F461356

General Info

Members Datasets Scaffolds Average Seq Length
541 302 1082 199

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10129628|Ga0114129_101296283
Length 218
Sequence LGDIQKAQRFLDFVLGFARNDRKANMKLVIAATGASGAIYLQRLLEQIDCAEHEVHLVMSGYARAVAKQELDDFKIPAEVSHHSESDMNVPFVSGSARFDAMVIVPCSMATLGRIASGSSDSVLLRAADVFLKERRKLVLVPRETPWNLIHARNVVTLLEAGAIVLPAIPSFYSRPGSLTAVVDTVVWRILDQIGLPSQGAYRWAEKKRSAKTSRKRS

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
159 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
179 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
205 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
275 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
276 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
277 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
278 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
279 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
280 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
281 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
282 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
283 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
284 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
285 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
286 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
297 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
298 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
299 2547132512 Azospira oryzae 6a3 Isolate Unclassified
300 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
301 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
302 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 5.36
Rhizosphere 92.98
Stem 0
Stem Tuber 0
Unclassified 19.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10129628 3300009147 Bacteria 3466
2 SwRhRL2b_contig_395561 2162886007 Bacteria 3968
3 LJQas_1000212 3300000549 Bacteria 10613
4 JGI24737J22298_10015090 3300001990 Bacteria 2501
5 JGI24035J26624_1000443 3300002126 Bacteria 3921
6 JGI25406J46586_10000002 3300003203 Bacteria 202415
7 Ga0065704_10023691 3300005289 Unclassified 973
8 Ga0065712_10000909 3300005290 Bacteria 8329
9 Ga0065712_10020774 3300005290 Bacteria 2015
10 Ga0065715_10001537 3300005293 Bacteria 9340
11 Ga0065715_10008741 3300005293 Bacteria 4870
12 Ga0065715_10362601 3300005293 Unclassified 931
13 Ga0065715_10371153 3300005293 Bacteria 921
14 Ga0065715_10574824 3300005293 Unclassified 724
15 Ga0065707_10011776 3300005295 Unclassified 1767
16 Ga0065707_10051083 3300005295 Bacteria 1080
17 Ga0070676_10029642 3300005328 Bacteria 3114
18 Ga0070676_10120984 3300005328 Bacteria 1643
19 Ga0070683_100134600 3300005329 Bacteria 2340
20 Ga0070683_100142189 3300005329 Unclassified 2273
21 Ga0070690_100080159 3300005330 Bacteria 2135
22 Ga0070670_100139354 3300005331 Bacteria 2097
23 Ga0070670_100247974 3300005331 Bacteria 1551
24 Ga0070670_100272476 3300005331 Bacteria 1477
25 Ga0070677_10046544 3300005333 Bacteria 1735
26 Ga0068869_100328508 3300005334 Bacteria 1242
27 Ga0068869_100726539 3300005334 Unclassified 849
28 Ga0070682_100226153 3300005337 Unclassified 1335
29 Ga0070682_100761675 3300005337 Bacteria 783
30 Ga0068868_100504016 3300005338 Bacteria 1061
31 Ga0068868_100515533 3300005338 Bacteria 1049
32 Ga0070660_100012754 3300005339 Bacteria 6008
33 Ga0070660_100033250 3300005339 Bacteria 3886
34 Ga0070689_100009244 3300005340 Bacteria 6980
35 Ga0070689_100016418 3300005340 Bacteria 5418
36 Ga0070689_100023483 3300005340 Bacteria 4616
37 Ga0070689_100279065 3300005340 Bacteria 1385
38 Ga0070689_100336793 3300005340 Bacteria 1263
39 Ga0070687_100032638 3300005343 Bacteria 2563
40 Ga0070687_100259689 3300005343 Bacteria 1083
41 Ga0070668_100015290 3300005347 Bacteria 5734
42 Ga0070668_100035580 3300005347 Bacteria 3798
43 Ga0070668_100166605 3300005347 Bacteria 1791
44 Ga0070675_100002235 3300005354 Bacteria 14369
45 Ga0070675_100023228 3300005354 Bacteria 4956
46 Ga0070675_100174025 3300005354 Bacteria 1858
47 Ga0070671_100063066 3300005355 Bacteria 3086
48 Ga0070671_100088709 3300005355 Bacteria 2588
49 Ga0070674_100206217 3300005356 Bacteria 1521
50 Ga0070674_100292644 3300005356 Bacteria 1295
51 Ga0070674_100859471 3300005356 Bacteria 787
52 Ga0070673_100098852 3300005364 Bacteria 2399
53 Ga0070673_100252340 3300005364 Bacteria 1538
54 Ga0070688_100000773 3300005365 Bacteria 15832
55 Ga0070688_100013682 3300005365 Bacteria 4582
56 Ga0070688_100073012 3300005365 Bacteria 2200
57 Ga0070659_100001243 3300005366 Bacteria 18491
58 Ga0070659_100593889 3300005366 Bacteria 951
59 Ga0070667_100052770 3300005367 Bacteria 3432
60 Ga0070667_100080922 3300005367 Bacteria 2779
61 Ga0070667_100193269 3300005367 Bacteria 1804
62 Ga0070667_100343323 3300005367 Bacteria 1351
63 Ga0070714_100275925 3300005435 Unclassified 1560
64 Ga0070714_100357955 3300005435 Bacteria 1372
65 Ga0070713_100045462 3300005436 Unclassified 3598
66 Ga0070710_10029333 3300005437 Unclassified 2951
67 Ga0070701_10036636 3300005438 Bacteria 2472
68 Ga0070711_100006371 3300005439 Bacteria 7113
69 Ga0070711_100150260 3300005439 Bacteria 1756
70 Ga0070700_100009402 3300005441 Bacteria 5364
71 Ga0070700_100196246 3300005441 Bacteria 1415
72 Ga0070694_100373072 3300005444 Bacteria 1111
