga0466957_0215239 | Ga0466957_0215239_39_575 | 178 |
| 118 | 3300045836 | Ga0466958_0143360 | Ga0466958_0143360_249_788 | 178 |
| 119 | 3300045976 | Ga0466967_0034350 | Ga0466967_0034350_529_1068 | 178 |
| 120 | 3300045976 | Ga0466967_0449728 | Ga0466967_0449728_185_721 | 178 |
| 121 | 3300045976 | Ga0466967_0640592 | Ga0466967_0640592_388_924 | 178 |
| 122 | 3300046454 | Ga0495592_0092010 | Ga0495592_0092010_735_1271 | 178 |
| 123 | 3300046543 | Ga0495645_0200659 | Ga0495645_0200659_394_930 | 178 |
| 124 | 3300046559 | Ga0495667_0116689 | Ga0495667_0116689_61_597 | 178 |
| 125 | 3300046675 | Ga0495657_0180094 | Ga0495657_0180094_161_697 | 178 |
| 126 | 3300046678 | Ga0495599_0070525 | Ga0495599_0070525_1152_1688 | 178 |
| 127 | 3300047321 | Ga0495676_0157983 | Ga0495676_0157983_275_811 | 178 |
| 128 | 3300048903 | Ga0496100_0177053 | Ga0496100_0177053_681_1217 | 178 |
| 129 | 3300048904 | Ga0496101_0007907 | Ga0496101_0007907_5572_6108 | 178 |
| 130 | 3300048905 | Ga0496102_0185020 | Ga0496102_0185020_77_613 | 178 |
| 131 | 3300048905 | Ga0496102_0517898 | Ga0496102_0517898_109_645 | 178 |
| 132 | 3300048907 | Ga0496104_0199366 | Ga0496104_0199366_363_899 | 178 |
| 133 | 3300048917 | Ga0496114_0041443 | Ga0496114_0041443_1733_2269 | 178 |
| 134 | 3300048918 | Ga0496115_0008439 | Ga0496115_0008439_4602_5138 | 178 |
| 135 | 3300049590 | Ga0501074_0373418 | Ga0501074_0373418_152_688 | 178 |
| 136 | 3300053077 | Ga0495601_0390612 | Ga0495601_0390612_328_864 | 178 |
| 137 | 3300005336 | Ga0070680_100165194 | Ga0070680_1001651943 | 179 |
| 138 | 3300005530 | Ga0070679_100184386 | Ga0070679_1001843862 | 179 |
| 139 | 3300009098 | Ga0105245_10857687 | Ga0105245_108576872 | 179 |
| 140 | 3300013296 | Ga0157374_10207649 | Ga0157374_102076492 | 179 |
| 141 | 3300014968 | Ga0157379_10139969 | Ga0157379_101399692 | 179 |
| 142 | 3300014969 | Ga0157376_10830137 | Ga0157376_108301372 | 179 |
| 143 | 3300020082 | Ga0206353_10708738 | Ga0206353_107087382 | 179 |
| 144 | 3300022467 | Ga0224712_10288903 | Ga0224712_102889031 | 179 |
| 145 | 3300025986 | Ga0207658_10038047 | Ga0207658_100380472 | 179 |
| 146 | 3300026035 | Ga0207703_10948017 | Ga0207703_109480171 | 179 |
| 147 | 3300031548 | Ga0307408_100043781 | Ga0307408_1000437812 | 179 |
| 148 | 3300031731 | Ga0307405_10363817 | Ga0307405_103638172 | 179 |
| 149 | 3300031995 | Ga0307409_100103661 | Ga0307409_1001036613 | 179 |
| 150 | 3300032002 | Ga0307416_100330622 | Ga0307416_1003306222 | 179 |
| 151 | 3300037418 | Ga0395900_0930647 | Ga0395900_0930647_15_554 | 179 |
| 152 | 3300037466 | Ga0395898_0032692 | Ga0395898_0032692_3895_4434 | 179 |
| 153 | 3300037466 | Ga0395898_0767721 | Ga0395898_0767721_96_635 | 179 |
| 154 | 3300037471 | Ga0395905_0159594 | Ga0395905_0159594_1091_1630 | 179 |
| 155 | 3300037471 | Ga0395905_0247522 | Ga0395905_0247522_548_1087 | 179 |
| 156 | 3300038443 | Ga0395901_0025438 | Ga0395901_0025438_3696_4235 | 179 |
| 157 | 3300038443 | Ga0395901_0040004 | Ga0395901_0040004_3895_4434 | 179 |
| 158 | 3300038443 | Ga0395901_0837697 | Ga0395901_0837697_319_858 | 179 |
| 159 | 3300039437 | Ga0436365_0221520 | Ga0436365_0221520_316_855 | 179 |
| 160 | 3300044694 | Ga0466963_0027851 | Ga0466963_0027851_2960_3499 | 179 |
| 161 | 3300044694 | Ga0466963_0064493 | Ga0466963_0064493_785_1324 | 179 |
| 162 | 3300044842 | Ga0466957_0007673 | Ga0466957_0007673_530_1069 | 179 |
| 163 | 3300044842 | Ga0466957_0028907 | Ga0466957_0028907_2247_2786 | 179 |
| 164 | 3300044842 | Ga0466957_0664780 | Ga0466957_0664780_118_657 | 179 |
| 165 | 3300045049 | Ga0466959_0043755 | Ga0466959_0043755_2606_3145 | 179 |
| 166 | 3300045836 | Ga0466958_0008302 | Ga0466958_0008302_3054_3593 | 179 |
| 167 | 3300045976 | Ga0466967_0016325 | Ga0466967_0016325_4813_5352 | 179 |
| 168 | 3300045976 | Ga0466967_0018314 | Ga0466967_0018314_1107_1646 | 179 |
| 169 | 3300045976 | Ga0466967_0055396 | Ga0466967_0055396_658_1197 | 179 |
| 170 | 3300045976 | Ga0466967_0136325 | Ga0466967_0136325_595_1134 | 179 |
| 171 | 3300045976 | Ga0466967_0506763 | Ga0466967_0506763_230_769 | 179 |
| 172 | 3300046474 | Ga0495605_0050203 | Ga0495605_0050203_23_562 | 179 |
