F461341

General Info

Members Datasets Scaffolds Average Seq Length
541 326 498 231

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10005042|Ga0075365_100050428
Length 249
Sequence MFLSTAIRRRPEFRAGIRDMSSAALGIGAWGLMTGVAMVKSNMSVLESVAMTLLVYAGSSQLAAIPLLFAGAPAWVILATGFCVNLRFVVFSLHLRPYLMHMPRWRRMTHGYLTADLSYALFTRKYPAPPAGADAQKAQGAQEAYLTGNYFVTWCSWMGMSLLGIALANFIPQNWGLGFAGVLSLVAIVCSMATTRLRVLATLIASVTAVXXXXLPLKLNIVVAIGVAVLLCFWLEKQFGLDPDAEDDK

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221658 Variovorax sp. Root411 Isolate Unclassified
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2643221683 Variovorax sp. Root473 Isolate Unclassified
10 2738541277 Variovorax sp. GV051 Isolate Unclassified
11 2738541307 Variovorax sp. GV008 Isolate Unclassified
12 2738543013 Variovorax sp. BT01 Isolate Unclassified
13 2738543019 Variovorax sp. GV040 Isolate Unclassified
14 2818991446 Variovorax sp. 1180 Isolate Unclassified
15 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
16 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
17 2842677519 Variovorax sp. R-72495 Isolate Unclassified
18 2842733646 Variovorax sp. R-72446 Isolate Unclassified
19 2842747753 Variovorax sp. R-72060 Isolate Unclassified
20 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
21 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
22 2885198086 Variovorax sp. 679 Isolate Unclassified
23 2885211737 Variovorax sp. 553 Isolate Unclassified
24 2899924645 Variovorax sp. 369 Isolate Unclassified
25 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
26 2904456579 Variovorax sp. 2002 Isolate Unclassified
27 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
28 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
29 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
30 2928037797 Variovorax sp. 1126 Isolate Unclassified
31 2928044640 Variovorax sp. 1128 Isolate Unclassified
32 2928051484 Variovorax sp. 1133 Isolate Unclassified
33 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
34 2928070936 Variovorax gossypii 1167 Isolate Unclassified
35 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
36 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
37 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
38 2929520902 Variovorax beijingensis 502 Isolate Unclassified
39 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
40 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
41 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
42 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
43 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
48 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
49 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
55 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
56 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
57 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
60 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
61 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
64 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
65 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
70 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
173 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
174 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
175 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
176 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
177 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
178 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
179 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
204 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
205 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
206 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
210 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
211 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
215 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
216 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
217 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
218 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
219 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
220 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
221 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
222 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
223 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
224 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
225 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
226 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
227 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
228 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
232 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
250 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
255 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
272 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
285 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
291 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
292 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
305 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
306 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
307 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
308 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
309 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
310 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
311 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
312 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
313 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
314 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
315 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
316 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
319 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
322 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
323 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
326 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.5
Metatranscriptomes 0.55
Isolates 7.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.57
Nodule 0.55
Rhizoplane 2.4
Rhizosphere 52.31
Stem 0
Stem Tuber 0
Unclassified 10.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10059931 3300001979 Bacteria 1053
2 JGI24739J22299_10023093 3300001989 Bacteria 2201
3 JGI25152J39213_1004633 3300002773 Bacteria 4271
4 JGI25152J39213_1023786 3300002773 Bacteria 1038
5 JGI25150J39212_1000874 3300002774 Bacteria 9971
6 JGI25159J45721_1008148 3300002987 Bacteria 2909
7 JGI25151J46595_10001246 3300003187 Bacteria 18063
8 JGI25151J46595_10001606 3300003187 Bacteria 14987
9 JGI25151J46595_10003299 3300003187 Bacteria 8961
10 JGI25151J46595_10007260 3300003187 Bacteria 5452
11 JGI25151J46595_10072238 3300003187 Bacteria 1038
12 JGI25153J46596_10010204 3300003215 Bacteria 4271
13 JGI25153J46596_10059982 3300003215 Bacteria 1038
14 rootH1_10097023 3300003316 Bacteria 2065
15 rootH2_10178126 3300003320 Bacteria 1103
16 JGI25160J50197_1007473 3300003354 Bacteria 4271
17 JGI25160J50197_1007479 3300003354 Bacteria 4270
18 JGI25161J50226_1002863 3300003374 Bacteria 4211
19 JGI25161J50226_1002870 3300003374 Bacteria 4200
20 Ga0006562J51391_1039181 3300003578 Bacteria 6060
21 Ga0006562J51391_1044441 3300003578 Bacteria 8308
22 Ga0006562J51391_1044445 3300003578 Bacteria 3537
23 Ga0055535_1000552 3300003761 Bacteria 32082
24 Ga0055542_1000003 3300003762 Bacteria 582721
25 Ga0055526_1010589 3300003771 Bacteria 4271
26 Ga0055526_1010591 3300003771 Bacteria 4271
27 Ga0055537_1000508 3300003773 Bacteria 23378
28 Ga0055537_1001509 3300003773 Bacteria 8961
29 Ga0055524_1008473 3300003775 Bacteria 4271
30 Ga0055536_1007479 3300003781 Bacteria 4876
31 Ga0055536_1010016 3300003781 Bacteria 3829
32 Ga0055536_1011023 3300003781 Bacteria 3517
33 Ga0055536_1029014 3300003781 Bacteria 1495
34 Ga0055534_1000461 3300003784 Bacteria 23378
35 Ga0055534_1001223 3300003784 Bacteria 10737
36 Ga0055534_1001552 3300003784 Bacteria 8961
37 Ga0055534_1016674 3300003784 Bacteria 1314