73 Ga0070708_100085458 3300005445 Bacteria 2863
74 Ga0070708_100707802 3300005445 Unclassified 948
75 Ga0070708_100806431 3300005445 Unclassified 882
76 Ga0070663_100008999 3300005455 Bacteria 6165
77 Ga0070663_100233533 3300005455 Bacteria 1449
78 Ga0070678_100206858 3300005456 Bacteria 1623
79 Ga0070678_100442989 3300005456 Bacteria 1136
80 Ga0070662_100038946 3300005457 Bacteria 3380
81 Ga0070662_100071788 3300005457 Bacteria 2554
82 Ga0070662_100250484 3300005457 Bacteria 1424
83 Ga0070662_100332347 3300005457 Bacteria 1242
84 Ga0070662_100332476 3300005457 Bacteria 1241
85 Ga0070662_100768170 3300005457 Unclassified 818
86 Ga0070681_10125118 3300005458 Bacteria 2503
87 Ga0068867_100141065 3300005459 Bacteria 1884
88 Ga0070685_10424332 3300005466 Bacteria 926
89 Ga0070698_100725922 3300005471 Bacteria 936
90 Ga0070699_100434002 3300005518 Unclassified 1190
91 Ga0070684_100000223 3300005535 Bacteria 39444
92 Ga0070684_100221876 3300005535 Bacteria 1724
93 Ga0070684_100362263 3300005535 Bacteria 1334
94 Ga0070697_100005508 3300005536 Bacteria 9759
95 Ga0070697_100008301 3300005536 Bacteria 8104
96 Ga0070697_100039526 3300005536 Bacteria 3814
97 Ga0070697_100046931 3300005536 Bacteria 3502
98 Ga0068853_100049471 3300005539 Bacteria 3612
99 Ga0068853_100309667 3300005539 Bacteria 1462
100 Ga0070672_100151060 3300005543 Bacteria 1921
101 Ga0070672_100190966 3300005543 Bacteria 1710
102 Ga0070672_100385274 3300005543 Bacteria 1200
103 Ga0070695_100245210 3300005545 Unclassified 1301
104 Ga0070696_100585676 3300005546 Unclassified 898
105 Ga0070693_100093436 3300005547 Bacteria 1818
106 Ga0070665_100064900 3300005548 Bacteria 3663
107 Ga0070665_100304868 3300005548 Bacteria 1596
108 Ga0070704_100026647 3300005549 Bacteria 3824
109 Ga0068855_100039974 3300005563 Bacteria 5567
110 Ga0070664_100116235 3300005564 Unclassified 2339
111 Ga0070664_100146669 3300005564 Bacteria 2081
112 Ga0070664_100220993 3300005564 Bacteria 1695
113 Ga0068857_100025407 3300005577 Bacteria 5215
114 Ga0068857_100678610 3300005577 Unclassified 978
115 Ga0068856_100870751 3300005614 Unclassified 920
116 Ga0070702_100338667 3300005615 Bacteria 1055
117 Ga0068859_100021797 3300005617 Bacteria 6425
118 Ga0068864_100064628 3300005618 Bacteria 3174
119 Ga0068864_100137113 3300005618 Unclassified 2204
120 Ga0068861_100319847 3300005719 Bacteria 1351
121 Ga0068863_100006124 3300005841 Bacteria 11797
122 Ga0068863_100329370 3300005841 Bacteria 1484
123 Ga0068858_100009928 3300005842 Bacteria 9041
124 Ga0068858_100117035 3300005842 Bacteria 2491
125 Ga0068858_100347735 3300005842 Bacteria 1420
126 Ga0068860_100004153 3300005843 Bacteria 14839
127 Ga0068860_100023249 3300005843 Bacteria 5989
128 Ga0068860_100036576 3300005843 Bacteria 4703
129 Ga0068860_100117126 3300005843 Unclassified 2549
130 Ga0068862_100083417 3300005844 Bacteria 2775
131 Ga0068862_100236432 3300005844 Bacteria 1659
132 Ga0081455_10003905 3300005937 Bacteria 16973
133 Ga0081455_10051948 3300005937 Bacteria 3513
134 Ga0081455_10059596 3300005937 Bacteria 3222
135 Ga0081455_10075954 3300005937 Unclassified 2770
136 Ga0081455_10109547 3300005937 Bacteria 2197
137 Ga0081455_10478378 3300005937 Bacteria 843
138 Ga0081540_1028337 3300005983 Bacteria 3147
139 Ga0081540_1141351 3300005983 Unclassified 965
140 Ga0081539_10000061 3300005985 Bacteria 250890
141 Ga0081539_10011593 3300005985 Bacteria 6945
142 Ga0081539_10062331 3300005985 Bacteria 2038
143 Ga0070717_10022831 3300006028 Unclassified 4950
144 Ga0070717_10327187 3300006028 Bacteria 1366
145 Ga0070715_10180330 3300006163 Bacteria 1058
146 Ga0070716_100037042 3300006173 Bacteria 2693
147 Ga0070712_100006277 3300006175 Bacteria 7363
148 Ga0070712_100050175 3300006175 Unclassified 2902
149 Ga0070712_100241363 3300006175 Unclassified 1439
150 Ga0097621_100438776 3300006237 Bacteria 1175
151 Ga0097621_100919712 3300006237 Bacteria 815
152 Ga0075428_100373244 3300006844 Bacteria 1529
153 Ga0075430_100691141 3300006846 Bacteria 841
154 Ga0075434_100159916 3300006871 Bacteria 2272
155 Ga0075434_100166287 3300006871 Bacteria 2226
156 Ga0097620_100021797 3300006931 Bacteria 6425
157 Ga0099795_10015743 3300007788 Unclassified 2376
158 Ga0105240_10164820 3300009093 Bacteria 2629
159 Ga0111539_10005594 3300009094 Bacteria 16255
160 Ga0111539_10227807 3300009094 Bacteria 2171
161 Ga0105245_10863058 3300009098 Bacteria 946
162 Ga0105247_10182999 3300009101 Unclassified 1399
163 Ga0114129_10186629 3300009147 Bacteria 2818
164 Ga0114129_10857468 3300009147 Bacteria 1154
165 Ga0105243_10871413 3300009148 Bacteria 893
166 Ga0105242_10493059 3300009176 Bacteria 1164
167 Ga0105248_10144991 3300009177 Bacteria 2679
168 Ga0105248_10956815 3300009177 Bacteria 967
169 Ga0105237_10227642 3300009545 Bacteria 1865
170 Ga0105237_10250047 3300009545 Bacteria 1775
171 Ga0105237_10327980 3300009545 Bacteria 1534
172 Ga0105238_10872958 3300009551 Bacteria 917
173 Ga0105249_10002442 3300009553 Bacteria 16138
174 Ga0105249_10065551 3300009553 Unclassified 3341
175 Ga0105249_10259681 3300009553 Bacteria 1725
176 Ga0105249_11451062 3300009553 Unclassified 758
177 Ga0099796_10003217 3300010159 Bacteria 3747
178 Ga0105239_10123819 3300010375 Bacteria 2873
179 Ga0105239_10362899 3300010375 Bacteria 1636
180 Ga0105239_11336242 3300010375 Bacteria 827