| 173 | 3300046533 | Ga0495640_0113208 | Ga0495640_0113208_1202_1741 | 179 |
| 174 | 3300048910 | Ga0496107_0023681 | Ga0496107_0023681_2071_2709 | 179 |
| 175 | 3300048915 | Ga0496112_0007581 | Ga0496112_0007581_2362_2901 | 179 |
| 176 | 3300048917 | Ga0496114_0046958 | Ga0496114_0046958_1958_2596 | 179 |
| 177 | 3300049586 | Ga0501070_0056475 | Ga0501070_0056475_1551_2090 | 179 |
| 178 | 3300049588 | Ga0501072_0002379 | Ga0501072_0002379_1469_2008 | 179 |
| 179 | 3300049589 | Ga0501073_0035129 | Ga0501073_0035129_2489_3028 | 179 |
| 180 | 3300049590 | Ga0501074_0006600 | Ga0501074_0006600_3880_4419 | 179 |
| 181 | 3300049741 | Ga0501079_0016754 | Ga0501079_0016754_1472_2011 | 179 |
| 182 | 3300049742 | Ga0501080_0016151 | Ga0501080_0016151_4351_4890 | 179 |
| 183 | 3300049744 | Ga0501083_0000290 | Ga0501083_0000290_30676_31215 | 179 |
| 184 | 3300053085 | Ga0495619_0944540 | Ga0495619_0944540_10_549 | 179 |
| 185 | 3300054114 | Ga0501084_0140170 | Ga0501084_0140170_1075_1614 | 179 |
| 186 | 3300060353 | Ga0501082_0987558 | Ga0501082_0987558_158_697 | 179 |
| 187 | 3300061719 | Ga0466962_0002161 | Ga0466962_0002161_5584_6123 | 179 |
| 188 | 3300006852 | Ga0075433_10047503 | Ga0075433_100475034 | 180 |
| 189 | 3300006871 | Ga0075434_101243963 | Ga0075434_1012439631 | 180 |
| 190 | 3300050512 | nmdc:mga0n895_1202876_c1 | nmdc:mga0n895_1202876_c1_178_720 | 180 |
| 191 | 3300044842 | Ga0466957_0222892 | Ga0466957_0222892_112_657 | 181 |
| 192 | 3300045976 | Ga0466967_0143789 | Ga0466967_0143789_693_1238 | 181 |
| 193 | 3300060353 | Ga0501082_0778822 | Ga0501082_0778822_223_768 | 181 |
| 194 | 3300061734 | Ga0530510_0185221 | Ga0530510_0185221_675_1220 | 181 |
| 195 | 3300005434 | Ga0070709_10000237 | Ga0070709_100002376 | 182 |
| 196 | 3300025906 | Ga0207699_10000017 | Ga0207699_10000017162 | 182 |
| 197 | 3300025915 | Ga0207693_10754190 | Ga0207693_107541902 | 182 |
| 198 | 3300025916 | Ga0207663_10224910 | Ga0207663_102249102 | 182 |
| 199 | 3300025928 | Ga0207700_10382581 | Ga0207700_103825812 | 182 |
| 200 | 3300035117 | Ga0373953_0086057 | Ga0373953_0086057_622_1170 | 182 |
| 201 | 3300045976 | Ga0466967_1125492 | Ga0466967_1125492_108_656 | 182 |
| 202 | 3300046454 | Ga0495592_0165046 | Ga0495592_0165046_376_924 | 182 |
| 203 | 3300046461 | Ga0495641_0114369 | Ga0495641_0114369_411_959 | 182 |
| 204 | 3300046462 | Ga0495651_0131251 | Ga0495651_0131251_834_1382 | 182 |
| 205 | 3300046511 | Ga0495608_0099425 | Ga0495608_0099425_1145_1693 | 182 |
| 206 | 3300046516 | Ga0495628_0169720 | Ga0495628_0169720_624_1172 | 182 |
| 207 | 3300046517 | Ga0495630_0092367 | Ga0495630_0092367_588_1154 | 182 |
| 208 | 3300046517 | Ga0495630_0639542 | Ga0495630_0639542_165_713 | 182 |
| 209 | 3300046529 | Ga0495652_0724529 | Ga0495652_0724529_84_632 | 182 |
| 210 | 3300046535 | Ga0495586_0002714 | Ga0495586_0002714_6143_6709 | 182 |
| 211 | 3300046536 | Ga0495587_0021012 | Ga0495587_0021012_3283_3831 | 182 |
| 212 | 3300046543 | Ga0495645_0059021 | Ga0495645_0059021_1565_2113 | 182 |
| 213 | 3300046675 | Ga0495657_0092967 | Ga0495657_0092967_62_610 | 182 |
| 214 | 3300046678 | Ga0495599_0094469 | Ga0495599_0094469_1122_1670 | 182 |
| 215 | 3300046678 | Ga0495599_0179596 | Ga0495599_0179596_79_627 | 182 |
| 216 | 3300046680 | Ga0495646_0037898 | Ga0495646_0037898_208_756 | 182 |
| 217 | 3300047319 | Ga0495674_0102352 | Ga0495674_0102352_392_958 | 182 |
| 218 | 3300047444 | Ga0495675_0139443 | Ga0495675_0139443_807_1355 | 182 |
| 219 | 3300048917 | Ga0496114_0247390 | Ga0496114_0247390_726_1274 | 182 |
| 220 | 3300050507 | nmdc:mga05p37_464377_c1 | nmdc:mga05p37_464377_c1_31_588 | 182 |
| 221 | 3300053077 | Ga0495601_0309982 | Ga0495601_0309982_233_781 | 182 |
| 222 | 3300053084 | Ga0495595_0005829 | Ga0495595_0005829_4016_4564 | 182 |
| 223 | 3300053085 | Ga0495619_0438655 | Ga0495619_0438655_62_610 | 182 |
| 224 | 3300005293 | Ga0065715_10028950 | Ga0065715_100289502 | 183 |
| 225 | 3300005338 | Ga0068868_100444075 | Ga0068868_1004440752 | 183 |
| 226 | 3300005406 | Ga0070703_10000078 | Ga0070703_1000007812 | 183 |
| 227 | 3300005440 | Ga0070705_100000397 | Ga0070705_1000003971 | 183 |
| 228 | 3300005440 | Ga0070705_100618144 | Ga0070705_1006181441 | 183 |