38 Ga0055528_1000810 3300003790 Bacteria 21516
39 Ga0055528_1002798 3300003790 Bacteria 9135
40 Ga0055530_10001076 3300003791 Bacteria 21499
41 Ga0055530_10011406 3300003791 Bacteria 3193
42 Ga0055540_1002308 3300003792 Bacteria 10238
43 Ga0055540_1002716 3300003792 Bacteria 9113
44 Ga0055540_1003718 3300003792 Bacteria 7220
45 Ga0055540_1008984 3300003792 Bacteria 3521
46 Ga0055531_10003339 3300003794 Bacteria 10270
47 Ga0055531_10003705 3300003794 Bacteria 9615
48 Ga0055531_10007508 3300003794 Bacteria 5930
49 Ga0055543_1001369 3300004625 Bacteria 9816
50 Ga0065165_1009609 3300005262 Bacteria 4306
51 Ga0065165_1031297 3300005262 Bacteria 1683
52 Ga0065165_1080630 3300005262 Bacteria 845
53 Ga0065704_10201910 3300005289 Bacteria 1143
54 Ga0070658_10122467 3300005327 Bacteria 2162
55 Ga0070658_10630540 3300005327 Bacteria 930
56 Ga0068869_100099186 3300005334 Bacteria 2201
57 Ga0068868_100011378 3300005338 Bacteria 6479
58 Ga0068868_100139634 3300005338 Bacteria 1988
59 Ga0070660_100253752 3300005339 Bacteria 1435
60 Ga0070669_100139434 3300005353 Bacteria 1868
61 Ga0070669_100532223 3300005353 Bacteria 978
62 Ga0070675_100498775 3300005354 Bacteria 1097
63 Ga0070675_100511416 3300005354 Bacteria 1083
64 Ga0070674_100111447 3300005356 Bacteria 2010
65 Ga0070678_100129881 3300005456 Bacteria 2000
66 Ga0070678_100142658 3300005456 Bacteria 1919
67 Ga0070678_100186090 3300005456 Bacteria 1704
68 Ga0070662_100025442 3300005457 Bacteria 4088
69 Ga0068867_100404915 3300005459 Bacteria 1152
70 Ga0068853_100042455 3300005539 Bacteria 3888
71 Ga0068853_100201435 3300005539 Bacteria 1812
72 Ga0068853_100278278 3300005539 Bacteria 1542
73 Ga0068855_100106757 3300005563 Bacteria 3218
74 Ga0068855_100635599 3300005563 Bacteria 1148
75 Ga0070664_100053827 3300005564 Bacteria 3413
76 Ga0068854_100262601 3300005578 Bacteria 1383
77 Ga0068852_100090555 3300005616 Bacteria 2736
78 Ga0068852_100206716 3300005616 Bacteria 1860
79 Ga0068859_100253883 3300005617 Bacteria 1849
80 Ga0068862_100043607 3300005844 Bacteria 3825
81 Ga0075365_10005042 3300006038 Bacteria 7083
82 Ga0075365_10024318 3300006038 Bacteria 3819
83 Ga0075365_10152521 3300006038 Bacteria 1608
84 Ga0075368_10015087 3300006042 Bacteria 2861
85 Ga0075368_10017282 3300006042 Bacteria 2698
86 Ga0075363_100048564 3300006048 Bacteria 2257
87 Ga0075363_100181681 3300006048 Bacteria 1197
88 Ga0075364_10086451 3300006051 Bacteria 2077
89 Ga0075364_10312209 3300006051 Bacteria 1071
90 Ga0075432_10022631 3300006058 Bacteria 2150
91 Ga0075362_10006208 3300006177 Bacteria 4439
92 Ga0075362_10013922 3300006177 Bacteria 3233
93 Ga0075362_10032046 3300006177 Bacteria 2278
94 Ga0075362_10060598 3300006177 Bacteria 1711
95 Ga0075362_10069063 3300006177 Bacteria 1610
96 Ga0075367_10006554 3300006178 Bacteria 5892
97 Ga0075367_10025570 3300006178 Bacteria 3340
98 Ga0075367_10044382 3300006178 Bacteria 2605
99 Ga0075367_10141402 3300006178 Bacteria 1491
100 Ga0075369_10012649 3300006186 Bacteria 3334
101 Ga0075366_10001688 3300006195 Bacteria 11083
102 Ga0075366_10008631 3300006195 Bacteria 5673
103 Ga0075366_10019528 3300006195 Bacteria 3923
104 Ga0075366_10025504 3300006195 Bacteria 3453
105 Ga0075366_10048552 3300006195 Bacteria 2517
106 Ga0075370_10009245 3300006353 Bacteria 5108
107 Ga0075370_10021732 3300006353 Bacteria 3516
108 Ga0075370_10024949 3300006353 Bacteria 3305
109 Ga0075370_10047266 3300006353 Bacteria 2437
110 Ga0075370_10063588 3300006353 Bacteria 2104
111 Ga0075370_10247384 3300006353 Bacteria 1056
112 Ga0075428_100603345 3300006844 Bacteria 1172
113 Ga0075430_100103531 3300006846 Bacteria 2376
114 Ga0075429_100838917 3300006880 Bacteria 805
115 Ga0097620_100253889 3300006931 Bacteria 1849
116 Ga0099826_10004376 3300006948 Bacteria 9890
117 Ga0105244_10020518 3300009036 Bacteria 3670
118 Ga0105245_10149712 3300009098 Bacteria 2206
119 Ga0105243_10009826 3300009148 Bacteria 7282
120 Ga0105243_10074383 3300009148 Bacteria 2755
121 Ga0105242_10109777 3300009176 Bacteria 2349
122 Ga0105239_10020029 3300010375 Bacteria 7381
123 Ga0105239_10229494 3300010375 Bacteria 2083
124 Ga0105246_10173739 3300011119 Bacteria 1652
125 Ga0157347_1003692 3300012502 Bacteria 1387
126 Ga0157373_10069551 3300013100 Bacteria 2489
127 Ga0157371_10035373 3300013102 Bacteria 3579
128 Ga0157370_10294061 3300013104 Bacteria 1500
129 Ga0157370_10405033 3300013104 Bacteria 1255
130 Ga0157369_10069284 3300013105 Bacteria 3790
131 Ga0163162_10096868 3300013306 Bacteria 3038
132 Ga0157372_10112936 3300013307 Bacteria 3113
133 Ga0157375_10324994 3300013308 Bacteria 1703
134 Ga0182008_10001489 3300014497 Bacteria 15647
135 Ga0182008_10008224 3300014497 Bacteria 5708
136 Ga0157379_10144708 3300014968 Bacteria 2143
137 Ga0157376_10010561 3300014969 Bacteria 6761
138 Ga0157376_10924375 3300014969 Bacteria 892
139 Ga0182006_1003670 3300015261 Bacteria 7782
140 Ga0182007_10001107 3300015262 Bacteria 14594
141 Ga0182005_1011669 3300015265 Bacteria 2499
142 Ga0183362_10004 3300015683 Bacteria 569303
143 Ga0163161_10001219 3300017792 Bacteria 19374
144 Ga0163161_10007245 3300017792 Bacteria 7664
145 Ga0163161_10012800 3300017792 Bacteria 5828
146 Ga0163161_10058786 3300017792 Bacteria 2795
147 Ga0163161_10498588 3300017792 Bacteria 991
148 Ga0209436_104194 3300025208 Bacteria 3613
149 Ga0209672_100220 3300025228 Bacteria 44241
150 Ga0209147_101193 3300025229 Bacteria 10522
151 Ga0209258_100015 3300025242 Bacteria 706310
152 Ga0207425_1000532 3300025245 Bacteria 23050
153 Ga0207425_1001822 3300025245 Bacteria 8249
154 Ga0209148_1000028 3300025254 Bacteria 582773
155 Ga0209129_1000049 3300025258 Bacteria 268086
156 Ga0209129_1000850 3300025258 Bacteria 19144
157 Ga0209129_1001373 3300025258 Bacteria 13666
158 Ga0209129_1001720 3300025258 Bacteria 11801
159 Ga0209565_1000616 3300025263 Bacteria 23453
160 Ga0209565_1001027 3300025263 Bacteria 14191
161 Ga0209673_1000193 3300025273 Bacteria 123134
162 Ga0209673_1001755 3300025273 Bacteria 18074
163 Ga0209673_1002433 3300025273 Bacteria 12930
164 Ga0209673_1003214 3300025273 Bacteria 9889
165 Ga0209130_1000738 3300025284 Bacteria 28711
166 Ga0209130_1001701 3300025284 Bacteria 13303
167 Ga0209130_1005270 3300025284 Bacteria 4549
168 Ga0209675_1000220 3300025291 Bacteria 59335
169 Ga0209675_1000752 3300025291 Bacteria 21822
170 Ga0209675_1001562 3300025291 Bacteria 12989
171 Ga0209675_1001767 3300025291 Bacteria 11823
172 Ga0209675_1004908 3300025291 Bacteria 5776
173 Ga0209676_1000074 3300025292 Bacteria 305770
174 Ga0209676_1000209 3300025292 Bacteria 130388
175 Ga0209676_1001266 3300025292 Bacteria 26257
176 Ga0209676_1010843 3300025292 Bacteria 3743
177 Ga0209676_1018674 3300025292 Bacteria 2411
178 Ga0209025_1000283 3300025294 Bacteria 114855
179 Ga0209025_1001271 3300025294 Bacteria 34705
180 Ga0209025_1001535 3300025294 Bacteria 29451
181 Ga0209025_1038179 3300025294 Bacteria 2116
182 Ga0209025_1052920 3300025294 Bacteria 1598
183 Ga0209564_1001576 3300025295 Bacteria 22303
184 Ga0209564_1003788 3300025295 Bacteria 9830
185 Ga0209758_1003331 3300025297 Bacteria 14776
186 Ga0209758_1005924 3300025297 Bacteria 9090
187 Ga0209050_1000015 3300025298 Bacteria 759102
188 Ga0209050_1004374 3300025298 Bacteria 9591
189 Ga0209256_1000264 3300025299 Bacteria 92750
190 Ga0209256_1000304 3300025299 Bacteria 85971
191 Ga0207426_1000108 3300025302 Bacteria 242257
192 Ga0207426_1000130 3300025302 Bacteria 210271
193 Ga0209051_1000010 3300025303 Bacteria 641298
194 Ga0209051_1000156 3300025303 Bacteria 128246
195 Ga0209051_1000680 3300025303 Bacteria 37836
196 Ga0209051_1000891 3300025303 Bacteria 29909
197 Ga0209051_1003579 3300025303 Bacteria 10104
198 Ga0209257_1000026 3300025304 Bacteria 723225
199 Ga0209257_1000172 3300025304 Bacteria 167434
200 Ga0209257_1004242 3300025304 Bacteria 11324
201 Ga0209257_1006791 3300025304 Bacteria 7201
202 Ga0207705_10106744 3300025909 Bacteria 2065
203 Ga0207654_10466527 3300025911 Bacteria 887
204 Ga0207671_10046850 3300025914 Bacteria 3199
205 Ga0207681_10002834 3300025923 Bacteria 10974