181 Ga0157373_10023746 3300013100 Bacteria 4443
182 Ga0157369_10657656 3300013105 Unclassified 1080
183 Ga0157374_10048316 3300013296 Bacteria 3948
184 Ga0157374_10247855 3300013296 Bacteria 1752
185 Ga0157374_10500257 3300013296 Bacteria 1220
186 Ga0157374_11354983 3300013296 Unclassified 734
187 Ga0157378_10202438 3300013297 Bacteria 1878
188 Ga0157378_10542375 3300013297 Bacteria 1167
189 Ga0157378_10556326 3300013297 Bacteria 1153
190 Ga0163162_10029284 3300013306 Bacteria 5449
191 Ga0163162_10078127 3300013306 Unclassified 3375
192 Ga0163162_10164881 3300013306 Bacteria 2339
193 Ga0163162_11216345 3300013306 Unclassified 855
194 Ga0157372_10078710 3300013307 Bacteria 3726
195 Ga0157372_10405457 3300013307 Bacteria 1588
196 Ga0157372_11499129 3300013307 Bacteria 777
197 Ga0157375_10004619 3300013308 Bacteria 11970
198 Ga0157375_10339940 3300013308 Bacteria 1666
199 Ga0157375_10449396 3300013308 Bacteria 1454
200 Ga0157377_10021585 3300014745 Bacteria 3389
201 Ga0157377_10178383 3300014745 Bacteria 1334
202 Ga0157379_10001718 3300014968 Bacteria 18133
203 Ga0157376_10200619 3300014969 Bacteria 1835
204 Ga0157376_10618786 3300014969 Bacteria 1080
205 Ga0207666_1003218 3300025271 Bacteria 1998
206 Ga0207673_1009768 3300025290 Bacteria 1228
207 Ga0207697_10000728 3300025315 Bacteria 18701
208 Ga0207697_10041453 3300025315 Bacteria 1891
209 Ga0207697_10057617 3300025315 Bacteria 1612
210 Ga0207697_10184251 3300025315 Bacteria 916
211 Ga0207653_10009013 3300025885 Bacteria 3114
212 Ga0207682_10068506 3300025893 Bacteria 1500
213 Ga0207692_10029490 3300025898 Bacteria 2608
214 Ga0207692_10112431 3300025898 Unclassified 1512
215 Ga0207688_10158912 3300025901 Bacteria 1339
216 Ga0207688_10273024 3300025901 Bacteria 1029
217 Ga0207680_10348687 3300025903 Bacteria 1040
218 Ga0207647_10015588 3300025904 Bacteria 5205
219 Ga0207645_10106612 3300025907 Bacteria 1812
220 Ga0207707_10115975 3300025912 Bacteria 2340
221 Ga0207671_10138673 3300025914 Bacteria 1872
222 Ga0207693_10000865 3300025915 Bacteria 27049
223 Ga0207693_10006929 3300025915 Bacteria 9361
224 Ga0207693_10024641 3300025915 Bacteria 4772
225 Ga0207693_10061472 3300025915 Unclassified 2942
226 Ga0207693_10102200 3300025915 Unclassified 2248
227 Ga0207657_10038577 3300025919 Bacteria 4251
228 Ga0207657_10254131 3300025919 Bacteria 1400
229 Ga0207649_10526626 3300025920 Unclassified 902
230 Ga0207652_10927829 3300025921 Bacteria 768
231 Ga0207646_10190162 3300025922 Bacteria 1854
232 Ga0207681_10176743 3300025923 Bacteria 1623
233 Ga0207681_10323923 3300025923 Bacteria 1226
234 Ga0207650_10198004 3300025925 Bacteria 1608
235 Ga0207659_10001661 3300025926 Bacteria 13209
236 Ga0207659_10003893 3300025926 Bacteria 8999
237 Ga0207659_10122214 3300025926 Bacteria 1996
238 Ga0207659_10384249 3300025926 Unclassified 1171
239 Ga0207687_10174448 3300025927 Bacteria 1661
240 Ga0207700_10035809 3300025928 Unclassified 3578
241 Ga0207664_10084217 3300025929 Unclassified 2593
242 Ga0207644_10131713 3300025931 Bacteria 1915
243 Ga0207644_10493460 3300025931 Bacteria 1009
244 Ga0207690_10004818 3300025932 Bacteria 7960
245 Ga0207690_10318133 3300025932 Bacteria 1222
246 Ga0207690_10325450 3300025932 Bacteria 1209
247 Ga0207706_10006497 3300025933 Bacteria 10855
248 Ga0207706_10037714 3300025933 Unclassified 4290
249 Ga0207706_10043098 3300025933 Bacteria 3999
250 Ga0207706_10051671 3300025933 Unclassified 3629
251 Ga0207686_10464520 3300025934 Bacteria 976
252 Ga0207670_10008801 3300025936 Bacteria 5718
253 Ga0207670_10030992 3300025936 Unclassified 3421
254 Ga0207670_10062920 3300025936 Bacteria 2537
255 Ga0207669_10233321 3300025937 Bacteria 1359
256 Ga0207669_10286567 3300025937 Bacteria 1245
257 Ga0207665_10032279 3300025939 Unclassified 3467
258 Ga0207665_10054528 3300025939 Bacteria 2696
259 Ga0207665_10266343 3300025939 Unclassified 1271
260 Ga0207665_10338831 3300025939 Unclassified 1133
261 Ga0207691_10065221 3300025940 Bacteria 3297
262 Ga0207691_10170098 3300025940 Bacteria 1908
263 Ga0207691_10323512 3300025940 Bacteria 1322
264 Ga0207691_10476493 3300025940 Bacteria 1061
265 Ga0207689_10062782 3300025942 Bacteria 3055
266 Ga0207661_10083999 3300025944 Bacteria 2636
267 Ga0207679_10107514 3300025945 Unclassified 2195
268 Ga0207679_10575656 3300025945 Bacteria 1012
269 Ga0207651_10273215 3300025960 Bacteria 1393
270 Ga0207712_10004354 3300025961 Bacteria 8941
271 Ga0207668_10007939 3300025972 Bacteria 6313
272 Ga0207668_10017766 3300025972 Bacteria 4463
273 Ga0207668_10445239 3300025972 Bacteria 1104
274 Ga0207658_10053545 3300025986 Bacteria 2982
275 Ga0207658_10061573 3300025986 Bacteria 2805
276 Ga0207658_10181942 3300025986 Bacteria 1740
277 Ga0207677_10460474 3300026023 Bacteria 1091
278 Ga0207703_10021957 3300026035 Bacteria 4998
279 Ga0207703_10129302 3300026035 Bacteria 2179
280 Ga0207639_10985770 3300026041 Bacteria 789
281 Ga0207678_10010085 3300026067 Bacteria 8289
282 Ga0207678_10028345 3300026067 Bacteria 4889
283 Ga0207708_10009330 3300026075 Bacteria 7264
284 Ga0207641_10011630 3300026088 Bacteria 7226
285 Ga0207648_10037366 3300026089 Bacteria 4277
286 Ga0207648_10648155 3300026089 Bacteria 976
287 Ga0207676_10034259 3300026095 Bacteria 3844
288 Ga0207674_10013872 3300026116 Bacteria 8914