| 229 | 3300005441 | Ga0070700_100260312 | Ga0070700_1002603121 | 183 |
| 230 | 3300005467 | Ga0070706_100000320 | Ga0070706_10000032011 | 183 |
| 231 | 3300005536 | Ga0070697_100583382 | Ga0070697_1005833821 | 183 |
| 232 | 3300005545 | Ga0070695_100686475 | Ga0070695_1006864751 | 183 |
| 233 | 3300006852 | Ga0075433_10391826 | Ga0075433_103918262 | 183 |
| 234 | 3300006871 | Ga0075434_100083879 | Ga0075434_1000838794 | 183 |
| 235 | 3300006914 | Ga0075436_100112529 | Ga0075436_1001125292 | 183 |
| 236 | 3300007076 | Ga0075435_100044799 | Ga0075435_1000447992 | 183 |
| 237 | 3300007076 | Ga0075435_100136550 | Ga0075435_1001365502 | 183 |
| 238 | 3300025885 | Ga0207653_10000021 | Ga0207653_1000002187 | 183 |
| 239 | 3300025910 | Ga0207684_10000394 | Ga0207684_1000039411 | 183 |
| 240 | 3300047322 | Ga0495680_0665067 | Ga0495680_0665067_27_584 | 183 |
| 241 | 3300050512 | nmdc:mga0n895_27769_c1 | nmdc:mga0n895_27769_c1_79_633 | 183 |
| 242 | 3300050514 | nmdc:mga08x19_130948_c1 | nmdc:mga08x19_130948_c1_411_965 | 183 |
| 243 | 3300005337 | Ga0070682_100565630 | Ga0070682_1005656301 | 184 |
| 244 | 3300005468 | Ga0070707_100636489 | Ga0070707_1006364892 | 184 |
| 245 | 3300005439 | Ga0070711_100000027 | Ga0070711_10000002715 | 185 |
| 246 | 3300026116 | Ga0207674_10186955 | Ga0207674_101869551 | 185 |
| 247 | 3300050514 | nmdc:mga08x19_45_c1 | nmdc:mga08x19_45_c1_144185_144751 | 185 |
| 248 | 3300050514 | nmdc:mga08x19_611287_c1 | nmdc:mga08x19_611287_c1_110_676 | 185 |
| 249 | 3300005535 | Ga0070684_100136286 | Ga0070684_1001362862 | 186 |
| 250 | 3300010375 | Ga0105239_10306283 | Ga0105239_103062832 | 186 |
| 251 | 3300025937 | Ga0207669_10101462 | Ga0207669_101014622 | 186 |
| 252 | 3300025944 | Ga0207661_10063829 | Ga0207661_100638292 | 186 |
| 253 | 3300060353 | Ga0501082_0906746 | Ga0501082_0906746_104_718 | 186 |
| 254 | 3300025927 | Ga0207687_10276097 | Ga0207687_102760972 | 187 |
| 255 | 3300005353 | Ga0070669_100040918 | Ga0070669_1000409183 | 188 |
| 256 | 3300005456 | Ga0070678_100630552 | Ga0070678_1006305521 | 188 |
| 257 | 3300025903 | Ga0207680_10042140 | Ga0207680_100421402 | 188 |
| 258 | 3300025923 | Ga0207681_10069176 | Ga0207681_100691763 | 188 |
| 259 | 3300025926 | Ga0207659_10088672 | Ga0207659_100886722 | 188 |
| 260 | 3300026089 | Ga0207648_10182773 | Ga0207648_101827732 | 188 |
| 261 | 3300026121 | Ga0207683_10032747 | Ga0207683_100327473 | 188 |
| 262 | 3300005290 | Ga0065712_10076849 | Ga0065712_100768492 | 189 |
| 263 | 3300005293 | Ga0065715_10129845 | Ga0065715_101298453 | 189 |
| 264 | 3300009094 | Ga0111539_10056813 | Ga0111539_100568134 | 189 |
| 265 | 3300009553 | Ga0105249_10670348 | Ga0105249_106703482 | 189 |
| 266 | 3300013306 | Ga0163162_10003181 | Ga0163162_1000318118 | 189 |
| 267 | 3300025927 | Ga0207687_10000098 | Ga0207687_1000009824 | 189 |
| 268 | 3300025961 | Ga0207712_10539325 | Ga0207712_105393252 | 189 |
| 269 | 3300005840 | Ga0068870_10116245 | Ga0068870_101162452 | 190 |
| 270 | 3300025908 | Ga0207643_10118423 | Ga0207643_101184232 | 190 |
| 271 | 3300041505 | Ga0451849_0381006 | Ga0451849_0381006_2362_2949 | 190 |
| 272 | 3300041511 | Ga0451855_1116450 | Ga0451855_1116450_322_909 | 190 |
| 273 | 3300041512 | Ga0451853_0373412 | Ga0451853_0373412_20695_21282 | 190 |
| 274 | 3300006028 | Ga0070717_10096757 | Ga0070717_100967572 | 191 |
| 275 | 3300006195 | Ga0075366_10176568 | Ga0075366_101765682 | 191 |
| 276 | 3300049568 | Ga0501031_0173524 | Ga0501031_0173524_735_1355 | 191 |
| 277 | 3300049583 | Ga0501067_0016421 | Ga0501067_0016421_2429_3025 | 191 |
| 278 | 3300050493 | nmdc:mga0k408_217103_c1 | nmdc:mga0k408_217103_c1_239_835 | 191 |
| 279 | 3300046615 | Ga0495656_0059087 | Ga0495656_0059087_257_841 | 192 |
| 280 | 3300003323 | rootH1_10082928 | rootH1_100829286 | 195 |
| 281 | 3300009147 | Ga0114129_10091695 | Ga0114129_100916955 | 195 |
| 282 | 3300009177 | Ga0105248_10300698 | Ga0105248_103006982 | 195 |
| 283 | 3300025925 | Ga0207650_10477483 | Ga0207650_104774832 | 195 |
| 284 | 3300026078 | Ga0207702_11023333 | Ga0207702_110233332 | 195 |
| 285 | 3300050515 | nmdc:mga0a205_429929_c1 | nmdc:mga0a205_429929_c1_44_649 | 195 |