206 Ga0207694_10294592 3300025924 Bacteria 1335
207 Ga0207650_10494589 3300025925 Bacteria 1021
208 Ga0207644_10111340 3300025931 Bacteria 2071
209 Ga0207706_10010805 3300025933 Bacteria 8332
210 Ga0207709_10000881 3300025935 Bacteria 22823
211 Ga0207709_10001518 3300025935 Bacteria 16025
212 Ga0207709_10008095 3300025935 Bacteria 5823
213 Ga0207669_10146544 3300025937 Bacteria 1647
214 Ga0207691_10065201 3300025940 Bacteria 3298
215 Ga0207711_10250274 3300025941 Bacteria 1627
216 Ga0207689_10047691 3300025942 Bacteria 3535
217 Ga0207689_10159225 3300025942 Bacteria 1861
218 Ga0207679_10069759 3300025945 Bacteria 2646
219 Ga0207667_10073365 3300025949 Bacteria 3556
220 Ga0207677_10009823 3300026023 Bacteria 5393
221 Ga0207677_10110057 3300026023 Bacteria 2050
222 Ga0207639_10009570 3300026041 Bacteria 6691
223 Ga0207639_10175451 3300026041 Bacteria 1819
224 Ga0207678_10052086 3300026067 Bacteria 3532
225 Ga0207648_10343906 3300026089 Bacteria 1344
226 Ga0207676_10824929 3300026095 Bacteria 906
227 Ga0207674_10152108 3300026116 Bacteria 2271
228 Ga0207683_10330422 3300026121 Bacteria 1397
229 Ga0207683_10525010 3300026121 Bacteria 1094
230 Ga0207698_10116878 3300026142 Bacteria 2249
231 Ga0207698_10400768 3300026142 Bacteria 1311
232 Ga0209282_1000107 3300027666 Bacteria 54230
233 Ga0268266_10197124 3300028379 Bacteria 1841
234 Ga0268265_10184106 3300028380 Bacteria 1797
235 Ga0307517_10161063 3300028786 Bacteria 1506
236 Ga0307515_10000034 3300028794 Bacteria 344640
237 Ga0307515_10004298 3300028794 Bacteria 29582
238 Ga0307515_10120145 3300028794 Bacteria 2983
239 Ga0307515_10141214 3300028794 Bacteria 2582
240 Ga0307515_10371366 3300028794 Bacteria 1067
241 Ga0307512_10114925 3300030522 Bacteria 1755
242 Ga0316177_1083882 3300030731 Bacteria 8039
243 Ga0316176_1202874 3300030732 Bacteria 3868
244 Ga0314311_1037987 3300030733 Bacteria 8746
245 Ga0316178_1108730 3300030735 Bacteria 2721
246 Ga0316180_1109965 3300030736 Bacteria 3749
247 Ga0316181_1212719 3300030744 Bacteria 9197
248 Ga0316182_1134875 3300030745 Bacteria 3527
249 Ga0316182_1186063 3300030745 Bacteria 3520
250 Ga0265329_10012048 3300031242 Bacteria 3123
251 Ga0265331_10020278 3300031250 Bacteria 3417
252 Ga0265327_10002797 3300031251 Bacteria 17626
253 Ga0265327_10027984 3300031251 Bacteria 3234
254 Ga0265316_10456368 3300031344 Bacteria 916
255 Ga0307513_10013418 3300031456 Bacteria 10054
256 Ga0307513_10088941 3300031456 Bacteria 3155
257 Ga0307513_10119921 3300031456 Bacteria 2601
258 Ga0307513_10119937 3300031456 Bacteria 2600
259 Ga0307408_100053312 3300031548 Bacteria 2919
260 Ga0307408_100169221 3300031548 Bacteria 1743
261 Ga0307514_10000772 3300031649 Bacteria 53243
262 Ga0265314_10000882 3300031711 Bacteria 35754
263 Ga0265342_10058236 3300031712 Bacteria 2284
264 Ga0307405_10094187 3300031731 Bacteria 1991
265 Ga0307405_10437433 3300031731 Bacteria 1033
266 Ga0307405_10656348 3300031731 Bacteria 863
267 Ga0307406_10001194 3300031901 Bacteria 14535
268 Ga0307406_10192655 3300031901 Bacteria 1493
269 Ga0307406_10521267 3300031901 Bacteria 967
270 Ga0307407_10165264 3300031903 Bacteria 1452
271 Ga0307407_10234569 3300031903 Bacteria 1248
272 Ga0307412_10028681 3300031911 Bacteria 3485
273 Ga0307412_10043403 3300031911 Bacteria 2927
274 Ga0307412_10303746 3300031911 Bacteria 1262
275 Ga0307416_100220004 3300032002 Bacteria 1820
276 Ga0307416_100468615 3300032002 Bacteria 1317
277 Ga0307414_10061691 3300032004 Bacteria 2656
278 Ga0307414_10497982 3300032004 Bacteria 1077
279 Ga0307411_10033019 3300032005 Bacteria 3205
280 Ga0307411_10053422 3300032005 Bacteria 2647
281 Ga0373931_0092613 3300035691 Bacteria 1686
282 Ga0395899_0011048 3300037312 Bacteria 6916
283 Ga0395900_0003054 3300037418 Bacteria 18229
284 Ga0395900_0022521 3300037418 Bacteria 6445
285 Ga0395900_0092706 3300037418 Bacteria 3104
286 Ga0395900_0290980 3300037418 Bacteria 1622
287 Ga0395898_0014885 3300037466 Bacteria 7984
288 Ga0395898_0094084 3300037466 Bacteria 2880
289 Ga0395898_0703598 3300037466 Bacteria 952
290 Ga0395905_0000047 3300037471 Bacteria 237582
291 Ga0395905_0010034 3300037471 Bacteria 9233
292 Ga0395905_0015479 3300037471 Bacteria 7250
293 Ga0395905_0029288 3300037471 Bacteria 5188
294 Ga0395905_0034752 3300037471 Bacteria 4734
295 Ga0395905_0228821 3300037471 Bacteria 1739
296 Ga0395905_0381479 3300037471 Bacteria 1303
297 Ga0395905_0387691 3300037471 Bacteria 1291
298 Ga0395905_0498731 3300037471 Bacteria 1117
299 Ga0395901_0147058 3300038443 Bacteria 2476
300 Ga0395901_0151089 3300038443 Bacteria 2440
301 Ga0395901_0467228 3300038443 Bacteria 1288
302 Ga0439436_0015525 3300041404 Bacteria 2290
303 Ga0439436_0045455 3300041404 Bacteria 1249
304 Ga0439439_0004178 3300041406 Bacteria 3235
305 Ga0439439_0035051 3300041406 Bacteria 1288
306 Ga0439439_0106375 3300041406 Bacteria 775
307 Ga0439447_014070 3300041407 Bacteria 2252
308 Ga0439466_0003081 3300041411 Bacteria 6487
309 Ga0439466_0003244 3300041411 Bacteria 6337
310 Ga0439465_0005171 3300041413 Bacteria 4186
311 Ga0439431_0019901 3300041997 Bacteria 1599
312 Ga0439431_0022472 3300041997 Bacteria 1520
313 Ga0439431_0053971 3300041997 Bacteria 1047
314 Ga0439431_0074555 3300041997 Bacteria 908
315 Ga0439431_0075942 3300041997 Bacteria 901
316 Ga0439433_0001455 3300041999 Bacteria 4894
317 Ga0439437_009544 3300042000 Bacteria 1100
318 Ga0439442_013792 3300042002 Bacteria 1659
319 Ga0439445_0000788 3300042004 Bacteria 6667
320 Ga0439445_0011977 3300042004 Bacteria 2076
321 Ga0439432_010623 3300042006 Bacteria 3184
322 Ga0439432_024551 3300042006 Bacteria 1981
323 Ga0439449_0000210 3300042007 Bacteria 20564
324 Ga0439449_0003246 3300042007 Bacteria 6338
325 Ga0439449_0016033 3300042007 Bacteria 2817
326 Ga0439449_0061502 3300042007 Bacteria 1385
327 Ga0439452_008612 3300042010 Bacteria 3058
328 Ga0439452_008815 3300042010 Bacteria 3009
329 Ga0439457_004466 3300042014 Bacteria 3638
330 Ga0439457_026766 3300042014 Bacteria 1277
331 Ga0439462_0005556 3300042015 Bacteria 3109
332 Ga0439462_0008644 3300042015 Bacteria 2571
333 Ga0450911_000650 3300042115 Bacteria 10413
334 Ga0450912_007252 3300042116 Bacteria 896
335 Ga0450914_003288 3300042118 Bacteria 1232
336 Ga0450923_032913 3300042125 Bacteria 1064
337 Ga0450890_009796 3300042127 Bacteria 1231
338 Ga0450897_003022 3300042128 Bacteria 1316
339 Ga0450896_027426 3300042133 Bacteria 852
340 Ga0450889_009590 3300042144 Bacteria 993
341 Ga0450906_003775 3300042145 Bacteria 3223
342 Ga0450906_028898 3300042145 Bacteria 982
343 Ga0439446_0003074 3300042156 Bacteria 4096
344 Ga0439458_0017242 3300042157 Bacteria 1647
345 Ga0450908_010424 3300042184 Bacteria 1715
346 Ga0450908_017148 3300042184 Bacteria 1287
347 Ga0439434_0006134 3300042435 Bacteria 3505
348 Ga0439434_0007659 3300042435 Bacteria 3164
349 Ga0439434_0022335 3300042435 Bacteria 1902
350 Ga0439434_0031718 3300042435 Bacteria 1607
351 Ga0439434_0054673 3300042435 Bacteria 1242
352 Ga0439460_0105722 3300042461 Bacteria 909
353 Ga0450918_006605 3300042531 Bacteria 2063
354 Ga0450893_0000888 3300042532 Bacteria 4451
355 Ga0451577_0000126 3300042876 Bacteria 168037
356 Ga0453683_0002304 3300044673 Bacteria 15012
357 Ga0466965_0138070 3300044683 Bacteria 1267
358 Ga0466965_0203262 3300044683 Bacteria 1051
359 Ga0453684_0000365 3300044712 Bacteria 186233
360 Ga0466957_0116997 3300044842 Bacteria 1696
361 Ga0451576_0000627 3300045051 Bacteria 73597
362 Ga0451576_0010523 3300045051 Bacteria 10601
363 Ga0466958_0140504 3300045836 Bacteria 1520
364 Ga0466967_0343491 3300045976 Bacteria 1444
365 Ga0495627_016550 3300046453 Bacteria 2522
366 Ga0495603_0323269 3300046455 Bacteria 886
367 Ga0495629_0052506 3300046459 Bacteria 2853
368 Ga0495638_0007988 3300046460 Bacteria 7544
369 Ga0495650_0074468 3300046471 Bacteria 1324
370 Ga0495582_0225904 3300046473 Bacteria 1072
371 Ga0495639_0020378 3300046475 Bacteria 2898
372 Ga0495606_0086649 3300046507 Bacteria 1935
373 Ga0495610_0076966 3300046512 Bacteria 1542
374 Ga0495616_0002323 3300046513 Bacteria 12711