289 Ga0207675_100234715 3300026118 Bacteria 1771
290 Ga0207675_100816491 3300026118 Bacteria 946
291 Ga0207683_10157242 3300026121 Bacteria 2054
292 Ga0207683_10233591 3300026121 Bacteria 1677
293 Ga0207698_10881830 3300026142 Bacteria 901
294 Ga0209179_1019365 3300027512 Unclassified 1310
295 Ga0209974_10143420 3300027876 Bacteria 858
296 Ga0207428_10025209 3300027907 Bacteria 4979
297 Ga0207428_10209574 3300027907 Bacteria 1464
298 Ga0268266_10034876 3300028379 Bacteria 4280
299 Ga0268266_10044338 3300028379 Bacteria 3802
300 Ga0268265_10192380 3300028380 Bacteria 1763
301 Ga0268265_10332805 3300028380 Bacteria 1380
302 Ga0268264_10044082 3300028381 Bacteria 3699
303 Ga0268264_10825055 3300028381 Bacteria 927
304 Ga0265324_10045622 3300029957 Bacteria 1509
305 Ga0307511_10130027 3300030521 Unclassified 1520
306 Ga0265330_10048160 3300031235 Bacteria 1874
307 Ga0265332_10000069 3300031238 Bacteria 88113
308 Ga0265332_10003818 3300031238 Bacteria 7197
309 Ga0265327_10002356 3300031251 Bacteria 20137
310 Ga0265327_10053482 3300031251 Bacteria 2095
311 Ga0265316_10219961 3300031344 Bacteria 1402
312 Ga0307509_10000138 3300031507 Bacteria 108694
313 Ga0316579_10031849 3300031691 Bacteria 2416
314 Ga0316578_10189500 3300031728 Bacteria 1239
315 Ga0307405_10025983 3300031731 Bacteria 3370
316 Ga0307405_10601240 3300031731 Bacteria 897
317 Ga0307413_10000379 3300031824 Bacteria 14254
318 Ga0307413_10006127 3300031824 Bacteria 5458
319 Ga0307413_10013602 3300031824 Bacteria 4097
320 Ga0307413_10194356 3300031824 Bacteria 1459
321 Ga0307413_10309109 3300031824 Bacteria 1202
322 Ga0307413_10836479 3300031824 Bacteria 776
323 Ga0307410_10000234 3300031852 Bacteria 20907
324 Ga0307410_10033745 3300031852 Bacteria 3306
325 Ga0307410_10115271 3300031852 Bacteria 1951
326 Ga0307410_10171875 3300031852 Unclassified 1634
327 Ga0307410_10302058 3300031852 Bacteria 1263
328 Ga0307406_10022694 3300031901 Bacteria 3725
329 Ga0307406_10025816 3300031901 Unclassified 3520
330 Ga0307406_10035216 3300031901 Bacteria 3077
331 Ga0307407_10000212 3300031903 Bacteria 17550
332 Ga0307407_10000791 3300031903 Bacteria 10465
333 Ga0307407_10059883 3300031903 Bacteria 2219
334 Ga0307407_10109025 3300031903 Bacteria 1735
335 Ga0307407_10646260 3300031903 Unclassified 792
336 Ga0307412_10117106 3300031911 Bacteria 1912
337 Ga0307412_10273604 3300031911 Bacteria 1323
338 Ga0307412_10360468 3300031911 Bacteria 1170
339 Ga0307412_10450326 3300031911 Bacteria 1060
340 Ga0307412_11236932 3300031911 Bacteria 670
341 Ga0307409_100003190 3300031995 Bacteria 8818
342 Ga0307409_100299345 3300031995 Bacteria 1495
343 Ga0307409_100376806 3300031995 Unclassified 1347
344 Ga0307409_100570762 3300031995 Unclassified 1114
345 Ga0307409_101155121 3300031995 Bacteria 797
346 Ga0307416_100580969 3300032002 Bacteria 1198
347 Ga0307416_100755270 3300032002 Bacteria 1065
348 Ga0307416_100955049 3300032002 Bacteria 959
349 Ga0307416_102142176 3300032002 Unclassified 661
350 Ga0307414_10031596 3300032004 Unclassified 3476
351 Ga0307414_10041788 3300032004 Bacteria 3109
352 Ga0307414_10065700 3300032004 Bacteria 2589
353 Ga0307411_10011930 3300032005 Bacteria 4715
354 Ga0307411_10597382 3300032005 Bacteria 948
355 Ga0307415_100005446 3300032126 Bacteria 6762
356 Ga0307415_100054394 3300032126 Bacteria 2732
357 Ga0307415_100634085 3300032126 Bacteria 956
358 Ga0316583_10034483 3300032133 Unclassified 1796
359 Ga0316580_10051185 3300032139 Unclassified 1273
360 Ga0316580_10102303 3300032139 Bacteria 877
361 Ga0373959_0045987 3300034820 Bacteria 930
362 Ga0373926_0066011 3300035083 Unclassified 1325
363 Ga0373932_0186262 3300035112 Unclassified 731
364 Ga0373932_0281080 3300035112 Bacteria 616
365 Ga0373945_0006509 3300035116 Bacteria 3772
366 Ga0373954_0276720 3300035118 Bacteria 827
367 Ga0373960_0080691 3300035121 Unclassified 1024
368 Ga0373943_0017795 3300035170 Unclassified 3256
369 Ga0373943_0035986 3300035170 Unclassified 2369
370 Ga0373946_0077837 3300035171 Unclassified 1446
371 Ga0373962_0028225 3300035242 Unclassified 1522
372 Ga0316574_0227683 3300035398 Bacteria 1193
373 Ga0373924_0016912 3300035410 Bacteria 2790
374 Ga0373924_0058782 3300035410 Bacteria 1605
375 Ga0373931_0085703 3300035691 Bacteria 1747
376 Ga0373931_0183236 3300035691 Unclassified 1241
377 Ga0373931_0210246 3300035691 Bacteria 1166
378 Ga0373935_0317015 3300035692 Unclassified 1105
379 Ga0373927_0053798 3300035695 Bacteria 2604
380 Ga0373927_0384165 3300035695 Bacteria 926
381 Ga0373927_0410954 3300035695 Bacteria 893
382 Ga0373927_0465694 3300035695 Unclassified 835
383 Ga0373947_0003389 3300035725 Bacteria 9429
384 Ga0373947_0046675 3300035725 Unclassified 2594
385 Ga0373947_0065316 3300035725 Bacteria 2219
386 Ga0373937_0124475 3300036401 Bacteria 2404
387 Ga0373937_0308645 3300036401 Bacteria 1496
388 Ga0316582_0008351 3300036647 Bacteria 5560
389 Ga0373925_0010416 3300037068 Bacteria 6746
390 Ga0373925_0259207 3300037068 Unclassified 1396
391 Ga0373925_0690714 3300037068 Bacteria 841
392 Ga0395900_0459237 3300037418 Bacteria 1229
393 Ga0395898_0303583 3300037466 Bacteria 1523
394 Ga0436361_0450372 3300039447 Bacteria 5983
395 Ga0436361_0541982 3300039447 Unclassified 1329
396 Ga0436361_0760940 3300039447 Bacteria 1750
397 Ga0436361_0799803 3300039447 Unclassified 693