| 286 | 3300005295 | Ga0065707_10022485 | Ga0065707_100224852 | 196 |
| 287 | 3300005336 | Ga0070680_100212323 | Ga0070680_1002123232 | 196 |
| 288 | 3300005343 | Ga0070687_100113439 | Ga0070687_1001134392 | 196 |
| 289 | 3300005353 | Ga0070669_100780965 | Ga0070669_1007809651 | 196 |
| 290 | 3300005441 | Ga0070700_100000170 | Ga0070700_10000017034 | 196 |
| 291 | 3300005445 | Ga0070708_100235611 | Ga0070708_1002356112 | 196 |
| 292 | 3300005468 | Ga0070707_100105397 | Ga0070707_1001053972 | 196 |
| 293 | 3300005518 | Ga0070699_100000194 | Ga0070699_10000019455 | 196 |
| 294 | 3300005545 | Ga0070695_100103810 | Ga0070695_1001038102 | 196 |
| 295 | 3300005546 | Ga0070696_100000242 | Ga0070696_1000002427 | 196 |
| 296 | 3300005546 | Ga0070696_100012684 | Ga0070696_1000126842 | 196 |
| 297 | 3300005547 | Ga0070693_100006521 | Ga0070693_1000065212 | 196 |
| 298 | 3300005616 | Ga0068852_101349730 | Ga0068852_1013497302 | 196 |
| 299 | 3300006358 | Ga0068871_100829308 | Ga0068871_1008293082 | 196 |
| 300 | 3300006844 | Ga0075428_101223627 | Ga0075428_1012236272 | 196 |
| 301 | 3300006852 | Ga0075433_10749004 | Ga0075433_107490041 | 196 |
| 302 | 3300009093 | Ga0105240_10043979 | Ga0105240_100439792 | 196 |
| 303 | 3300009094 | Ga0111539_10104832 | Ga0111539_101048323 | 196 |
| 304 | 3300009176 | Ga0105242_10003683 | Ga0105242_1000368313 | 196 |
| 305 | 3300011119 | Ga0105246_10187530 | Ga0105246_101875302 | 196 |
| 306 | 3300013105 | Ga0157369_10000065 | Ga0157369_1000006561 | 196 |
| 307 | 3300013297 | Ga0157378_10433698 | Ga0157378_104336982 | 196 |
| 308 | 3300014325 | Ga0163163_11142696 | Ga0163163_111426961 | 196 |
| 309 | 3300021384 | Ga0213876_10000008 | Ga0213876_10000008391 | 196 |
| 310 | 3300025913 | Ga0207695_10072469 | Ga0207695_100724692 | 196 |
| 311 | 3300025918 | Ga0207662_10027645 | Ga0207662_100276454 | 196 |
| 312 | 3300025922 | Ga0207646_10087953 | Ga0207646_100879532 | 196 |
| 313 | 3300025934 | Ga0207686_10002498 | Ga0207686_1000249813 | 196 |
| 314 | 3300025941 | Ga0207711_10291631 | Ga0207711_102916312 | 196 |
| 315 | 3300026041 | Ga0207639_10000073 | Ga0207639_1000007374 | 196 |
| 316 | 3300026075 | Ga0207708_10000409 | Ga0207708_100004097 | 196 |
| 317 | 3300028380 | Ga0268265_10186082 | Ga0268265_101860822 | 196 |
| 318 | 3300031616 | Ga0307508_10089850 | Ga0307508_100898502 | 196 |
| 319 | 3300039437 | Ga0436365_0670421 | Ga0436365_0670421_7403_8002 | 196 |
| 320 | 3300042876 | Ga0451577_0002705 | Ga0451577_0002705_8360_8959 | 196 |
| 321 | 3300044712 | Ga0453684_0005932 | Ga0453684_0005932_12118_12717 | 196 |
| 322 | 3300045051 | Ga0451576_0108594 | Ga0451576_0108594_1495_2094 | 196 |
| 323 | 3300049569 | Ga0501032_0347682 | Ga0501032_0347682_128_736 | 196 |
| 324 | 3300050511 | nmdc:mga08y16_66625_c1 | nmdc:mga08y16_66625_c1_2267_2875 | 196 |
| 325 | 3300050513 | nmdc:mga0rr50_52486_c1 | nmdc:mga0rr50_52486_c1_1462_2067 | 196 |
| 326 | 3300050515 | nmdc:mga0a205_65482_c1 | nmdc:mga0a205_65482_c1_2356_2964 | 196 |
| 327 | 3300050515 | nmdc:mga0a205_666735_c1 | nmdc:mga0a205_666735_c1_173_781 | 196 |
| 328 | 3300053083 | Ga0495655_0003734 | Ga0495655_0003734_321_920 | 196 |
| 329 | 3300005337 | Ga0070682_100016951 | Ga0070682_1000169512 | 197 |
| 330 | 3300025934 | Ga0207686_10461936 | Ga0207686_104619361 | 197 |
| 331 | 3300026142 | Ga0207698_10720137 | Ga0207698_107201372 | 197 |
| 332 | 3300042131 | Ga0450894_032633 | Ga0450894_032633_26_625 | 197 |
| 333 | 3300042133 | Ga0450896_000960 | Ga0450896_000960_1348_1947 | 197 |
| 334 | 3300042134 | Ga0450898_010329 | Ga0450898_010329_96_695 | 197 |
| 335 | 3300048915 | Ga0496112_0729441 | Ga0496112_0729441_155_748 | 197 |
| 336 | 3300005340 | Ga0070689_100070205 | Ga0070689_1000702053 | 198 |
| 337 | 3300005354 | Ga0070675_100634958 | Ga0070675_1006349581 | 198 |
| 338 | 3300005365 | Ga0070688_100188395 | Ga0070688_1001883952 | 198 |
| 339 | 3300005444 | Ga0070694_100135355 | Ga0070694_1001353551 | 198 |
| 340 | 3300005544 | Ga0070686_100078311 | Ga0070686_1000783112 | 198 |
| 341 | 3300006871 | Ga0075434_100246401 | Ga0075434_1002464012 | 198 |
| 342 | 3300009094 | Ga0111539_10064851 | Ga0111539_100648512 | 198 |