375 Ga0495620_0029804 3300046515 Bacteria 2520
376 Ga0495631_0000679 3300046518 Bacteria 21953
377 Ga0495637_0001068 3300046520 Bacteria 17095
378 Ga0495637_0018186 3300046520 Bacteria 3263
379 Ga0495637_0123113 3300046520 Bacteria 996
380 Ga0495642_0010339 3300046528 Bacteria 3573
381 Ga0495654_0000909 3300046530 Bacteria 21993
382 Ga0495654_0007122 3300046530 Bacteria 6286
383 Ga0495622_0012599 3300046557 Bacteria 3918
384 Ga0495633_0168450 3300046558 Bacteria 1010
385 Ga0495656_0005927 3300046615 Bacteria 4253
386 Ga0495656_0028934 3300046615 Bacteria 2227
387 Ga0495656_0049894 3300046615 Bacteria 1784
388 Ga0495625_0000098 3300046660 Bacteria 140987
389 Ga0495625_0015934 3300046660 Bacteria 5931
390 Ga0495625_0212235 3300046660 Bacteria 1272
391 Ga0495635_0065630 3300046663 Bacteria 2490
392 Ga0495635_0304796 3300046663 Bacteria 1068
393 Ga0495659_0058087 3300046664 Bacteria 1423
394 Ga0495659_0142790 3300046664 Bacteria 957
395 Ga0495588_0031957 3300046674 Bacteria 2652
396 Ga0495657_0249182 3300046675 Bacteria 1070
397 Ga0495670_0036585 3300046691 Bacteria 2446
398 Ga0495670_0038758 3300046691 Bacteria 2376
399 Ga0495670_0103986 3300046691 Bacteria 1465
400 Ga0495671_0009116 3300046692 Bacteria 5559
401 Ga0495581_0211936 3300047315 Bacteria 1133
402 Ga0495676_0001400 3300047321 Bacteria 20759
403 Ga0495685_066479 3300047447 Bacteria 1211
404 Ga0495593_0003354 3300047673 Bacteria 9597
405 Ga0495593_0067544 3300047673 Bacteria 1861
406 Ga0495602_0186568 3300048088 Bacteria 1594
407 Ga0495614_0001715 3300048089 Bacteria 9573
408 Ga0495615_0003015 3300048090 Bacteria 2778
409 Ga0495615_0005097 3300048090 Bacteria 2341
410 Ga0496101_0010883 3300048904 Bacteria 6020
411 Ga0496102_0049837 3300048905 Bacteria 3811
412 Ga0496104_0138076 3300048907 Bacteria 2342
413 Ga0496105_0012757 3300048908 Bacteria 6657
414 Ga0496107_0464541 3300048910 Bacteria 940
415 Ga0496110_0065223 3300048913 Bacteria 3219
416 Ga0496110_0399777 3300048913 Bacteria 1252
417 Ga0496110_0597546 3300048913 Bacteria 1001
418 Ga0496110_0703388 3300048913 Bacteria 912
419 Ga0496114_0193218 3300048917 Bacteria 1781
420 Ga0496116_0028046 3300048919 Bacteria 4087
421 Ga0496117_0213039 3300048920 Bacteria 1081
422 Ga0496118_0026481 3300048921 Bacteria 4938
423 Ga0496118_0044737 3300048921 Bacteria 3463
424 Ga0496121_0105370 3300048924 Bacteria 2164
425 Ga0496122_0000080 3300048925 Bacteria 212397
426 Ga0496123_0000631 3300048926 Bacteria 58934
427 Ga0496123_0130993 3300048926 Bacteria 1389
428 Ga0496124_0100144 3300048927 Bacteria 2349
429 Ga0496124_0106279 3300048927 Bacteria 2266
430 Ga0496124_0224604 3300048927 Bacteria 1409
431 Ga0496125_0008757 3300048928 Bacteria 10525
432 Ga0496125_0015576 3300048928 Bacteria 7342
433 Ga0496126_0107296 3300048929 Bacteria 2435
434 Ga0496126_0321623 3300048929 Bacteria 1271
435 Ga0501034_0227855 3300049571 Bacteria 1814
436 Ga0501249_020755 3300049679 Bacteria 1430
437 Ga0501262_000116 3300049759 Bacteria 9845
438 Ga0501270_031972 3300049767 Bacteria 873
439 nmdc:mga03683_1476_c1 3300050489 Bacteria 7023
440 nmdc:mga03683_18940_c2 3300050489 Bacteria 1952
441 nmdc:mga03683_44441_c2 3300050489 Bacteria 1420
442 nmdc:mga03683_7393_c1 3300050489 Bacteria 3814
443 nmdc:mga03683_74865_c1 3300050489 Bacteria 1453
444 nmdc:mga03n38_126312_c1 3300050490 Bacteria 1263
445 nmdc:mga03n38_165153_c1 3300050490 Bacteria 1124
446 nmdc:mga03n38_188539_c1 3300050490 Bacteria 1061
447 nmdc:mga03n38_31406_c2 3300050490 Bacteria 1826
448 nmdc:mga03n38_61059_c1 3300050490 Bacteria 1716
449 nmdc:mga00v17_157080_c1 3300050491 Bacteria 1463
450 nmdc:mga00v17_80035_c1 3300050491 Bacteria 2038
451 nmdc:mga0yw44_1400_c1 3300050492 Bacteria 9560
452 nmdc:mga0yw44_57655_c1 3300050492 Bacteria 2370
453 nmdc:mga0yw44_94999_c1 3300050492 Bacteria 1890
454 nmdc:mga0k408_15372_c1 3300050493 Bacteria 4232
455 nmdc:mga0k408_16996_c1 3300050493 Bacteria 4044
456 nmdc:mga0k408_193265_c1 3300050493 Bacteria 1214
457 nmdc:mga0k408_29412_c1 3300050493 Bacteria 3127
458 nmdc:mga0k408_9405_c1 3300050493 Bacteria 5267
459 nmdc:mga06z11_59283_c1 3300050494 Bacteria 1989
460 nmdc:mga06z11_99955_c1 3300050494 Bacteria 1590
461 nmdc:mga07m45_147851_c1 3300050496 Bacteria 1362
462 nmdc:mga07m45_19648_c1 3300050496 Bacteria 3662
463 nmdc:mga07m45_3572_c1 3300050496 Bacteria 7515
464 nmdc:mga07m45_9389_c1 3300050496 Bacteria 5073
465 nmdc:mga09592_581888_c1 3300050508 Bacteria 960
466 nmdc:mga0qj67_83096_c1 3300050509 Bacteria 2567
467 Ga0500610_0000694 3300053079 Bacteria 10436
468 Ga0500610_0002108 3300053079 Bacteria 7168
469 Ga0500651_0000862 3300053093 Bacteria 14842
470 Ga0500566_0035449 3300053094 Bacteria 2899
471 Ga0500641_0134154 3300053096 Bacteria 1069
472 Ga0500562_005628 3300053108 Bacteria 3153
473 Ga0500562_082388 3300053108 Bacteria 871
474 Ga0500571_000042 3300053110 Bacteria 39585
475 Ga0500593_000547 3300053117 Bacteria 14603
476 Ga0500594_0001772 3300053118 Bacteria 4691
477 Ga0500594_0052550 3300053118 Bacteria 1152
478 Ga0500607_002165 3300053121 Bacteria 16337
479 Ga0500608_039584 3300053122 Bacteria 2257
480 Ga0500626_036500 3300053128 Bacteria 2222
481 Ga0500655_000520 3300053133 Bacteria 7747
482 Ga0500658_0000985 3300053134 Bacteria 11629
483 Ga0500658_0001132 3300053134 Bacteria 10894
484 Ga0500559_0001639 3300053136 Bacteria 12401
485 Ga0500559_0009718 3300053136 Bacteria 4151
486 Ga0500559_0027889 3300053136 Bacteria 2411
487 Ga0500564_016259 3300053138 Bacteria 3367
488 Ga0500568_0008057 3300053139 Bacteria 5114
489 Ga0500573_0056900 3300053140 Bacteria 2245
490 Ga0500574_000109 3300053141 Bacteria 9002
491 Ga0500616_0060765 3300053153 Bacteria 1958
492 Ga0500616_0083506 3300053153 Bacteria 1599
493 Ga0500627_0026962 3300053158 Bacteria 2375
494 Ga0500634_0029268 3300053161 Bacteria 3002
495 Ga0500638_011914 3300053162 Bacteria 3879
496 Ga0500636_0033140 3300053177 Bacteria 3060
497 Ga0500596_011814 3300053735 Bacteria 1332
498 Ga0590075_013464 3300059424 Bacteria 1995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046663 Ga0495635_0304796 Ga0495635_0304796_10_639 174
2 3300053108 Ga0500562_082388 Ga0500562_082388_11_640 187
3 3300042116 Ga0450912_007252 Ga0450912_007252_20_661 189
4 3300049767 Ga0501270_031972 Ga0501270_031972_217_855 190
5 3300005334 Ga0068869_100099186 Ga0068869_1000991862 191
6 3300041997 Ga0439431_0074555 Ga0439431_0074555_18_662 191
7 3300042435 Ga0439434_0031718 Ga0439434_0031718_13_657 192
8 3300046512 Ga0495610_0076966 Ga0495610_0076966_11_655 192
9 3300050493 nmdc:mga0k408_193265_c1 nmdc:mga0k408_193265_c1_551_1195 192
10 3300005338 Ga0068868_100139634 Ga0068868_1001396343 196
11 3300025925 Ga0207650_10494589 Ga0207650_104945892 197
12 3300005338 Ga0068868_100011378 Ga0068868_1000113787 198
13 3300037471 Ga0395905_0381479 Ga0395905_0381479_11_682 201
14 3300037471 Ga0395905_0498731 Ga0395905_0498731_424_1101 201
15 3300042000 Ga0439437_009544 Ga0439437_009544_250_927 201
16 3300044683 Ga0466965_0203262 Ga0466965_0203262_360_1037 201
17 3300048913 Ga0496110_0703388 Ga0496110_0703388_154_837 201
18 3300038443 Ga0395901_0467228 Ga0395901_0467228_10_687 203
19 3300005844 Ga0068862_100043607 Ga0068862_1000436075 204
20 3300028380 Ga0268265_10184106 Ga0268265_101841062 204
21 3300005353 Ga0070669_100532223 Ga0070669_1005322231 205
22 3300046528 Ga0495642_0010339 Ga0495642_0010339_221_952 205
23 3300046615 Ga0495656_0005927 Ga0495656_0005927_751_1482 205
24 3300046664 Ga0495659_0142790 Ga0495659_0142790_112_843 205
25 3300047447 Ga0495685_066479 Ga0495685_066479_310_1041 205
26 3300042876 Ga0451577_0000126 Ga0451577_0000126_40669_41418 206
27 3300044712 Ga0453684_0000365 Ga0453684_0000365_47994_48743 206
28 3300045051 Ga0451576_0000627 Ga0451576_0000627_41669_42418 206
29 3300031456 Ga0307513_10088941 Ga0307513_100889413 207
30 3300045976 Ga0466967_0343491 Ga0466967_0343491_721_1410 207
31 3300028794 Ga0307515_10120145 Ga0307515_101201452 208
32 3300053108 Ga0500562_005628 Ga0500562_005628_1554_2291 208
33 3300006038 Ga0075365_10024318 Ga0075365_100243185 209