398 Ga0436362_0222690 3300039453 Bacteria 1512
399 Ga0439439_0054789 3300041406 Bacteria 1051
400 Ga0439455_0017257 3300042012 Bacteria 1680
401 Ga0450896_006635 3300042133 Bacteria 1588
402 Ga0450898_012743 3300042134 Bacteria 1393
403 Ga0439458_0037487 3300042157 Bacteria 1169
404 Ga0439444_0029115 3300042437 Bacteria 1027
405 Ga0439464_0025795 3300042439 Bacteria 1628
406 Ga0439460_0051943 3300042461 Unclassified 1231
407 Ga0439460_0076778 3300042461 Unclassified 1043
408 Ga0439460_0143525 3300042461 Unclassified 793
409 Ga0451577_0054199 3300042876 Bacteria 3580
410 Ga0451577_0090334 3300042876 Bacteria 2733
411 Ga0439440_0065449 3300042993 Unclassified 936
412 Ga0453684_0000189 3300044712 Bacteria 269690
413 Ga0451576_0004150 3300045051 Bacteria 19074
414 Ga0451576_0054305 3300045051 Bacteria 4195
415 Ga0451576_0192885 3300045051 Bacteria 2128
416 Ga0451576_1434396 3300045051 Bacteria 718
417 Ga0495592_0026196 3300046454 Bacteria 4423
418 Ga0495629_0014267 3300046459 Bacteria 5720
419 Ga0495653_0253709 3300046463 Bacteria 1166
420 Ga0495662_0285802 3300046476 Unclassified 812
421 Ga0495664_0612093 3300046477 Bacteria 647
422 Ga0495584_0129362 3300046491 Bacteria 1281
423 Ga0495584_0273010 3300046491 Unclassified 859
424 Ga0495585_0342218 3300046492 Unclassified 728
425 Ga0495616_0148798 3300046513 Unclassified 1061
426 Ga0495628_0042862 3300046516 Bacteria 3607
427 Ga0495630_0033732 3300046517 Unclassified 3818
428 Ga0495586_0085929 3300046535 Bacteria 1733
429 Ga0495598_0020788 3300046537 Unclassified 1737
430 Ga0495645_0151223 3300046543 Bacteria 1612
431 Ga0495622_0169570 3300046557 Unclassified 982
432 Ga0495656_0147316 3300046615 Unclassified 1134
433 Ga0495668_0282278 3300046616 Bacteria 910
434 Ga0495634_0031596 3300046642 Unclassified 3645
435 Ga0495635_0034749 3300046663 Unclassified 3497
436 Ga0495659_0002663 3300046664 Bacteria 5750
437 Ga0495599_0062614 3300046678 Bacteria 2324
438 Ga0495669_0017506 3300046684 Unclassified 3076
439 Ga0495613_0170975 3300046689 Bacteria 1542
440 Ga0495671_0029528 3300046692 Bacteria 2815
441 Ga0495589_0018364 3300046794 Bacteria 3587
442 Ga0495581_0109348 3300047315 Bacteria 1607
443 Ga0495680_0330592 3300047322 Bacteria 1065
444 Ga0495675_0538623 3300047444 Bacteria 667
445 Ga0495684_0005721 3300047471 Bacteria 9670
446 Ga0496100_0065819 3300048903 Unclassified 2403
447 Ga0496101_0339114 3300048904 Unclassified 1180
448 Ga0496102_0019408 3300048905 Bacteria 5989
449 Ga0496102_0158882 3300048905 Unclassified 2126
450 Ga0496102_0341548 3300048905 Unclassified 1410
451 Ga0496103_0254148 3300048906 Unclassified 1131
452 Ga0496104_0055777 3300048907 Bacteria 3736
453 Ga0496105_0144065 3300048908 Bacteria 1960
454 Ga0496106_0051154 3300048909 Bacteria 3115
455 Ga0496106_0203575 3300048909 Bacteria 1576
456 Ga0496106_0280093 3300048909 Bacteria 1336
457 Ga0496108_0081434 3300048911 Bacteria 2743
458 Ga0496108_0122558 3300048911 Unclassified 2230
459 Ga0496108_0160173 3300048911 Unclassified 1945
460 Ga0496108_0662073 3300048911 Bacteria 907
461 Ga0496109_0030776 3300048912 Bacteria 4810
462 Ga0496109_0149068 3300048912 Unclassified 2190
463 Ga0496109_0152690 3300048912 Unclassified 2162
464 Ga0496109_0595612 3300048912 Bacteria 1042
465 Ga0496109_0804043 3300048912 Unclassified 878
466 Ga0496110_0041039 3300048913 Bacteria 4036
467 Ga0496110_0079912 3300048913 Bacteria 2913
468 Ga0496110_0407952 3300048913 Bacteria 1239
469 Ga0496111_0363921 3300048914 Unclassified 1070
470 Ga0496112_1168448 3300048915 Unclassified 687
471 Ga0496113_0000857 3300048916 Bacteria 15922
472 Ga0496114_0058818 3300048917 Bacteria 3210
473 Ga0496114_0064543 3300048917 Bacteria 3066
474 Ga0496115_0956672 3300048918 Bacteria 657
475 Ga0501031_0021782 3300049568 Bacteria 4177
476 Ga0501032_0000146 3300049569 Bacteria 57593
477 Ga0501032_0023475 3300049569 Bacteria 4260
478 Ga0501032_0068611 3300049569 Bacteria 2366
479 Ga0501033_0000875 3300049570 Bacteria 27540
480 Ga0501033_0484443 3300049570 Bacteria 857
481 Ga0501034_0001607 3300049571 Bacteria 29355
482 Ga0501036_0002965 3300049572 Bacteria 13481
483 Ga0501036_0099681 3300049572 Bacteria 2457
484 Ga0501037_0000311 3300049573 Bacteria 41277
485 Ga0501038_0002632 3300049574 Bacteria 16784
486 Ga0501038_0014366 3300049574 Bacteria 7215
487 Ga0501038_0245072 3300049574 Bacteria 1421
488 Ga0501038_0269504 3300049574 Bacteria 1343
489 Ga0501038_0519165 3300049574 Bacteria 909
490 Ga0501039_0001397 3300049575 Bacteria 17725
491 Ga0501039_0020503 3300049575 Bacteria 5065
492 Ga0501040_0004509 3300049576 Bacteria 9035
493 Ga0501042_0000049 3300049578 Bacteria 40765
494 Ga0501043_0001168 3300049579 Bacteria 23109
495 Ga0501043_0382564 3300049579 Unclassified 1065
496 Ga0501046_0001374 3300049580 Bacteria 23430
497 Ga0501047_0007830 3300049581 Bacteria 10062
498 Ga0501048_0003975 3300049582 Bacteria 11228
499 Ga0501068_0016288 3300049584 Bacteria 4284
500 Ga0501072_0159148 3300049588 Bacteria 1801
501 Ga0501073_0117899 3300049589 Bacteria 1840
502 Ga0501202_005889 3300049652 Bacteria 2180
503 Ga0501227_099375 3300049665 Bacteria 773
504 Ga0501235_021827 3300049669 Bacteria 1424
505 Ga0501240_063247 3300049673 Bacteria 657
506 Ga0501243_057621 3300049675 Unclassified 714
507 Ga0501247_001180 3300049677 Bacteria 2435