| 343 | 3300025916 | Ga0207663_10000006 | Ga0207663_1000000697 | 198 |
| 344 | 3300025936 | Ga0207670_10058121 | Ga0207670_100581212 | 198 |
| 345 | 3300026075 | Ga0207708_10129503 | Ga0207708_101295032 | 198 |
| 346 | 3300028380 | Ga0268265_10735809 | Ga0268265_107358091 | 198 |
| 347 | 3300046454 | Ga0495592_0068694 | Ga0495592_0068694_1292_1897 | 198 |
| 348 | 3300046462 | Ga0495651_0124079 | Ga0495651_0124079_328_933 | 198 |
| 349 | 3300046516 | Ga0495628_0105411 | Ga0495628_0105411_875_1480 | 198 |
| 350 | 3300046678 | Ga0495599_0059582 | Ga0495599_0059582_1561_2166 | 198 |
| 351 | 3300050512 | nmdc:mga0n895_405690_c1 | nmdc:mga0n895_405690_c1_705_1328 | 198 |
| 352 | 3300005340 | Ga0070689_100005731 | Ga0070689_1000057313 | 199 |
| 353 | 3300005445 | Ga0070708_100515168 | Ga0070708_1005151682 | 199 |
| 354 | 3300006173 | Ga0070716_100030951 | Ga0070716_1000309512 | 199 |
| 355 | 3300006175 | Ga0070712_100046551 | Ga0070712_1000465513 | 199 |
| 356 | 3300009094 | Ga0111539_10617462 | Ga0111539_106174622 | 199 |
| 357 | 3300025915 | Ga0207693_10058864 | Ga0207693_100588642 | 199 |
| 358 | 3300025936 | Ga0207670_10000962 | Ga0207670_100009623 | 199 |
| 359 | 3300025939 | Ga0207665_10021990 | Ga0207665_100219902 | 199 |
| 360 | 3300042005 | Ga0439448_0024922 | Ga0439448_0024922_76_780 | 199 |
| 361 | 3300049741 | Ga0501079_0646497 | Ga0501079_0646497_132_758 | 199 |
| 362 | 3300050511 | nmdc:mga08y16_580460_c1 | nmdc:mga08y16_580460_c1_393_1061 | 199 |
| 363 | 3300005471 | Ga0070698_100094636 | Ga0070698_1000946363 | 200 |
| 364 | 3300005549 | Ga0070704_100020419 | Ga0070704_1000204193 | 200 |
| 365 | 3300009094 | Ga0111539_10005968 | Ga0111539_100059689 | 200 |
| 366 | 3300010375 | Ga0105239_10515325 | Ga0105239_105153252 | 200 |
| 367 | 3300027907 | Ga0207428_10081608 | Ga0207428_100816082 | 200 |
| 368 | 3300049569 | Ga0501032_0004392 | Ga0501032_0004392_2856_3500 | 200 |
| 369 | 3300049569 | Ga0501032_0005707 | Ga0501032_0005707_8397_9044 | 200 |
| 370 | 3300049570 | Ga0501033_0298221 | Ga0501033_0298221_337_984 | 200 |
| 371 | 3300049571 | Ga0501034_0005150 | Ga0501034_0005150_3033_3677 | 200 |
| 372 | 3300049571 | Ga0501034_0075276 | Ga0501034_0075276_1902_2549 | 200 |
| 373 | 3300049571 | Ga0501034_0127603 | Ga0501034_0127603_527_1147 | 200 |
| 374 | 3300049571 | Ga0501034_0142623 | Ga0501034_0142623_1725_2345 | 200 |
| 375 | 3300049572 | Ga0501036_0018437 | Ga0501036_0018437_1975_2619 | 200 |
| 376 | 3300049572 | Ga0501036_0215370 | Ga0501036_0215370_364_984 | 200 |
| 377 | 3300049573 | Ga0501037_0025268 | Ga0501037_0025268_631_1275 | 200 |
| 378 | 3300049573 | Ga0501037_0182143 | Ga0501037_0182143_737_1384 | 200 |
| 379 | 3300049573 | Ga0501037_0229273 | Ga0501037_0229273_596_1216 | 200 |
| 380 | 3300049574 | Ga0501038_0022442 | Ga0501038_0022442_1855_2499 | 200 |
| 381 | 3300049574 | Ga0501038_0036573 | Ga0501038_0036573_1562_2209 | 200 |
| 382 | 3300049575 | Ga0501039_0031628 | Ga0501039_0031628_1581_2225 | 200 |
| 383 | 3300049575 | Ga0501039_0083973 | Ga0501039_0083973_1645_2292 | 200 |
| 384 | 3300049575 | Ga0501039_0285991 | Ga0501039_0285991_560_1180 | 200 |
| 385 | 3300049578 | Ga0501042_0169833 | Ga0501042_0169833_705_1325 | 200 |
| 386 | 3300049579 | Ga0501043_0012710 | Ga0501043_0012710_1994_2614 | 200 |
| 387 | 3300049579 | Ga0501043_0038391 | Ga0501043_0038391_1622_2266 | 200 |
| 388 | 3300049579 | Ga0501043_0039540 | Ga0501043_0039540_1416_2063 | 200 |
| 389 | 3300049579 | Ga0501043_0609603 | Ga0501043_0609603_80_700 | 200 |
| 390 | 3300049580 | Ga0501046_0005157 | Ga0501046_0005157_2339_2983 | 200 |
| 391 | 3300049580 | Ga0501046_0047415 | Ga0501046_0047415_1655_2302 | 200 |
| 392 | 3300049580 | Ga0501046_0383931 | Ga0501046_0383931_237_857 | 200 |
| 393 | 3300049580 | Ga0501046_0436598 | Ga0501046_0436598_155_775 | 200 |
| 394 | 3300049581 | Ga0501047_0004351 | Ga0501047_0004351_2098_2742 | 200 |
| 395 | 3300049581 | Ga0501047_0043189 | Ga0501047_0043189_874_1521 | 200 |
| 396 | 3300049581 | Ga0501047_0075319 | Ga0501047_0075319_2084_2704 | 200 |
| 397 | 3300049581 | Ga0501047_0149332 | Ga0501047_0149332_1487_2107 | 200 |