34 3300006177 Ga0075362_10013922 Ga0075362_100139223 209
35 3300006178 Ga0075367_10006554 Ga0075367_100065545 209
36 3300006195 Ga0075366_10048552 Ga0075366_100485523 209
37 3300006353 Ga0075370_10009245 Ga0075370_100092454 209
38 3300050489 nmdc:mga03683_18940_c2 nmdc:mga03683_18940_c2_797_1537 209
39 3300050490 nmdc:mga03n38_61059_c1 nmdc:mga03n38_61059_c1_139_879 209
40 3300050493 nmdc:mga0k408_29412_c1 nmdc:mga0k408_29412_c1_1711_2451 209
41 3300050496 nmdc:mga07m45_9389_c1 nmdc:mga07m45_9389_c1_495_1235 209
42 3300009098 Ga0105245_10149712 Ga0105245_101497122 210
43 3300014969 Ga0157376_10010561 Ga0157376_100105617 210
44 3300025942 Ga0207689_10047691 Ga0207689_100476913 210
45 3300028794 Ga0307515_10004298 Ga0307515_100042987 210
46 3300031456 Ga0307513_10013418 Ga0307513_100134184 210
47 3300031649 Ga0307514_10000772 Ga0307514_100007727 210
48 3300053153 Ga0500616_0060765 Ga0500616_0060765_242_979 210
49 3300005354 Ga0070675_100498775 Ga0070675_1004987752 211
50 3300014968 Ga0157379_10144708 Ga0157379_101447083 211
51 3300017792 Ga0163161_10498588 Ga0163161_104985882 211
52 3300025941 Ga0207711_10250274 Ga0207711_102502742 211
53 3300026095 Ga0207676_10824929 Ga0207676_108249292 211
54 3300046615 Ga0495656_0028934 Ga0495656_0028934_204_944 211
55 3300046675 Ga0495657_0249182 Ga0495657_0249182_223_963 211
56 3300048904 Ga0496101_0010883 Ga0496101_0010883_1215_1955 211
57 3300048907 Ga0496104_0138076 Ga0496104_0138076_1267_2007 211
58 3300048908 Ga0496105_0012757 Ga0496105_0012757_330_1070 211
59 3300048917 Ga0496114_0193218 Ga0496114_0193218_23_763 211
60 3300031251 Ga0265327_10027984 Ga0265327_100279845 212
61 3300049571 Ga0501034_0227855 Ga0501034_0227855_324_1064 212
62 3300006042 Ga0075368_10017282 Ga0075368_100172823 213
63 3300006178 Ga0075367_10025570 Ga0075367_100255702 213
64 3300006195 Ga0075366_10008631 Ga0075366_100086313 213
65 3300050489 nmdc:mga03683_44441_c2 nmdc:mga03683_44441_c2_191_925 213
66 3300050490 nmdc:mga03n38_188539_c1 nmdc:mga03n38_188539_c1_137_871 213
67 3300050492 nmdc:mga0yw44_57655_c1 nmdc:mga0yw44_57655_c1_572_1306 213
68 3300050494 nmdc:mga06z11_99955_c1 nmdc:mga06z11_99955_c1_483_1217 213
69 3300005456 Ga0070678_100142658 Ga0070678_1001426582 214
70 3300006177 Ga0075362_10032046 Ga0075362_100320463 214
71 3300006195 Ga0075366_10001688 Ga0075366_100016887 214
72 3300013104 Ga0157370_10294061 Ga0157370_102940612 214
73 3300014969 Ga0157376_10924375 Ga0157376_109243752 214
74 3300015262 Ga0182007_10001107 Ga0182007_100011078 214
75 3300015265 Ga0182005_1011669 Ga0182005_10116692 214
76 3300025931 Ga0207644_10111340 Ga0207644_101113402 214
77 3300035691 Ga0373931_0092613 Ga0373931_0092613_184_918 214
78 3300044842 Ga0466957_0116997 Ga0466957_0116997_829_1563 214
79 3300046455 Ga0495603_0323269 Ga0495603_0323269_29_769 214
80 3300046459 Ga0495629_0052506 Ga0495629_0052506_439_1179 214
81 3300046473 Ga0495582_0225904 Ga0495582_0225904_279_1019 214
82 3300046475 Ga0495639_0020378 Ga0495639_0020378_363_1103 214
83 3300046674 Ga0495588_0031957 Ga0495588_0031957_405_1145 214
84 3300047315 Ga0495581_0211936 Ga0495581_0211936_246_986 214
85 3300047673 Ga0495593_0067544 Ga0495593_0067544_504_1244 214
86 3300048913 Ga0496110_0065223 Ga0496110_0065223_558_1298 214
87 3300048913 Ga0496110_0399777 Ga0496110_0399777_271_1011 214
88 3300050493 nmdc:mga0k408_9405_c1 nmdc:mga0k408_9405_c1_2231_2965 214
89 3300025911 Ga0207654_10466527 Ga0207654_104665271 215
90 3300026023 Ga0207677_10110057 Ga0207677_101100573 215
91 3300037471 Ga0395905_0034752 Ga0395905_0034752_3411_4145 215
92 3300045836 Ga0466958_0140504 Ga0466958_0140504_226_960 215
93 3300042461 Ga0439460_0105722 Ga0439460_0105722_52_789 216
94 3300046660 Ga0495625_0212235 Ga0495625_0212235_405_1148 216
95 3300026023 Ga0207677_10009823 Ga0207677_100098232 217
96 3300028794 Ga0307515_10371366 Ga0307515_103713662 217
97 3300031901 Ga0307406_10521267 Ga0307406_105212671 217
98 3300048090 Ga0495615_0003015 Ga0495615_0003015_398_1135 217
99 iso_pu_bacteria 2881101125 2881104366 217
100 3300005563 Ga0068855_100635599 Ga0068855_1006355992 218
101 3300006353 Ga0075370_10063588 Ga0075370_100635882 218
102 3300006880 Ga0075429_100838917 Ga0075429_1008389171 218
103 3300017792 Ga0163161_10012800 Ga0163161_100128003 218
104 3300031242 Ga0265329_10012048 Ga0265329_100120483 218
105 3300031250 Ga0265331_10020278 Ga0265331_100202782 218
106 3300031344 Ga0265316_10456368 Ga0265316_104563681 218
107 3300031548 Ga0307408_100169221 Ga0307408_1001692212 218
108 3300031711 Ga0265314_10000882 Ga0265314_1000088210 218
109 3300032002 Ga0307416_100220004 Ga0307416_1002200042 218
110 3300041406 Ga0439439_0106375 Ga0439439_0106375_19_759 218
111 3300042007 Ga0439449_0000210 Ga0439449_0000210_5476_6216 218
112 3300042015 Ga0439462_0005556 Ga0439462_0005556_862_1602 218
113 3300042144 Ga0450889_009590 Ga0450889_009590_178_915 218
114 3300042157 Ga0439458_0017242 Ga0439458_0017242_567_1304 218
115 3300042435 Ga0439434_0054673 Ga0439434_0054673_310_1050 218
116 3300050508 nmdc:mga09592_581888_c1 nmdc:mga09592_581888_c1_177_914 218
117 3300028786 Ga0307517_10161063 Ga0307517_101610633 219
118 3300037471 Ga0395905_0387691 Ga0395905_0387691_173_907 219
119 iso_pu_bacteria 2842733646 2842738643 219
120 iso_pu_bacteria 2842747753 2842750144 219
121 3300006177 Ga0075362_10060598 Ga0075362_100605982 220
122 3300032004 Ga0307414_10061691 Ga0307414_100616914 220
123 3300032005 Ga0307411_10033019 Ga0307411_100330193 220
124 3300037418 Ga0395900_0003054 Ga0395900_0003054_15297_16031 220
125 3300037466 Ga0395898_0014885 Ga0395898_0014885_3591_4325 220
126 3300037471 Ga0395905_0000047 Ga0395905_0000047_232886_233620 220
127 iso_pu_bacteria 2513020051 2513227044 220
128 iso_pu_bacteria 2599185214 2599621773 220
129 iso_pu_bacteria 2599185226 2599670543 220
130 iso_pu_bacteria 2599185227 2599679033 220
131 iso_pu_bacteria 2599185229 2599691284 220
132 iso_pu_bacteria 2643221628 2644163705 220
133 iso_pu_bacteria 2643221658 2644327061 220
134 iso_pu_bacteria 2643221672 2644398864 220
135 iso_pu_bacteria 2643221683 2644466547 220
136 iso_pu_bacteria 2738541277 2738721836 220
137 iso_pu_bacteria 2738541307 2738882010 220
138 iso_pu_bacteria 2738543013 2739247812 220
139 iso_pu_bacteria 2738543019 2739282200 220
140 iso_pu_bacteria 2818991446 2819597942 220
141 iso_pu_bacteria 2831265667 2831268930 220
142 iso_pu_bacteria 2838054893 2838058358 220
143 iso_pu_bacteria 2842677519 2842678276 220
144 iso_pu_bacteria 2885192300 2885194362 220
145 iso_pu_bacteria 2885198086 2885203901 220
146 iso_pu_bacteria 2885211737 2885217764 220
147 iso_pu_bacteria 2899924645 2899929361 220
148 iso_pu_bacteria 2904449895 2904451141 220
149 iso_pu_bacteria 2904456579 2904457995 220
150 iso_pu_bacteria 2904541872 2904546740 220
151 iso_pu_bacteria 2919462493 2919465653 220
152 iso_pu_bacteria 2928037797 2928040195 220
153 iso_pu_bacteria 2928044640 2928047056 220
154 iso_pu_bacteria 2928051484 2928057740 220
155 iso_pu_bacteria 2928064002 2928067878 220
156 iso_pu_bacteria 2928070936 2928072441 220
157 iso_pu_bacteria 2928084124 2928085640 220
158 iso_pu_bacteria 2928115317 2928119996 220
159 iso_pu_bacteria 2929160207 2929166190 220
160 iso_pu_bacteria 2929520902 2929526390 220
161 iso_pu_bacteria 2945909444 2945915036 220
162 iso_pu_bacteria 2945945610 2945950942 220
163 iso_pu_bacteria 2945972063 2945974420 220
164 iso_pu_bacteria 2945984333 2945989559 220
165 iso_pu_bacteria 2954767861 2954769661 220
166 3300028379 Ga0268266_10197124 Ga0268266_101971242 221
167 3300030731 Ga0316177_1083882 Ga0316177_10838823 221
168 3300030732 Ga0316176_1202874 Ga0316176_12028742 221
169 3300030733 Ga0314311_1037987 Ga0314311_10379875 221
170 3300030735 Ga0316178_1108730 Ga0316178_11087301 221
171 3300030736 Ga0316180_1109965 Ga0316180_11099652 221
172 3300030744 Ga0316181_1212719 Ga0316181_12127192 221
173 3300030745 Ga0316182_1186063 Ga0316182_11860632 221
174 3300031548 Ga0307408_100053312 Ga0307408_1000533123 221