508 Ga0501249_026146 3300049679 Bacteria 1289
509 Ga0501259_025569 3300049688 Bacteria 1082
510 Ga0501259_100913 3300049688 Bacteria 662
511 Ga0501262_005378 3300049759 Bacteria 1511
512 Ga0501267_006039 3300049764 Bacteria 1157
513 Ga0501268_000391 3300049765 Bacteria 4660
514 Ga0501270_005954 3300049767 Bacteria 1441
515 Ga0501273_001638 3300049770 Bacteria 2174
516 Ga0501035_0024151 3300049822 Bacteria 5576
517 Ga0501035_0034528 3300049822 Bacteria 4595
518 Ga0501035_0062046 3300049822 Bacteria 3326
519 Ga0501035_0326889 3300049822 Bacteria 1287
520 Ga0501044_0006116 3300049823 Bacteria 13281
521 Ga0501044_0064957 3300049823 Bacteria 3723
522 Ga0501044_0231085 3300049823 Bacteria 1797
523 Ga0501045_0001120 3300049824 Bacteria 17689
524 nmdc:mga06r32_665480_c1 3300050510 Unclassified 1008
525 nmdc:mga08y16_22821_c1 3300050511 Bacteria 6604
526 nmdc:mga08y16_296282_c1 3300050511 Bacteria 1667
527 nmdc:mga08y16_31995_c1 3300050511 Bacteria 5532
528 nmdc:mga08y16_404446_c1 3300050511 Bacteria 1397
529 nmdc:mga0n895_485589_c1 3300050512 Unclassified 1245
530 nmdc:mga0n895_62552_c1 3300050512 Bacteria 3679
531 nmdc:mga0rr50_814471_c1 3300050513 Unclassified 796
532 nmdc:mga0a205_131643_c1 3300050515 Unclassified 2401
533 nmdc:mga0a205_592360_c1 3300050515 Bacteria 962
534 Ga0495619_0089204 3300053085 Bacteria 2086
535 Ga0500636_0000210 3300053177 Bacteria 31824
536 Ga0500625_051263 3300053729 Bacteria 1904
537 2526212465 2526164512 Bacteria 4025691
538 2548846549 2547132512 Bacteria 3416496
539 2574430280 2574179768 Bacteria 4907129
540 2865002275 2864997549 Bacteria 5139696
541 639788981 639633007 Bacteria 4376040
542 Ga0114129_10129628
543 SwRhRL2b_contig_395561
544 LJQas_1000212
545 JGI24737J22298_10015090
546 JGI24035J26624_1000443
547 JGI25406J46586_10000002
548 Ga0065704_10023691
549 Ga0065712_10000909
550 Ga0065712_10020774
551 Ga0065715_10001537
552 Ga0065715_10008741
553 Ga0065715_10362601
554 Ga0065715_10371153
555 Ga0065715_10574824
556 Ga0065707_10011776
557 Ga0065707_10051083
558 Ga0070676_10029642
559 Ga0070676_10120984
560 Ga0070683_100134600
561 Ga0070683_100142189
562 Ga0070690_100080159
563 Ga0070670_100139354
564 Ga0070670_100247974
565 Ga0070670_100272476
566 Ga0070677_10046544
567 Ga0068869_100328508
568 Ga0068869_100726539
569 Ga0070682_100226153
570 Ga0070682_100761675
571 Ga0068868_100504016
572 Ga0068868_100515533
573 Ga0070660_100012754
574 Ga0070660_100033250
575 Ga0070689_100009244
576 Ga0070689_100016418
577 Ga0070689_100023483
578 Ga0070689_100279065
579 Ga0070689_100336793
580 Ga0070687_100032638
581 Ga0070687_100259689
582 Ga0070668_100015290
583 Ga0070668_100035580
584 Ga0070668_100166605
585 Ga0070675_100002235
586 Ga0070675_100023228
587 Ga0070675_100174025
588 Ga0070671_100063066
589 Ga0070671_100088709
590 Ga0070674_100206217
591 Ga0070674_100292644
592 Ga0070674_100859471
593 Ga0070673_100098852
594 Ga0070673_100252340
595 Ga0070688_100000773
596 Ga0070688_100013682
597 Ga0070688_100073012
598 Ga0070659_100001243
599 Ga0070659_100593889
600 Ga0070667_100052770
601 Ga0070667_100080922
602 Ga0070667_100193269
603 Ga0070667_100343323
604 Ga0070714_100275925
605 Ga0070714_100357955
606 Ga0070713_100045462
607 Ga0070710_10029333
608 Ga0070701_10036636
609 Ga0070711_100006371
610 Ga0070711_100150260
611 Ga0070700_100009402
612 Ga0070700_100196246
613 Ga0070694_100373072
614 Ga0070708_100085458
615 Ga0070708_100707802
616 Ga0070708_100806431
617 Ga0070663_100008999
618 Ga0070663_100233533
619 Ga0070678_100206858
620 Ga0070678_100442989
621 Ga0070662_100038946
622 Ga0070662_100071788
623 Ga0070662_100250484
624 Ga0070662_100332347
625 Ga0070662_100332476
626 Ga0070662_100768170
627 Ga0070681_10125118
628 Ga0068867_100141065
629 Ga0070685_10424332
630 Ga0070698_100725922
631 Ga0070699_100434002
632 Ga0070684_100000223
633 Ga0070684_100221876
634 Ga0070684_100362263
635 Ga0070697_100005508
636 Ga0070697_100008301
637 Ga0070697_100039526
638 Ga0070697_100046931
639 Ga0068853_100049471
640 Ga0068853_100309667
641 Ga0070672_100151060
642 Ga0070672_100190966
643 Ga0070672_100385274
644 Ga0070695_100245210
645 Ga0070696_100585676
646 Ga0070693_100093436
647 Ga0070665_100064900
648 Ga0070665_100304868
649 Ga0070704_100026647
650 Ga0068855_100039974
651 Ga0070664_100116235
652 Ga0070664_100146669
653 Ga0070664_100220993
654 Ga0068857_100025407
655 Ga0068857_100678610
656 Ga0068856_100870751
657 Ga0070702_100338667
658 Ga0068859_100021797
659 Ga0068864_100064628
660 Ga0068864_100137113
661 Ga0068861_100319847
662 Ga0068863_100006124
663 Ga0068863_100329370
664 Ga0068858_100009928
665 Ga0068858_100117035
666 Ga0068858_100347735
667 Ga0068860_100004153
668 Ga0068860_100023249
669 Ga0068860_100036576
670 Ga0068860_100117126
671 Ga0068862_100083417
672 Ga0068862_100236432
673 Ga0081455_10003905
674 Ga0081455_10051948
675 Ga0081455_10059596
676 Ga0081455_10075954
677 Ga0081455_10109547
678 Ga0081455_10478378
679 Ga0081540_1028337
680 Ga0081540_1141351
681 Ga0081539_10000061
682 Ga0081539_10011593
683 Ga0081539_10062331
684 Ga0070717_10022831
685 Ga0070717_10327187
686 Ga0070715_10180330
687 Ga0070716_100037042
688 Ga0070712_100006277
689 Ga0070712_100050175
690 Ga0070712_100241363
691 Ga0097621_100438776
692 Ga0097621_100919712
693 Ga0075428_100373244
694 Ga0075430_100691141