| 398 | 3300049581 | Ga0501047_0255833 | Ga0501047_0255833_636_1256 | 200 |
| 399 | 3300049582 | Ga0501048_0007911 | Ga0501048_0007911_797_1441 | 200 |
| 400 | 3300049582 | Ga0501048_0083249 | Ga0501048_0083249_141_788 | 200 |
| 401 | 3300049582 | Ga0501048_0280253 | Ga0501048_0280253_106_726 | 200 |
| 402 | 3300049583 | Ga0501067_0010991 | Ga0501067_0010991_4083_4730 | 200 |
| 403 | 3300049583 | Ga0501067_0298128 | Ga0501067_0298128_245_865 | 200 |
| 404 | 3300049584 | Ga0501068_0005157 | Ga0501068_0005157_5098_5742 | 200 |
| 405 | 3300049584 | Ga0501068_0420208 | Ga0501068_0420208_67_687 | 200 |
| 406 | 3300049585 | Ga0501069_0011667 | Ga0501069_0011667_1873_2517 | 200 |
| 407 | 3300049586 | Ga0501070_0095878 | Ga0501070_0095878_157_777 | 200 |
| 408 | 3300049586 | Ga0501070_0280605 | Ga0501070_0280605_419_1039 | 200 |
| 409 | 3300049586 | Ga0501070_0682880 | Ga0501070_0682880_94_741 | 200 |
| 410 | 3300049588 | Ga0501072_0025885 | Ga0501072_0025885_3302_3922 | 200 |
| 411 | 3300049588 | Ga0501072_0359158 | Ga0501072_0359158_397_1041 | 200 |
| 412 | 3300049589 | Ga0501073_0002377 | Ga0501073_0002377_1995_2639 | 200 |
| 413 | 3300049589 | Ga0501073_0025811 | Ga0501073_0025811_230_850 | 200 |
| 414 | 3300049589 | Ga0501073_0067440 | Ga0501073_0067440_1522_2169 | 200 |
| 415 | 3300049589 | Ga0501073_0070929 | Ga0501073_0070929_1672_2292 | 200 |
| 416 | 3300049589 | Ga0501073_0281465 | Ga0501073_0281465_463_1083 | 200 |
| 417 | 3300049590 | Ga0501074_0081185 | Ga0501074_0081185_243_863 | 200 |
| 418 | 3300049593 | Ga0501077_0064679 | Ga0501077_0064679_766_1410 | 200 |
| 419 | 3300049593 | Ga0501077_0153051 | Ga0501077_0153051_680_1300 | 200 |
| 420 | 3300049742 | Ga0501080_0005425 | Ga0501080_0005425_8714_9358 | 200 |
| 421 | 3300049742 | Ga0501080_0045419 | Ga0501080_0045419_1913_2560 | 200 |
| 422 | 3300049742 | Ga0501080_0141922 | Ga0501080_0141922_363_983 | 200 |
| 423 | 3300049742 | Ga0501080_0571774 | Ga0501080_0571774_196_816 | 200 |
| 424 | 3300049744 | Ga0501083_0015872 | Ga0501083_0015872_3264_3884 | 200 |
| 425 | 3300049744 | Ga0501083_0030226 | Ga0501083_0030226_1220_1840 | 200 |
| 426 | 3300049744 | Ga0501083_0057701 | Ga0501083_0057701_1085_1732 | 200 |
| 427 | 3300049822 | Ga0501035_0047150 | Ga0501035_0047150_1396_2040 | 200 |
| 428 | 3300049822 | Ga0501035_0077967 | Ga0501035_0077967_1757_2404 | 200 |
| 429 | 3300049823 | Ga0501044_0006011 | Ga0501044_0006011_10667_11311 | 200 |
| 430 | 3300049823 | Ga0501044_0088969 | Ga0501044_0088969_1735_2382 | 200 |
| 431 | 3300049823 | Ga0501044_0632526 | Ga0501044_0632526_107_727 | 200 |
| 432 | 3300050511 | nmdc:mga08y16_8864_c1 | nmdc:mga08y16_8864_c1_1855_2493 | 200 |
| 433 | 3300054114 | Ga0501084_0061291 | Ga0501084_0061291_1260_1880 | 200 |
| 434 | 3300054114 | Ga0501084_0061842 | Ga0501084_0061842_619_1263 | 200 |
| 435 | 3300054114 | Ga0501084_0089388 | Ga0501084_0089388_341_961 | 200 |
| 436 | 3300060353 | Ga0501082_0003404 | Ga0501082_0003404_12407_13054 | 200 |
| 437 | 3300060353 | Ga0501082_0021843 | Ga0501082_0021843_1582_2226 | 200 |
| 438 | 3300060353 | Ga0501082_0163030 | Ga0501082_0163030_1069_1689 | 200 |
| 439 | 3300060353 | Ga0501082_0530305 | Ga0501082_0530305_330_950 | 200 |
| 440 | 3300005290 | Ga0065712_10079731 | Ga0065712_100797312 | 201 |
| 441 | 3300005617 | Ga0068859_100745773 | Ga0068859_1007457732 | 201 |
| 442 | 3300006931 | Ga0097620_100745703 | Ga0097620_1007457032 | 201 |
| 443 | 3300028563 | Ga0265319_1000068 | Ga0265319_100006826 | 201 |
| 444 | 3300028577 | Ga0265318_10000040 | Ga0265318_100000409 | 201 |
| 445 | 3300031235 | Ga0265330_10000065 | Ga0265330_1000006548 | 201 |
| 446 | 3300031238 | Ga0265332_10001115 | Ga0265332_1000111510 | 201 |
| 447 | 3300031240 | Ga0265320_10000050 | Ga0265320_1000005045 | 201 |
| 448 | 3300031242 | Ga0265329_10000210 | Ga0265329_1000021015 | 201 |
| 449 | 3300031247 | Ga0265340_10003735 | Ga0265340_100037356 | 201 |
| 450 | 3300031249 | Ga0265339_10172574 | Ga0265339_101725742 | 201 |
| 451 | 3300031250 | Ga0265331_10000265 | Ga0265331_1000026522 | 201 |
| 452 | 3300031344 | Ga0265316_10000389 | Ga0265316_1000038915 | 201 |
| 453 | 3300031456 | Ga0307513_10113520 | Ga0307513_101135202 | 201 |