175 3300031731 Ga0307405_10437433 Ga0307405_104374331 221
176 3300031901 Ga0307406_10192655 Ga0307406_101926552 221
177 3300031911 Ga0307412_10043403 Ga0307412_100434031 221
178 3300037471 Ga0395905_0015479 Ga0395905_0015479_2513_3247 221
179 3300042127 Ga0450890_009796 Ga0450890_009796_421_1161 221
180 3300049679 Ga0501249_020755 Ga0501249_020755_78_818 221
181 3300050490 nmdc:mga03n38_31406_c2 nmdc:mga03n38_31406_c2_119_850 221
182 iso_pu_bacteria 2904479285 2904481302 221
183 3300003578 Ga0006562J51391_1044441 Ga0006562J51391_10444414 222
184 3300003578 Ga0006562J51391_1044445 Ga0006562J51391_10444454 222
185 3300006844 Ga0075428_100603345 Ga0075428_1006033452 222
186 3300006846 Ga0075430_100103531 Ga0075430_1001035312 222
187 3300031712 Ga0265342_10058236 Ga0265342_100582363 222
188 3300037312 Ga0395899_0011048 Ga0395899_0011048_1908_2642 222
189 3300037418 Ga0395900_0022521 Ga0395900_0022521_5010_5744 222
190 3300037418 Ga0395900_0290980 Ga0395900_0290980_16_750 222
191 3300037466 Ga0395898_0094084 Ga0395898_0094084_574_1308 222
192 3300037471 Ga0395905_0010034 Ga0395905_0010034_3708_4442 222
193 3300037471 Ga0395905_0029288 Ga0395905_0029288_543_1277 222
194 3300037471 Ga0395905_0228821 Ga0395905_0228821_314_1048 222
195 3300038443 Ga0395901_0147058 Ga0395901_0147058_702_1436 222
196 3300038443 Ga0395901_0151089 Ga0395901_0151089_270_1004 222
197 3300041997 Ga0439431_0075942 Ga0439431_0075942_101_838 222
198 3300042118 Ga0450914_003288 Ga0450914_003288_17_751 222
199 3300042125 Ga0450923_032913 Ga0450923_032913_161_898 222
200 3300042435 Ga0439434_0022335 Ga0439434_0022335_427_1164 222
201 3300044673 Ga0453683_0002304 Ga0453683_0002304_9681_10418 222
202 3300045051 Ga0451576_0010523 Ga0451576_0010523_8993_9730 222
203 3300046530 Ga0495654_0000909 Ga0495654_0000909_771_1517 222
204 3300050509 nmdc:mga0qj67_83096_c1 nmdc:mga0qj67_83096_c1_922_1659 222
205 3300003773 Ga0055537_1000508 Ga0055537_100050811 223
206 3300003784 Ga0055534_1000461 Ga0055534_100046113 223
207 3300003790 Ga0055528_1000810 Ga0055528_100081010 223
208 3300003792 Ga0055540_1002716 Ga0055540_10027167 223
209 3300005289 Ga0065704_10201910 Ga0065704_102019102 223
210 3300005327 Ga0070658_10630540 Ga0070658_106305401 223
211 3300005459 Ga0068867_100404915 Ga0068867_1004049152 223
212 3300005617 Ga0068859_100253883 Ga0068859_1002538833 223
213 3300006038 Ga0075365_10152521 Ga0075365_101525212 223
214 3300006042 Ga0075368_10015087 Ga0075368_100150872 223
215 3300006048 Ga0075363_100048564 Ga0075363_1000485642 223
216 3300006048 Ga0075363_100181681 Ga0075363_1001816812 223
217 3300006051 Ga0075364_10312209 Ga0075364_103122092 223
218 3300006058 Ga0075432_10022631 Ga0075432_100226312 223
219 3300006177 Ga0075362_10069063 Ga0075362_100690632 223
220 3300006186 Ga0075369_10012649 Ga0075369_100126492 223
221 3300006931 Ga0097620_100253889 Ga0097620_1002538893 223
222 3300006948 Ga0099826_10004376 Ga0099826_100043762 223
223 3300014497 Ga0182008_10001489 Ga0182008_1000148910 223
224 3300017792 Ga0163161_10058786 Ga0163161_100587863 223
225 3300025263 Ga0209565_1000616 Ga0209565_100061613 223
226 3300025273 Ga0209673_1000193 Ga0209673_100019311 223
227 3300025273 Ga0209673_1001755 Ga0209673_10017559 223
228 3300025291 Ga0209675_1000220 Ga0209675_100022011 223
229 3300025303 Ga0209051_1000891 Ga0209051_100089114 223
230 3300025923 Ga0207681_10002834 Ga0207681_100028346 223
231 3300026089 Ga0207648_10343906 Ga0207648_103439062 223
232 3300027666 Ga0209282_1000107 Ga0209282_100010716 223
233 3300030745 Ga0316182_1134875 Ga0316182_11348753 223
234 3300031731 Ga0307405_10656348 Ga0307405_106563481 223
235 3300031901 Ga0307406_10001194 Ga0307406_100011942 223
236 3300031903 Ga0307407_10165264 Ga0307407_101652642 223
237 3300031903 Ga0307407_10234569 Ga0307407_102345691 223
238 3300032004 Ga0307414_10497982 Ga0307414_104979822 223
239 3300037418 Ga0395900_0092706 Ga0395900_0092706_1766_2503 223
240 3300037466 Ga0395898_0703598 Ga0395898_0703598_201_938 223
241 3300041411 Ga0439466_0003081 Ga0439466_0003081_1083_1823 223
242 3300042145 Ga0450906_003775 Ga0450906_003775_573_1313 223
243 3300042184 Ga0450908_017148 Ga0450908_017148_461_1201 223
244 3300042435 Ga0439434_0007659 Ga0439434_0007659_2326_3066 223
245 3300042531 Ga0450918_006605 Ga0450918_006605_556_1296 223
246 3300046660 Ga0495625_0000098 Ga0495625_0000098_40399_41139 223
247 3300048925 Ga0496122_0000080 Ga0496122_0000080_9531_10268 223
248 3300048926 Ga0496123_0000631 Ga0496123_0000631_3599_4336 223
249 3300048927 Ga0496124_0100144 Ga0496124_0100144_842_1579 223
250 3300048928 Ga0496125_0008757 Ga0496125_0008757_328_1068 223
251 3300048929 Ga0496126_0107296 Ga0496126_0107296_895_1632 223
252 3300048929 Ga0496126_0321623 Ga0496126_0321623_139_879 223
253 3300050489 nmdc:mga03683_7393_c1 nmdc:mga03683_7393_c1_2482_3222 223
254 3300050489 nmdc:mga03683_74865_c1 nmdc:mga03683_74865_c1_203_943 223
255 3300050490 nmdc:mga03n38_126312_c1 nmdc:mga03n38_126312_c1_144_884 223
256 3300050490 nmdc:mga03n38_165153_c1 nmdc:mga03n38_165153_c1_119_859 223
257 3300050492 nmdc:mga0yw44_94999_c1 nmdc:mga0yw44_94999_c1_648_1385 223
258 3300053118 Ga0500594_0052550 Ga0500594_0052550_374_1111 223
259 3300053136 Ga0500559_0001639 Ga0500559_0001639_845_1582 223
260 3300053136 Ga0500559_0027889 Ga0500559_0027889_686_1423 223
261 3300053140 Ga0500573_0056900 Ga0500573_0056900_888_1625 223
262 3300059424 Ga0590075_013464 Ga0590075_013464_1165_1902 223
263 3300001979 JGI24740J21852_10059931 JGI24740J21852_100599312 224
264 3300001989 JGI24739J22299_10023093 JGI24739J22299_100230932 224
265 3300002773 JGI25152J39213_1004633 JGI25152J39213_10046332 224
266 3300002773 JGI25152J39213_1023786 JGI25152J39213_10237862 224
267 3300002774 JGI25150J39212_1000874 JGI25150J39212_10008748 224
268 3300002987 JGI25159J45721_1008148 JGI25159J45721_10081484 224
269 3300003187 JGI25151J46595_10001246 JGI25151J46595_100012466 224
270 3300003187 JGI25151J46595_10001606 JGI25151J46595_100016068 224
271 3300003187 JGI25151J46595_10003299 JGI25151J46595_100032992 224
272 3300003187 JGI25151J46595_10007260 JGI25151J46595_100072604 224
273 3300003187 JGI25151J46595_10072238 JGI25151J46595_100722382 224
274 3300003215 JGI25153J46596_10010204 JGI25153J46596_100102042 224
275 3300003215 JGI25153J46596_10059982 JGI25153J46596_100599822 224
276 3300003316 rootH1_10097023 rootH1_100970232 224
277 3300003320 rootH2_10178126 rootH2_101781261 224
278 3300003354 JGI25160J50197_1007473 JGI25160J50197_10074732 224
279 3300003354 JGI25160J50197_1007479 JGI25160J50197_10074792 224
280 3300003374 JGI25161J50226_1002863 JGI25161J50226_10028635 224
281 3300003374 JGI25161J50226_1002870 JGI25161J50226_10028702 224
282 3300003578 Ga0006562J51391_1039181 Ga0006562J51391_10391811 224
283 3300003761 Ga0055535_1000552 Ga0055535_100055218 224
284 3300003762 Ga0055542_1000003 Ga0055542_1000003133 224
285 3300003771 Ga0055526_1010589 Ga0055526_10105892 224
286 3300003771 Ga0055526_1010591 Ga0055526_10105912 224
287 3300003773 Ga0055537_1001509 Ga0055537_10015092 224
288 3300003775 Ga0055524_1008473 Ga0055524_10084732 224
289 3300003781 Ga0055536_1007479 Ga0055536_10074795 224
290 3300003781 Ga0055536_1010016 Ga0055536_10100163 224
291 3300003781 Ga0055536_1011023 Ga0055536_10110234 224
292 3300003781 Ga0055536_1029014 Ga0055536_10290142 224
293 3300003784 Ga0055534_1001223 Ga0055534_10012239 224
294 3300003784 Ga0055534_1001552 Ga0055534_10015522 224
295 3300003784 Ga0055534_1016674 Ga0055534_10166742 224
296 3300003790 Ga0055528_1002798 Ga0055528_10027982 224
297 3300003791 Ga0055530_10001076 Ga0055530_1000107620 224
298 3300003791 Ga0055530_10011406 Ga0055530_100114063 224
299 3300003792 Ga0055540_1002308 Ga0055540_10023083 224
300 3300003792 Ga0055540_1003718 Ga0055540_10037186 224
301 3300003792 Ga0055540_1008984 Ga0055540_10089844 224
302 3300003794 Ga0055531_10003339 Ga0055531_1000333910 224
303 3300003794 Ga0055531_10003705 Ga0055531_100037053 224
304 3300003794 Ga0055531_10007508 Ga0055531_100075083 224
305 3300004625 Ga0055543_1001369 Ga0055543_10013692 224
306 3300005262 Ga0065165_1009609 Ga0065165_10096092 224
307 3300005262 Ga0065165_1031297 Ga0065165_10312972 224
308 3300005262 Ga0065165_1080630 Ga0065165_10806301 224
309 3300005327 Ga0070658_10122467 Ga0070658_101224671 224
310 3300005339 Ga0070660_100253752 Ga0070660_1002537522 224
311 3300005353 Ga0070669_100139434 Ga0070669_1001394343 224
312 3300005354 Ga0070675_100511416 Ga0070675_1005114161 224
313 3300005356 Ga0070674_100111447 Ga0070674_1001114472 224
314 3300005456 Ga0070678_100129881 Ga0070678_1001298813 224
315 3300005456 Ga0070678_100186090 Ga0070678_1001860902 224
316 3300005457 Ga0070662_100025442 Ga0070662_1000254424 224
317 3300005539 Ga0068853_100042455 Ga0068853_1000424555 224
318 3300005539 Ga0068853_100201435 Ga0068853_1002014352 224
319 3300005539 Ga0068853_100278278 Ga0068853_1002782782 224
320 3300005563 Ga0068855_100106757 Ga0068855_1001067572 224
321 3300005564 Ga0070664_100053827 Ga0070664_1000538275 224
322 3300005578 Ga0068854_100262601 Ga0068854_1002626012 224
323 3300005616 Ga0068852_100090555 Ga0068852_1000905552 224
324 3300005616 Ga0068852_100206716 Ga0068852_1002067163 224
325 3300006038 Ga0075365_10005042 Ga0075365_100050428 224
326 3300006051 Ga0075364_10086451 Ga0075364_100864513 224
327 3300006177 Ga0075362_10006208 Ga0075362_100062083 224
328 3300006178 Ga0075367_10044382 Ga0075367_100443823 224
329 3300006178 Ga0075367_10141402 Ga0075367_101414022 224
330 3300006195 Ga0075366_10019528 Ga0075366_100195285 224
331 3300006195 Ga0075366_10025504 Ga0075366_100255043 224
332 3300006353 Ga0075370_10021732 Ga0075370_100217322 224
333 3300006353 Ga0075370_10024949 Ga0075370_100249495 224
334 3300006353 Ga0075370_10047266 Ga0075370_100472662 224
335 3300006353 Ga0075370_10247384 Ga0075370_102473842 224
336 3300009036 Ga0105244_10020518 Ga0105244_100205183 224
337 3300009148 Ga0105243_10009826 Ga0105243_100098262 224
338 3300009148 Ga0105243_10074383 Ga0105243_100743833 224
339 3300009176 Ga0105242_10109777 Ga0105242_101097772 224
340 3300010375 Ga0105239_10020029 Ga0105239_100200299 224
341 3300010375 Ga0105239_10229494 Ga0105239_102294943 224
342 3300011119 Ga0105246_10173739 Ga0105246_101737392 224
343 3300012502 Ga0157347_1003692 Ga0157347_10036922 224
344 3300013100 Ga0157373_10069551 Ga0157373_100695512 224
345 3300013102 Ga0157371_10035373 Ga0157371_100353732 224
346 3300013104 Ga0157370_10405033 Ga0157370_104050333 224
347 3300013105 Ga0157369_10069284 Ga0157369_100692843 224
348 3300013306 Ga0163162_10096868 Ga0163162_100968683 224
349 3300013307 Ga0157372_10112936 Ga0157372_101129362 224
350 3300013308 Ga0157375_10324994 Ga0157375_103249942 224
351 3300014497 Ga0182008_10008224 Ga0182008_100082243 224
352 3300015261 Ga0182006_1003670 Ga0182006_10036708 224
353 3300015683 Ga0183362_10004 Ga0183362_1000451 224
354 3300017792 Ga0163161_10001219 Ga0163161_1000121911 224
355 3300017792 Ga0163161_10007245 Ga0163161_100072454 224
356 3300025208 Ga0209436_104194 Ga0209436_1041942 224
357 3300025228 Ga0209672_100220 Ga0209672_10022031 224
358 3300025229 Ga0209147_101193 Ga0209147_1011938 224
359 3300025242 Ga0209258_100015 Ga0209258_100015252 224
360 3300025245 Ga0207425_1000532 Ga0207425_100053215 224
361 3300025245 Ga0207425_1001822 Ga0207425_10018224 224
362 3300025254 Ga0209148_1000028 Ga0209148_1000028417 224
363 3300025258 Ga0209129_1000049 Ga0209129_1000049255 224
364 3300025258 Ga0209129_1000850 Ga0209129_100085010 224
365 3300025258 Ga0209129_1001373 Ga0209129_10013734 224
366 3300025258 Ga0209129_1001720 Ga0209129_10017204 224
367 3300025263 Ga0209565_1001027 Ga0209565_10010277 224
368 3300025273 Ga0209673_1002433 Ga0209673_10024336 224
369 3300025273 Ga0209673_1003214 Ga0209673_100321410 224
370 3300025284 Ga0209130_1000738 Ga0209130_10007386 224
371 3300025284 Ga0209130_1001701 Ga0209130_100170110 224
372 3300025284 Ga0209130_1005270 Ga0209130_10052702 224
373 3300025291 Ga0209675_1000752 Ga0209675_10007522 224
374 3300025291 Ga0209675_1001562 Ga0209675_10015626 224
375 3300025291 Ga0209675_1001767 Ga0209675_100176710 224
376 3300025291 Ga0209675_1004908 Ga0209675_10049083 224
377 3300025292 Ga0209676_1000074 Ga0209676_1000074217 224
378 3300025292 Ga0209676_1000209 Ga0209676_1000209101 224
379 3300025292 Ga0209676_1001266 Ga0209676_100126610 224
380 3300025292 Ga0209676_1010843 Ga0209676_10108432 224
381 3300025292 Ga0209676_1018674 Ga0209676_10186743 224
382 3300025294 Ga0209025_1000283 Ga0209025_100028379 224
383 3300025294 Ga0209025_1001271 Ga0209025_100127115 224
384 3300025294 Ga0209025_1001535 Ga0209025_100153517 224
385 3300025294 Ga0209025_1038179 Ga0209025_10381792 224
386 3300025294 Ga0209025_1052920 Ga0209025_10529201 224
387 3300025295 Ga0209564_1001576 Ga0209564_100157613 224
388 3300025295 Ga0209564_1003788 Ga0209564_10037882 224
389 3300025297 Ga0209758_1003331 Ga0209758_100333110 224
390 3300025297 Ga0209758_1005924 Ga0209758_10059249 224
391 3300025298 Ga0209050_1000015 Ga0209050_1000015253 224
392 3300025298 Ga0209050_1004374 Ga0209050_10043748 224
393 3300025299 Ga0209256_1000264 Ga0209256_100026471 224
394 3300025299 Ga0209256_1000304 Ga0209256_100030472 224
395 3300025302 Ga0207426_1000108 Ga0207426_1000108159 224
396 3300025302 Ga0207426_1000130 Ga0207426_1000130140 224
397 3300025303 Ga0209051_1000010 Ga0209051_1000010253 224
398 3300025303 Ga0209051_1000156 Ga0209051_100015612 224
399 3300025303 Ga0209051_1000680 Ga0209051_100068021 224
400 3300025303 Ga0209051_1003579 Ga0209051_10035793 224
401 3300025304 Ga0209257_1000026 Ga0209257_1000026424 224
402 3300025304 Ga0209257_1000172 Ga0209257_100017266 224
403 3300025304 Ga0209257_1004242 Ga0209257_10042429 224
404 3300025304 Ga0209257_1006791 Ga0209257_10067916 224
405 3300025909 Ga0207705_10106744 Ga0207705_101067443 224
406 3300025914 Ga0207671_10046850 Ga0207671_100468502 224
407 3300025924 Ga0207694_10294592 Ga0207694_102945922 224
408 3300025933 Ga0207706_10010805 Ga0207706_100108056 224
409 3300025935 Ga0207709_10000881 Ga0207709_1000088110 224
410 3300025935 Ga0207709_10001518 Ga0207709_100015184 224
411 3300025935 Ga0207709_10008095 Ga0207709_100080955 224
412 3300025937 Ga0207669_10146544 Ga0207669_101465442 224
413 3300025940 Ga0207691_10065201 Ga0207691_100652014 224
414 3300025942 Ga0207689_10159225 Ga0207689_101592252 224
415 3300025945 Ga0207679_10069759 Ga0207679_100697594 224
416 3300025949 Ga0207667_10073365 Ga0207667_100733652 224
417 3300026041 Ga0207639_10009570 Ga0207639_100095706 224
418 3300026041 Ga0207639_10175451 Ga0207639_101754512 224
419 3300026067 Ga0207678_10052086 Ga0207678_100520862 224
420 3300026116 Ga0207674_10152108 Ga0207674_101521083 224
421 3300026121 Ga0207683_10330422 Ga0207683_103304222 224
422 3300026121 Ga0207683_10525010 Ga0207683_105250101 224
423 3300026142 Ga0207698_10116878 Ga0207698_101168783 224
424 3300026142 Ga0207698_10400768 Ga0207698_104007681 224
425 3300028794 Ga0307515_10000034 Ga0307515_10000034286 224
426 3300028794 Ga0307515_10141214 Ga0307515_101412141 224
427 3300030522 Ga0307512_10114925 Ga0307512_101149253 224
428 3300031251 Ga0265327_10002797 Ga0265327_1000279715 224
429 3300031456 Ga0307513_10119921 Ga0307513_101199213 224
430 3300031456 Ga0307513_10119937 Ga0307513_101199373 224
431 3300031731 Ga0307405_10094187 Ga0307405_100941872 224
432 3300031911 Ga0307412_10028681 Ga0307412_100286814 224
433 3300031911 Ga0307412_10303746 Ga0307412_103037462 224
434 3300032002 Ga0307416_100468615 Ga0307416_1004686152 224
435 3300032005 Ga0307411_10053422 Ga0307411_100534222 224
436 3300041404 Ga0439436_0015525 Ga0439436_0015525_545_1285 224
437 3300041404 Ga0439436_0045455 Ga0439436_0045455_264_1004 224
438 3300041406 Ga0439439_0004178 Ga0439439_0004178_391_1131 224
439 3300041406 Ga0439439_0035051 Ga0439439_0035051_504_1244 224
440 3300041407 Ga0439447_014070 Ga0439447_014070_824_1564 224
441 3300041411 Ga0439466_0003244 Ga0439466_0003244_2603_3343 224
442 3300041413 Ga0439465_0005171 Ga0439465_0005171_2946_3686 224
443 3300041997 Ga0439431_0019901 Ga0439431_0019901_543_1283 224
444 3300041997 Ga0439431_0022472 Ga0439431_0022472_550_1290 224
445 3300041997 Ga0439431_0053971 Ga0439431_0053971_209_949 224
446 3300041999 Ga0439433_0001455 Ga0439433_0001455_558_1298 224
447 3300042002 Ga0439442_013792 Ga0439442_013792_375_1115 224
448 3300042004 Ga0439445_0000788 Ga0439445_0000788_5748_6488 224
449 3300042004 Ga0439445_0011977 Ga0439445_0011977_832_1572 224
450 3300042006 Ga0439432_010623 Ga0439432_010623_694_1434 224
451 3300042006 Ga0439432_024551 Ga0439432_024551_448_1188 224
452 3300042007 Ga0439449_0003246 Ga0439449_0003246_920_1660 224
453 3300042007 Ga0439449_0016033 Ga0439449_0016033_18_758 224
454 3300042007 Ga0439449_0061502 Ga0439449_0061502_399_1139 224
455 3300042010 Ga0439452_008612 Ga0439452_008612_1032_1772 224
456 3300042010 Ga0439452_008815 Ga0439452_008815_1160_1900 224
457 3300042014 Ga0439457_004466 Ga0439457_004466_419_1159 224
458 3300042014 Ga0439457_026766 Ga0439457_026766_502_1242 224
459 3300042015 Ga0439462_0008644 Ga0439462_0008644_180_920 224
460 3300042115 Ga0450911_000650 Ga0450911_000650_8611_9351 224
461 3300042128 Ga0450897_003022 Ga0450897_003022_413_1153 224
462 3300042133 Ga0450896_027426 Ga0450896_027426_52_792 224
463 3300042145 Ga0450906_028898 Ga0450906_028898_152_892 224
464 3300042156 Ga0439446_0003074 Ga0439446_0003074_2148_2888 224
465 3300042184 Ga0450908_010424 Ga0450908_010424_489_1229 224
466 3300042435 Ga0439434_0006134 Ga0439434_0006134_338_1078 224
467 3300042532 Ga0450893_0000888 Ga0450893_0000888_1202_1942 224
468 3300044683 Ga0466965_0138070 Ga0466965_0138070_192_932 224
469 3300046453 Ga0495627_016550 Ga0495627_016550_1472_2212 224
470 3300046460 Ga0495638_0007988 Ga0495638_0007988_5967_6707 224
471 3300046471 Ga0495650_0074468 Ga0495650_0074468_165_905 224
472 3300046507 Ga0495606_0086649 Ga0495606_0086649_406_1146 224
473 3300046513 Ga0495616_0002323 Ga0495616_0002323_8626_9366 224
474 3300046515 Ga0495620_0029804 Ga0495620_0029804_856_1596 224
475 3300046518 Ga0495631_0000679 Ga0495631_0000679_13956_14696 224
476 3300046520 Ga0495637_0001068 Ga0495637_0001068_11482_12222 224
477 3300046520 Ga0495637_0018186 Ga0495637_0018186_608_1348 224
478 3300046520 Ga0495637_0123113 Ga0495637_0123113_237_977 224
479 3300046530 Ga0495654_0007122 Ga0495654_0007122_743_1483 224
480 3300046557 Ga0495622_0012599 Ga0495622_0012599_661_1401 224
481 3300046558 Ga0495633_0168450 Ga0495633_0168450_230_970 224
482 3300046615 Ga0495656_0049894 Ga0495656_0049894_757_1497 224
483 3300046660 Ga0495625_0015934 Ga0495625_0015934_331_1071 224
484 3300046663 Ga0495635_0065630 Ga0495635_0065630_1103_1843 224
485 3300046664 Ga0495659_0058087 Ga0495659_0058087_477_1217 224
486 3300046691 Ga0495670_0036585 Ga0495670_0036585_1626_2366 224
487 3300046691 Ga0495670_0038758 Ga0495670_0038758_1265_2005 224
488 3300046691 Ga0495670_0103986 Ga0495670_0103986_291_1031 224
489 3300046692 Ga0495671_0009116 Ga0495671_0009116_1330_2070 224
490 3300047321 Ga0495676_0001400 Ga0495676_0001400_12220_12960 224
491 3300047673 Ga0495593_0003354 Ga0495593_0003354_6546_7286 224
492 3300048088 Ga0495602_0186568 Ga0495602_0186568_559_1299 224
493 3300048089 Ga0495614_0001715 Ga0495614_0001715_2640_3380 224
494 3300048090 Ga0495615_0005097 Ga0495615_0005097_631_1371 224
495 3300048905 Ga0496102_0049837 Ga0496102_0049837_2744_3484 224
496 3300048910 Ga0496107_0464541 Ga0496107_0464541_92_832 224
497 3300048913 Ga0496110_0597546 Ga0496110_0597546_51_791 224
498 3300048919 Ga0496116_0028046 Ga0496116_0028046_1706_2446 224
499 3300048920 Ga0496117_0213039 Ga0496117_0213039_164_904 224
500 3300048921 Ga0496118_0026481 Ga0496118_0026481_1437_2177 224
501 3300048921 Ga0496118_0044737 Ga0496118_0044737_888_1628 224
502 3300048924 Ga0496121_0105370 Ga0496121_0105370_799_1539 224
503 3300048926 Ga0496123_0130993 Ga0496123_0130993_376_1116 224
504 3300048927 Ga0496124_0106279 Ga0496124_0106279_719_1459 224
505 3300048927 Ga0496124_0224604 Ga0496124_0224604_421_1161 224
506 3300048928 Ga0496125_0015576 Ga0496125_0015576_5786_6526 224
507 3300049759 Ga0501262_000116 Ga0501262_000116_265_1005 224
508 3300050489 nmdc:mga03683_1476_c1 nmdc:mga03683_1476_c1_3434_4174 224
509 3300050491 nmdc:mga00v17_157080_c1 nmdc:mga00v17_157080_c1_638_1387 224
510 3300050491 nmdc:mga00v17_80035_c1 nmdc:mga00v17_80035_c1_664_1404 224
511 3300050492 nmdc:mga0yw44_1400_c1 nmdc:mga0yw44_1400_c1_8693_9442 224
512 3300050493 nmdc:mga0k408_15372_c1 nmdc:mga0k408_15372_c1_1577_2317 224
513 3300050493 nmdc:mga0k408_16996_c1 nmdc:mga0k408_16996_c1_1669_2409 224
514 3300050494 nmdc:mga06z11_59283_c1 nmdc:mga06z11_59283_c1_1097_1837 224
515 3300050496 nmdc:mga07m45_147851_c1 nmdc:mga07m45_147851_c1_322_1062 224
516 3300050496 nmdc:mga07m45_19648_c1 nmdc:mga07m45_19648_c1_1889_2629 224
517 3300050496 nmdc:mga07m45_3572_c1 nmdc:mga07m45_3572_c1_1082_1822 224
518 3300053079 Ga0500610_0000694 Ga0500610_0000694_6475_7215 224
519 3300053079 Ga0500610_0002108 Ga0500610_0002108_3222_3962 224
520 3300053093 Ga0500651_0000862 Ga0500651_0000862_8767_9507 224
521 3300053094 Ga0500566_0035449 Ga0500566_0035449_56_796 224
522 3300053096 Ga0500641_0134154 Ga0500641_0134154_20_760 224
523 3300053110 Ga0500571_000042 Ga0500571_000042_8703_9443 224
524 3300053117 Ga0500593_000547 Ga0500593_000547_4543_5283 224
525 3300053118 Ga0500594_0001772 Ga0500594_0001772_3071_3811 224
526 3300053121 Ga0500607_002165 Ga0500607_002165_2675_3415 224
527 3300053122 Ga0500608_039584 Ga0500608_039584_876_1616 224
528 3300053128 Ga0500626_036500 Ga0500626_036500_715_1455 224
529 3300053133 Ga0500655_000520 Ga0500655_000520_6776_7516 224
530 3300053134 Ga0500658_0000985 Ga0500658_0000985_1295_2035 224
531 3300053134 Ga0500658_0001132 Ga0500658_0001132_9565_10305 224
532 3300053136 Ga0500559_0009718 Ga0500559_0009718_3205_3945 224
533 3300053138 Ga0500564_016259 Ga0500564_016259_2128_2868 224
534 3300053139 Ga0500568_0008057 Ga0500568_0008057_1542_2282 224
535 3300053141 Ga0500574_000109 Ga0500574_000109_7541_8281 224
536 3300053153 Ga0500616_0083506 Ga0500616_0083506_389_1129 224
537 3300053158 Ga0500627_0026962 Ga0500627_0026962_339_1079 224
538 3300053161 Ga0500634_0029268 Ga0500634_0029268_1707_2447 224
539 3300053162 Ga0500638_011914 Ga0500638_011914_1737_2477 224
540 3300053177 Ga0500636_0033140 Ga0500636_0033140_193_933 224
541 3300053735 Ga0500596_011814 Ga0500596_011814_518_1258 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03591

AzlC

AzlC protein

22

171

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.3232 22 189
6zdw-assembly1.cif.gz_AAA crystal structure of the ribonuclease core of r3b2 0.3104 87 167
4iu8-assembly1.cif.gz_A crystal structure of a membrane transporter (selenomethionine derivative) 0.3059 27 191
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.2926 5 193
3jbi-assembly1.cif.gz_V mdff model of the vinculin tail domain bound to f-actin 0.2919 13 168
ID Description Score Start End Superfamily
af_Q61983_14_231_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.39 4 190 1.20.1250.20
af_Q497L8_131_536_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3843 21 189 1.20.1250.20
af_A0A0B4KHM5_17_486_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3736 20 188 1.20.1250.20
af_A0A0P0Y6M3_45_473_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3646 17 187 1.20.1250.20
af_Q9W5H8_10_164_1.10.8.1310 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.3618 59 160 1.10.8.1310
ID Description Score Start End GO Terms
AF-A0A4Q3N7R6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8982 4 166 GO:0005886
GO:1903785
AF-A0A7Y1UPM9-F1-model_v4 AzlC family ABC transporter permease 0.8969 12 165 GO:0005886
GO:1903785
AF-A0A4Q3N7R6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8879 4 166 GO:0005886
GO:1903785
AF-A0A4Q3PW71-F1-model_v4 deleted 0.8667 24 154
AF-A0A259PMU6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8624 21 166 GO:0005886
GO:1903785

Feature Viewer

pLDDT pTM Quality
83.87 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map