695 Ga0075434_100159916
696 Ga0075434_100166287
697 Ga0097620_100021797
698 Ga0099795_10015743
699 Ga0105240_10164820
700 Ga0111539_10005594
701 Ga0111539_10227807
702 Ga0105245_10863058
703 Ga0105247_10182999
704 Ga0114129_10186629
705 Ga0114129_10857468
706 Ga0105243_10871413
707 Ga0105242_10493059
708 Ga0105248_10144991
709 Ga0105248_10956815
710 Ga0105237_10227642
711 Ga0105237_10250047
712 Ga0105237_10327980
713 Ga0105238_10872958
714 Ga0105249_10002442
715 Ga0105249_10065551
716 Ga0105249_10259681
717 Ga0105249_11451062
718 Ga0099796_10003217
719 Ga0105239_10123819
720 Ga0105239_10362899
721 Ga0105239_11336242
722 Ga0157373_10023746
723 Ga0157369_10657656
724 Ga0157374_10048316
725 Ga0157374_10247855
726 Ga0157374_10500257
727 Ga0157374_11354983
728 Ga0157378_10202438
729 Ga0157378_10542375
730 Ga0157378_10556326
731 Ga0163162_10029284
732 Ga0163162_10078127
733 Ga0163162_10164881
734 Ga0163162_11216345
735 Ga0157372_10078710
736 Ga0157372_10405457
737 Ga0157372_11499129
738 Ga0157375_10004619
739 Ga0157375_10339940
740 Ga0157375_10449396
741 Ga0157377_10021585
742 Ga0157377_10178383
743 Ga0157379_10001718
744 Ga0157376_10200619
745 Ga0157376_10618786
746 Ga0207666_1003218
747 Ga0207673_1009768
748 Ga0207697_10000728
749 Ga0207697_10041453
750 Ga0207697_10057617
751 Ga0207697_10184251
752 Ga0207653_10009013
753 Ga0207682_10068506
754 Ga0207692_10029490
755 Ga0207692_10112431
756 Ga0207688_10158912
757 Ga0207688_10273024
758 Ga0207680_10348687
759 Ga0207647_10015588
760 Ga0207645_10106612
761 Ga0207707_10115975
762 Ga0207671_10138673
763 Ga0207693_10000865
764 Ga0207693_10006929
765 Ga0207693_10024641
766 Ga0207693_10061472
767 Ga0207693_10102200
768 Ga0207657_10038577
769 Ga0207657_10254131
770 Ga0207649_10526626
771 Ga0207652_10927829
772 Ga0207646_10190162
773 Ga0207681_10176743
774 Ga0207681_10323923
775 Ga0207650_10198004
776 Ga0207659_10001661
777 Ga0207659_10003893
778 Ga0207659_10122214
779 Ga0207659_10384249
780 Ga0207687_10174448
781 Ga0207700_10035809
782 Ga0207664_10084217
783 Ga0207644_10131713
784 Ga0207644_10493460
785 Ga0207690_10004818
786 Ga0207690_10318133
787 Ga0207690_10325450
788 Ga0207706_10006497
789 Ga0207706_10037714
790 Ga0207706_10043098
791 Ga0207706_10051671
792 Ga0207686_10464520
793 Ga0207670_10008801
794 Ga0207670_10030992
795 Ga0207670_10062920
796 Ga0207669_10233321
797 Ga0207669_10286567
798 Ga0207665_10032279
799 Ga0207665_10054528
800 Ga0207665_10266343
801 Ga0207665_10338831
802 Ga0207691_10065221
803 Ga0207691_10170098
804 Ga0207691_10323512
805 Ga0207691_10476493
806 Ga0207689_10062782
807 Ga0207661_10083999
808 Ga0207679_10107514
809 Ga0207679_10575656
810 Ga0207651_10273215
811 Ga0207712_10004354
812 Ga0207668_10007939
813 Ga0207668_10017766
814 Ga0207668_10445239
815 Ga0207658_10053545
816 Ga0207658_10061573
817 Ga0207658_10181942
818 Ga0207677_10460474
819 Ga0207703_10021957
820 Ga0207703_10129302
821 Ga0207639_10985770
822 Ga0207678_10010085
823 Ga0207678_10028345
824 Ga0207708_10009330
825 Ga0207641_10011630
826 Ga0207648_10037366
827 Ga0207648_10648155
828 Ga0207676_10034259
829 Ga0207674_10013872
830 Ga0207675_100234715
831 Ga0207675_100816491
832 Ga0207683_10157242
833 Ga0207683_10233591
834 Ga0207698_10881830
835 Ga0209179_1019365
836 Ga0209974_10143420
837 Ga0207428_10025209
838 Ga0207428_10209574
839 Ga0268266_10034876
840 Ga0268266_10044338
841 Ga0268265_10192380
842 Ga0268265_10332805
843 Ga0268264_10044082
844 Ga0268264_10825055
845 Ga0265324_10045622
846 Ga0307511_10130027
847 Ga0265330_10048160
848 Ga0265332_10000069
849 Ga0265332_10003818
850 Ga0265327_10002356
851 Ga0265327_10053482
852 Ga0265316_10219961
853 Ga0307509_10000138
854 Ga0316579_10031849
855 Ga0316578_10189500
856 Ga0307405_10025983
857 Ga0307405_10601240
858 Ga0307413_10000379
859 Ga0307413_10006127
860 Ga0307413_10013602
861 Ga0307413_10194356
862 Ga0307413_10309109
863 Ga0307413_10836479
864 Ga0307410_10000234
865 Ga0307410_10033745
866 Ga0307410_10115271
867 Ga0307410_10171875
868 Ga0307410_10302058
869 Ga0307406_10022694
870 Ga0307406_10025816
871 Ga0307406_10035216
872 Ga0307407_10000212
873 Ga0307407_10000791
874 Ga0307407_10059883
875 Ga0307407_10109025
876 Ga0307407_10646260
877 Ga0307412_10117106
878 Ga0307412_10273604
879 Ga0307412_10360468
880 Ga0307412_10450326
881 Ga0307412_11236932
882 Ga0307409_100003190
883 Ga0307409_100299345
884 Ga0307409_100376806
885 Ga0307409_100570762
886 Ga0307409_101155121
887 Ga0307416_100580969
888 Ga0307416_100755270
889 Ga0307416_100955049
890 Ga0307416_102142176
891 Ga0307414_10031596
892 Ga0307414_10041788
893 Ga0307414_10065700
894 Ga0307411_10011930
895 Ga0307411_10597382
896 Ga0307415_100005446
897 Ga0307415_100054394
898 Ga0307415_100634085
899 Ga0316583_10034483
900 Ga0316580_10051185
901 Ga0316580_10102303
902 Ga0373959_0045987
903 Ga0373926_0066011
904 Ga0373932_0186262
905 Ga0373932_0281080
906 Ga0373945_0006509
907 Ga0373954_0276720
908 Ga0373960_0080691
909 Ga0373943_0017795
910 Ga0373943_0035986
911 Ga0373946_0077837
912 Ga0373962_0028225
913 Ga0316574_0227683
914 Ga0373924_0016912
915 Ga0373924_0058782
916 Ga0373931_0085703
917 Ga0373931_0183236
918 Ga0373931_0210246
919 Ga0373935_0317015
920 Ga0373927_0053798
921 Ga0373927_0384165
922 Ga0373927_0410954
923 Ga0373927_0465694
924 Ga0373947_0003389
925 Ga0373947_0046675
926 Ga0373947_0065316
927 Ga0373937_0124475
928 Ga0373937_0308645
929 Ga0316582_0008351
930 Ga0373925_0010416
931 Ga0373925_0259207
932 Ga0373925_0690714
933 Ga0395900_0459237
934 Ga0395898_0303583
935 Ga0436361_0450372
936 Ga0436361_0541982
937 Ga0436361_0760940
938 Ga0436361_0799803
939 Ga0436362_0222690
940 Ga0439439_0054789
941 Ga0439455_0017257
942 Ga0450896_006635
943 Ga0450898_012743
944 Ga0439458_0037487
945 Ga0439444_0029115
946 Ga0439464_0025795
947 Ga0439460_0051943
948 Ga0439460_0076778
949 Ga0439460_0143525
950 Ga0451577_0054199
951 Ga0451577_0090334
952 Ga0439440_0065449
953 Ga0453684_0000189
954 Ga0451576_0004150
955 Ga0451576_0054305
956 Ga0451576_0192885
957 Ga0451576_1434396
958 Ga0495592_0026196
959 Ga0495629_0014267
960 Ga0495653_0253709
961 Ga0495662_0285802
962 Ga0495664_0612093
963 Ga0495584_0129362
964 Ga0495584_0273010
965 Ga0495585_0342218
966 Ga0495616_0148798
967 Ga0495628_0042862
968 Ga0495630_0033732
969 Ga0495586_0085929
970 Ga0495598_0020788
971 Ga0495645_0151223
972 Ga0495622_0169570
973 Ga0495656_0147316
974 Ga0495668_0282278
975 Ga0495634_0031596
976 Ga0495635_0034749
977 Ga0495659_0002663
978 Ga0495599_0062614
979 Ga0495669_0017506
980 Ga0495613_0170975
981 Ga0495671_0029528
982 Ga0495589_0018364
983 Ga0495581_0109348
984 Ga0495680_0330592
985 Ga0495675_0538623
986 Ga0495684_0005721
987 Ga0496100_0065819
988 Ga0496101_0339114
989 Ga0496102_0019408
990 Ga0496102_0158882
991 Ga0496102_0341548
992 Ga0496103_0254148
993 Ga0496104_0055777
994 Ga0496105_0144065
995 Ga0496106_0051154
996 Ga0496106_0203575
997 Ga0496106_0280093
998 Ga0496108_0081434
999 Ga0496108_0122558
1000 Ga0496108_0160173
1001 Ga0496108_0662073
1002 Ga0496109_0030776
1003 Ga0496109_0149068
1004 Ga0496109_0152690
1005 Ga0496109_0595612
1006 Ga0496109_0804043
1007 Ga0496110_0041039
1008 Ga0496110_0079912
1009 Ga0496110_0407952
1010 Ga0496111_0363921
1011 Ga0496112_1168448
1012 Ga0496113_0000857
1013 Ga0496114_0058818
1014 Ga0496114_0064543
1015 Ga0496115_0956672
1016 Ga0501031_0021782
1017 Ga0501032_0000146
1018 Ga0501032_0023475
1019 Ga0501032_0068611
1020 Ga0501033_0000875
1021 Ga0501033_0484443
1022 Ga0501034_0001607
1023 Ga0501036_0002965
1024 Ga0501036_0099681
1025 Ga0501037_0000311
1026 Ga0501038_0002632
1027 Ga0501038_0014366
1028 Ga0501038_0245072
1029 Ga0501038_0269504
1030 Ga0501038_0519165
1031 Ga0501039_0001397
1032 Ga0501039_0020503
1033 Ga0501040_0004509
1034 Ga0501042_0000049
1035 Ga0501043_0001168
1036 Ga0501043_0382564
1037 Ga0501046_0001374
1038 Ga0501047_0007830
1039 Ga0501048_0003975
1040 Ga0501068_0016288
1041 Ga0501072_0159148
1042 Ga0501073_0117899
1043 Ga0501202_005889
1044 Ga0501227_099375
1045 Ga0501235_021827
1046 Ga0501240_063247
1047 Ga0501243_057621
1048 Ga0501247_001180
1049 Ga0501249_026146
1050 Ga0501259_025569
1051 Ga0501259_100913
1052 Ga0501262_005378
1053 Ga0501267_006039
1054 Ga0501268_000391
1055 Ga0501270_005954
1056 Ga0501273_001638
1057 Ga0501035_0024151
1058 Ga0501035_0034528
1059 Ga0501035_0062046
1060 Ga0501035_0326889
1061 Ga0501044_0006116
1062 Ga0501044_0064957
1063 Ga0501044_0231085
1064 Ga0501045_0001120
1065 nmdc:mga06r32_665480_c1
1066 nmdc:mga08y16_22821_c1
1067 nmdc:mga08y16_296282_c1
1068 nmdc:mga08y16_31995_c1
1069 nmdc:mga08y16_404446_c1
1070 nmdc:mga0n895_485589_c1
1071 nmdc:mga0n895_62552_c1
1072 nmdc:mga0rr50_814471_c1
1073 nmdc:mga0a205_131643_c1
1074 nmdc:mga0a205_592360_c1
1075 Ga0495619_0089204
1076 Ga0500636_0000210
1077 Ga0500625_051263
1078 2526212465
1079 2548846549
1080 2574430280
1081 2865002275
1082 639788981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02441

Flavoprotein

Flavoprotein

26

195

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7km2-assembly1.cif.gz_K dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn 0.9454 2 179
6m8v-assembly1.cif.gz_A crystal structure of ubix-like fmn prenyltransferase mj0101 from methanocaldococcus jannaschii, fmn complex 0.9453 1 180
4rhe-assembly1.cif.gz_B crystal structure of ubix, an aromatic acid decarboxylase from the colwellia psychrerythraea 34h 0.9422 2 179
7km2-assembly1.cif.gz_F dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn 0.9362 2 179
7km3-assembly1.cif.gz_A dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap 0.9313 2 174
ID Description Score Start End Superfamily
af_P33751_55_242_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.932 1 180 3.40.50.1950
2ejbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9287 2 169 3.40.50.1950
4zavA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9112 2 185 3.40.50.1950
af_P33751_55_242_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.8892 1 180 3.40.50.1950
4zavA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.8835 2 185 3.40.50.1950
ID Description Score Start End GO Terms
AF-A0A2V5MR75-F1-model_v4 3-octaprenyl-4-hydroxybenzoate carboxy-lyase 0.997 1 115 GO:0004659
GO:0016829
AF-A0A2V5XPR9-F1-model_v4 3-octaprenyl-4-hydroxybenzoate carboxy-lyase 0.9793 1 157 GO:0004659
GO:0016829
AF-A0A2V5RU15-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9783 1 184 GO:0016829
GO:0106141
AF-A0A7X8C9R8-F1-model_v4 deleted 0.9718 2 174
AF-A0A2V5MR75-F1-model_v4 3-octaprenyl-4-hydroxybenzoate carboxy-lyase 0.9717 1 115 GO:0004659
GO:0016829

Map