| 454 | 3300031595 | Ga0265313_10000040 | Ga0265313_1000004053 | 201 |
| 455 | 3300031711 | Ga0265314_10000117 | Ga0265314_1000011730 | 201 |
| 456 | 3300031712 | Ga0265342_10000037 | Ga0265342_1000003783 | 201 |
| 457 | 3300049587 | Ga0501071_0227525 | Ga0501071_0227525_330_968 | 201 |
| 458 | 3300049589 | Ga0501073_0290535 | Ga0501073_0290535_433_1071 | 201 |
| 459 | 3300026088 | Ga0207641_10302967 | Ga0207641_103029673 | 202 |
| 460 | 3300032002 | Ga0307416_100144226 | Ga0307416_1001442262 | 202 |
| 461 | 3300048912 | Ga0496109_0039094 | Ga0496109_0039094_444_1109 | 202 |
| 462 | 3300048913 | Ga0496110_0378370 | Ga0496110_0378370_343_1008 | 202 |
| 463 | 3300048915 | Ga0496112_0026840 | Ga0496112_0026840_4217_4882 | 202 |
| 464 | 3300048916 | Ga0496113_0101885 | Ga0496113_0101885_1167_1832 | 202 |
| 465 | 3300049588 | Ga0501072_0191085 | Ga0501072_0191085_202_834 | 202 |
| 466 | 3300005438 | Ga0070701_10056091 | Ga0070701_100560912 | 203 |
| 467 | 3300005440 | Ga0070705_100242180 | Ga0070705_1002421802 | 203 |
| 468 | 3300005455 | Ga0070663_100757966 | Ga0070663_1007579661 | 203 |
| 469 | 3300007076 | Ga0075435_100703797 | Ga0075435_1007037972 | 203 |
| 470 | 3300021384 | Ga0213876_10002664 | Ga0213876_100026644 | 203 |
| 471 | 3300027907 | Ga0207428_10000998 | Ga0207428_100009983 | 203 |
| 472 | 3300039437 | Ga0436365_1511658 | Ga0436365_1511658_165_806 | 203 |
| 473 | 3300049744 | Ga0501083_0206257 | Ga0501083_0206257_83_745 | 203 |
| 474 | 3300050512 | nmdc:mga0n895_502071_c1 | nmdc:mga0n895_502071_c1_22_642 | 203 |
| 475 | 3300060353 | Ga0501082_0325654 | Ga0501082_0325654_270_932 | 203 |
| 476 | 3300005353 | Ga0070669_100679240 | Ga0070669_1006792402 | 204 |
| 477 | 3300005468 | Ga0070707_100602523 | Ga0070707_1006025232 | 204 |
| 478 | 3300005548 | Ga0070665_100387467 | Ga0070665_1003874672 | 204 |
| 479 | 3300005617 | Ga0068859_100031477 | Ga0068859_1000314773 | 204 |
| 480 | 3300005618 | Ga0068864_100453078 | Ga0068864_1004530782 | 204 |
| 481 | 3300006931 | Ga0097620_100031476 | Ga0097620_1000314764 | 204 |
| 482 | 3300025903 | Ga0207680_10360755 | Ga0207680_103607552 | 204 |
| 483 | 3300025923 | Ga0207681_11006153 | Ga0207681_110061531 | 204 |
| 484 | 3300060353 | Ga0501082_0364205 | Ga0501082_0364205_348_1058 | 204 |
| 485 | 3300050511 | nmdc:mga08y16_1686_c1 | nmdc:mga08y16_1686_c1_1885_2538 | 205 |
| 486 | 3300003203 | JGI25406J46586_10067477 | JGI25406J46586_100674772 | 206 |
| 487 | 3300005334 | Ga0068869_100020145 | Ga0068869_1000201452 | 206 |
| 488 | 3300005341 | Ga0070691_10078768 | Ga0070691_100787681 | 206 |
| 489 | 3300005353 | Ga0070669_100131827 | Ga0070669_1001318273 | 206 |
| 490 | 3300005355 | Ga0070671_100599960 | Ga0070671_1005999601 | 206 |
| 491 | 3300005364 | Ga0070673_100005605 | Ga0070673_1000056053 | 206 |
| 492 | 3300005366 | Ga0070659_100338714 | Ga0070659_1003387142 | 206 |
| 493 | 3300005367 | Ga0070667_100061597 | Ga0070667_1000615972 | 206 |
| 494 | 3300005406 | Ga0070703_10042759 | Ga0070703_100427592 | 206 |
| 495 | 3300005441 | Ga0070700_100048296 | Ga0070700_1000482963 | 206 |
| 496 | 3300005455 | Ga0070663_100152497 | Ga0070663_1001524972 | 206 |
| 497 | 3300005456 | Ga0070678_100137571 | Ga0070678_1001375711 | 206 |
| 498 | 3300005459 | Ga0068867_100030558 | Ga0068867_1000305582 | 206 |
| 499 | 3300005545 | Ga0070695_100432455 | Ga0070695_1004324552 | 206 |
| 500 | 3300005546 | Ga0070696_100125214 | Ga0070696_1001252143 | 206 |
| 501 | 3300005549 | Ga0070704_100131470 | Ga0070704_1001314703 | 206 |
| 502 | 3300005615 | Ga0070702_100006054 | Ga0070702_1000060543 | 206 |
| 503 | 3300005719 | Ga0068861_100041667 | Ga0068861_1000416673 | 206 |
| 504 | 3300005843 | Ga0068860_100086874 | Ga0068860_1000868742 | 206 |
| 505 | 3300005985 | Ga0081539_10017940 | Ga0081539_100179402 | 206 |
| 506 | 3300006237 | Ga0097621_100770035 | Ga0097621_1007700352 | 206 |
| 507 | 3300007076 | Ga0075435_100007214 | Ga0075435_1000072146 | 206 |
| 508 | 3300009148 | Ga0105243_10052612 | Ga0105243_100526123 | 206 |
| 509 | 3300009176 | Ga0105242_10114118 | Ga0105242_101141183 | 206 |
| 510 | 3300009553 | Ga0105249_10744121 | Ga0105249_107441212 | 206 |
| 511 | 3300010375 | Ga0105239_10295409 | Ga0105239_102954091 | 206 |
| 512 | 3300013297 | Ga0157378_10341049 | Ga0157378_103410492 | 206 |
| 513 | 3300025315 | Ga0207697_10136436 | Ga0207697_101364362 | 206 |
| 514 | 3300025893 | Ga0207682_10026996 | Ga0207682_100269963 | 206 |
| 515 | 3300025904 | Ga0207647_10064073 | Ga0207647_100640735 | 206 |
| 516 | 3300025910 | Ga0207684_10480375 | Ga0207684_104803751 | 206 |
| 517 | 3300025918 | Ga0207662_10231109 | Ga0207662_102311092 | 206 |
| 518 | 3300025923 | Ga0207681_10080789 | Ga0207681_100807893 | 206 |
| 519 | 3300025926 | Ga0207659_10809768 | Ga0207659_108097681 | 206 |
| 520 | 3300025927 | Ga0207687_10141413 | Ga0207687_101414132 | 206 |
| 521 | 3300025931 | Ga0207644_10126609 | Ga0207644_101266092 | 206 |
| 522 | 3300025931 | Ga0207644_10139978 | Ga0207644_101399783 | 206 |
| 523 | 3300025932 | Ga0207690_10083935 | Ga0207690_100839353 | 206 |
| 524 | 3300025933 | Ga0207706_10019700 | Ga0207706_100197004 | 206 |
| 525 | 3300025934 | Ga0207686_10362535 | Ga0207686_103625352 | 206 |
| 526 | 3300025936 | Ga0207670_10049883 | Ga0207670_100498833 | 206 |
| 527 | 3300025937 | Ga0207669_10212285 | Ga0207669_102122852 | 206 |
| 528 | 3300025938 | Ga0207704_10184335 | Ga0207704_101843352 | 206 |
| 529 | 3300025940 | Ga0207691_10046985 | Ga0207691_100469854 | 206 |
| 530 | 3300025941 | Ga0207711_10076698 | Ga0207711_100766983 | 206 |
| 531 | 3300025942 | Ga0207689_10036372 | Ga0207689_100363721 | 206 |
| 532 | 3300025986 | Ga0207658_10072971 | Ga0207658_100729713 | 206 |
| 533 | 3300026023 | Ga0207677_10094236 | Ga0207677_100942363 | 206 |
| 534 | 3300026035 | Ga0207703_10995858 | Ga0207703_109958581 | 206 |
| 535 | 3300026075 | Ga0207708_10033198 | Ga0207708_100331984 | 206 |
| 536 | 3300026089 | Ga0207648_10005814 | Ga0207648_100058145 | 206 |
| 537 | 3300026118 | Ga0207675_100041575 | Ga0207675_1000415754 | 206 |
| 538 | 3300028381 | Ga0268264_10147354 | Ga0268264_101473543 | 206 |
| 539 | 3300048910 | Ga0496107_0069661 | Ga0496107_0069661_411_1037 | 206 |
| 540 | 3300050513 | nmdc:mga0rr50_42576_c1 | nmdc:mga0rr50_42576_c1_2330_2956 | 206 |
| 541 | 3300053153 | Ga0500616_0000595 | Ga0500616_0000595_13808_14431 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3auf-assembly1.cif.gz_A-2 | crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii | 0.9863 | 4 | 200 |
| 2ywr-assembly1.cif.gz_A | crystal structure of gar transformylase from aquifex aeolicus | 0.9803 | 4 | 200 |
| 3p9x-assembly1.cif.gz_B | crystal structure of phosphoribosylglycinamide formyltransferase from bacillus halodurans | 0.9735 | 4 | 187 |
| 3av3-assembly1.cif.gz_A | crystal structure of glycinamide ribonucleotide transformylase 1 from geobacillus kaustophilus | 0.9676 | 1 | 187 |
| 4s1n-assembly1.cif.gz_A | the crystal structure of phosphoribosylglycinamide formyltransferase from streptococcus pneumoniae tigr4 | 0.9666 | 3 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3aufA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9863 | 4 | 200 | 3.40.50.170 |
| 2ywrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9799 | 4 | 200 | 3.40.50.170 |
| af_Q2FZI7_1_188_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9718 | 4 | 187 | 3.40.50.170 |
| 3av3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9718 | 3 | 186 | 3.40.50.170 |
| 4s1nA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9662 | 4 | 187 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6BKH7-F1-model_v4 | phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) | 0.9977 | 84 | 188 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A350CZ61-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) | 0.9928 | 4 | 177 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A2V6XK53-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) | 0.991 | 4 | 159 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A2V8B6E4-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9895 | 1 | 204 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A7V9CNL6-F1-model_v4 | phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) | 0.9886 | 2 | 92 |
GO:0004644
GO:0005737 GO:0006189 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar