F461336

General Info

Members Datasets Scaffolds Average Seq Length
541 252 1082 153

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100418563|Ga0068857_1004185631
Length 174
Sequence MSYDEEQARKSRVVVETPNERREVVHTQSVRDNSGISAGMVGVLVVVAIALITMLVLFWMNTQPTTDESAALNAQQQPTVIQQPAAGGSISSGSXXXSPSVTSANMDSTIQTAVDKRLADDPAFSTLGITASVLDGKVMLIGTVKTEALKADIERAVKQIKGVKQVDNQIIVSG

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
158 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
180 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
181 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
182 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
183 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
184 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
198 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
199 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
200 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
201 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
202 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
203 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
204 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
205 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
206 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
207 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
208 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
209 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
210 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
211 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
212 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
213 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
214 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
215 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
216 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
217 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
218 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
221 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
222 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
223 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
224 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
225 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
226 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
227 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
228 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
229 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
230 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
231 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
232 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
233 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
234 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
235 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.24
Metatranscriptomes 7.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.66
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 34.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100418563 3300005577 Bacteria 1249
2 CNAas_1000782 3300000532 Bacteria 3027
3 JGI24751J29686_10000099 3300002459 Bacteria 47837
4 JGI25406J46586_10031847 3300003203 Bacteria 1967
5 rootL2_10147728 3300003322 Bacteria 1551
6 rootL2_10275350 3300003322 Unclassified 1648
7 Ga0065714_10086485 3300005288 Unclassified 2099
8 Ga0065704_10117579 3300005289 Bacteria 1831
9 Ga0065712_10264966 3300005290 Bacteria 928
10 Ga0065715_10157711 3300005293 Bacteria 1660
11 Ga0065715_10204310 3300005293 Bacteria 1345
12 Ga0065715_10240127 3300005293 Unclassified 1202
13 Ga0065715_10257096 3300005293 Bacteria 1149
14 Ga0065707_10000953 3300005295 Bacteria 13029
15 Ga0065707_10249104 3300005295 Unclassified 1131
16 Ga0070670_100000297 3300005331 Bacteria 43678
17 Ga0070670_100092547 3300005331 Bacteria 2600
18 Ga0070670_100123522 3300005331 Bacteria 2234
19 Ga0070670_100579209 3300005331 Unclassified 1003
20 Ga0070670_100759766 3300005331 Bacteria 874
21 Ga0068869_100224013 3300005334 Unclassified 1492
22 Ga0068869_100509344 3300005334 Bacteria 1006
23 Ga0068869_100625393 3300005334 Unclassified 912
24 Ga0070680_100041292 3300005336 Bacteria 3740
25 Ga0070682_100000909 3300005337 Bacteria 17310
26 Ga0070682_100008627 3300005337 Bacteria 5756
27 Ga0070682_100102049 3300005337 Unclassified 1895
28 Ga0070689_100000425 3300005340 Bacteria 24906
29 Ga0070689_100051849 3300005340 Unclassified 3172
30 Ga0070689_100101425 3300005340 Unclassified 2278
31 Ga0070687_100025728 3300005343 Bacteria 2827
32 Ga0070687_100547394 3300005343 Unclassified 787
33 Ga0070692_10005197 3300005345 Bacteria 5517
34 Ga0070692_10008680 3300005345 Bacteria 4544
35 Ga0070692_10705093 3300005345 Unclassified 680
36 Ga0070669_100000225 3300005353 Bacteria 47273
37 Ga0070669_101030159 3300005353 Bacteria 707
38 Ga0070675_100980991 3300005354 Unclassified 776
39 Ga0070671_100262355 3300005355 Unclassified 1468
40 Ga0070671_100281571 3300005355 Unclassified 1414
41 Ga0070671_100958524 3300005355 Bacteria 749
42 Ga0070673_100104093 3300005364 Unclassified 2343
43 Ga0070673_100448959 3300005364 Bacteria 1160
44 Ga0070659_100696467 3300005366 Unclassified 878
45 Ga0070659_100950111 3300005366 Unclassified 753
46 Ga0070703_10005823 3300005406 Bacteria 3454
47 Ga0070701_10262762 3300005438 Bacteria 1047
48 Ga0070705_100104096 3300005440 Archaea 1799
49 Ga0070705_100604824 3300005440 Unclassified 848
50 Ga0070700_100049422 3300005441 Bacteria 2611
51 Ga0070700_100083336 3300005441 Bacteria 2070
52 Ga0070700_100133015 3300005441 Bacteria 1681
53 Ga0070700_100585337 3300005441 Unclassified 872
54 Ga0070694_100000781 3300005444 Bacteria 17791
55 Ga0070694_100035426 3300005444 Bacteria 3299
56 Ga0070694_100044415 3300005444 Bacteria 2973
57 Ga0070694_100148471 3300005444 Bacteria 1710
58 Ga0070694_100535998 3300005444 Unclassified 936
59 Ga0070662_100096486 3300005457 Unclassified 2230
60 Ga0070681_10145741 3300005458 Unclassified 2297
61 Ga0068867_100211854 3300005459 Bacteria 1556
62 Ga0068867_100386526 3300005459 Bacteria 1177
63 Ga0070706_100000146 3300005467 Bacteria 89818
64 Ga0070706_100065317 3300005467 Unclassified 3365
65 Ga0070707_100023345 3300005468 Bacteria 5852
66 Ga0070707_100584332 3300005468 Unclassified 1079
67 Ga0070707_100799546 3300005468 Bacteria 907
68 Ga0070698_100006997 3300005471 Bacteria 12213
69 Ga0070698_100028883 3300005471 Bacteria 5757
70 Ga0070698_100152967 3300005471 Bacteria 2253
71 Ga0070699_100006092 3300005518 Bacteria 10554
72 Ga0070699_100372988 3300005518 Bacteria 1287
73 Ga0070679_100302900 3300005530 Bacteria 1549
74 Ga0070679_100414081 3300005530 Unclassified 1293
75 Ga0070697_100014032 3300005536 Bacteria 6293
76 Ga0070697_100049396 3300005536 Bacteria 3415
77 Ga0068853_100101724 3300005539 Bacteria 2542
78 Ga0070686_100744645 3300005544 Bacteria 785
79 Ga0070695_100041890 3300005545 Bacteria 2904
80 Ga0070695_100063145 3300005545 Bacteria 2407
81 Ga0070695_100122242 3300005545 Bacteria 1783
82 Ga0070695_100448379 3300005545 Bacteria 988
83 Ga0070696_100053424 3300005546 Archaea 2813
84 Ga0070696_100075088 3300005546 Bacteria 2384
85 Ga0070696_100120372 3300005546 Bacteria 1899
86 Ga0070696_100254226 3300005546 Unclassified 1330
87 Ga0070696_100484283 3300005546 Bacteria 982
88 Ga0070693_100001960 3300005547 Bacteria 9423
89 Ga0070693_100006717 3300005547 Bacteria 5586
90 Ga0070693_100230147 3300005547 Bacteria 1219
91 Ga0070693_100262267 3300005547 Bacteria 1150
92 Ga0070665_101537663 3300005548 Unclassified 674
93 Ga0068855_100282162 3300005563 Bacteria 1844
94 Ga0070664_100614163 3300005564 Unclassified 1009
95 Ga0068857_100086592 3300005577 Unclassified 2801
96 Ga0068857_100125612 3300005577 Bacteria 2311
97 Ga0068857_100199444 3300005577 Bacteria 1824
98 Ga0068857_100418156 3300005577 Unclassified 1249
99 Ga0068857_100459062 3300005577 Bacteria 1192
100 Ga0068854_100998808 3300005578 Unclassified 741
101 Ga0068856_100213805 3300005614 Bacteria 1943
102 Ga0070702_100004099 3300005615 Bacteria 6613
103 Ga0070702_100048821 3300005615 Unclassified 2411
104 Ga0070702_100381115 3300005615 Bacteria 1003
105 Ga0070702_100445753 3300005615 Unclassified 938
106 Ga0070702_100499914 3300005615 Bacteria 893
107 Ga0068852_100023736 3300005616 Bacteria 4943
108 Ga0068859_100009899 3300005617 Bacteria 9628
109 Ga0068859_100048683 3300005617 Bacteria 4257
110 Ga0068859_100111553 3300005617 Bacteria 2798
111 Ga0068859_100131349 3300005617 Bacteria 2576
112 Ga0068859_100161126 3300005617 Unclassified 2322
113 Ga0068859_100266259 3300005617 Bacteria 1806
114 Ga0068859_100315253 3300005617 Unclassified 1658
115 Ga0068859_100392878 3300005617 Bacteria 1483
116 Ga0068859_100759064 3300005617 Bacteria 1059
117 Ga0068859_101035600 3300005617 Unclassified 902
118 Ga0068864_100060231 3300005618 Bacteria 3287
119 Ga0068864_100083716 3300005618 Bacteria 2801
120 Ga0068864_100441962 3300005618 Bacteria 1242
121 Ga0068861_100080241 3300005719 Bacteria 2552
122 Ga0068861_100169537 3300005719 Bacteria 1808
123 Ga0068861_100224714 3300005719 Unclassified 1589
124 Ga0068861_100319395 3300005719 Unclassified 1352
125 Ga0068861_100956802 3300005719 Unclassified 815
126 Ga0068851_10086684 3300005834 Bacteria 1643
127 Ga0068870_10014907 3300005840 Bacteria 3680
128 Ga0068870_10019358 3300005840 Bacteria 3302
129 Ga0068863_100114811 3300005841 Bacteria 2565
130 Ga0068863_100131015 3300005841 Bacteria 2395
131 Ga0068863_100150453 3300005841 Bacteria 2227
132 Ga0068863_100285872 3300005841 Unclassified 1598
133 Ga0068863_100457856 3300005841 Bacteria 1252
134 Ga0068863_100731083 3300005841 Unclassified 985
135 Ga0068863_101003129 3300005841 Unclassified 838
136 Ga0068858_100067550 3300005842 Bacteria 3312
137 Ga0068858_100237231 3300005842 Bacteria 1729
138 Ga0068858_100650923 3300005842 Bacteria 1024
139 Ga0068860_100061844 3300005843 Unclassified 3558
140 Ga0068860_100244035 3300005843 Unclassified 1747
141 Ga0068860_100743998 3300005843 Bacteria 992
142 Ga0068862_100058906 3300005844 Bacteria 3296
143 Ga0068862_100251457 3300005844 Unclassified 1611
144 Ga0068862_100376675 3300005844 Bacteria 1323
145 Ga0081539_10000537 3300005985 Bacteria 78553
146 Ga0070716_100292431 3300006173 Bacteria 1129
147 Ga0070716_100470873 3300006173 Unclassified 920
148 Ga0070716_100707947 3300006173 Bacteria 770
149 Ga0097621_100034139 3300006237 Bacteria 4056
150 Ga0097621_100393356 3300006237 Bacteria 1240
151 Ga0075428_100406937 3300006844 Bacteria 1458
152 Ga0075428_100687396 3300006844 Bacteria 1090
153 Ga0075428_101104606 3300006844 Unclassified 837
154 Ga0075430_100048770 3300006846 Bacteria 3575
155 Ga0075430_100079724 3300006846 Bacteria 2743
156 Ga0075431_100154686 3300006847 Bacteria 2360
157 Ga0075431_100204600 3300006847 Archaea 2018
158 Ga0075431_100251606 3300006847 Unclassified 1795
159 Ga0075433_10038377 3300006852 Bacteria 4136
160 Ga0075433_10067317 3300006852 Bacteria 3143
161 Ga0075433_10294383 3300006852 Bacteria 1438
162 Ga0075433_10333118 3300006852 Bacteria 1342
163 Ga0075434_100076411 3300006871 Bacteria 3344
164 Ga0075434_100118976 3300006871 Bacteria 2655
165 Ga0075429_100035090 3300006880 Bacteria 4360
166 Ga0075429_100182996 3300006880 Bacteria 1836
167 Ga0068865_100796525 3300006881 Unclassified 815
168 Ga0097620_100009901 3300006931 Bacteria 9628
169 Ga0097620_100048686 3300006931 Bacteria 4257
170 Ga0097620_100111556 3300006931 Bacteria 2798
171 Ga0097620_100131342 3300006931 Bacteria 2576
172 Ga0097620_100161125 3300006931 Unclassified 2322
173 Ga0097620_100266275 3300006931 Bacteria 1806
174 Ga0097620_100315268 3300006931 Unclassified 1658
175 Ga0097620_100392888 3300006931 Bacteria 1483
176 Ga0097620_100759066 3300006931 Bacteria 1059
177 Ga0097620_101035851 3300006931 Unclassified 902
178 Ga0075435_100350845 3300007076 Unclassified 1265
179 Ga0105251_10061476 3300009011 Unclassified 1765
180 Ga0105251_10268093 3300009011 Unclassified 771
181 Ga0105240_10027698 3300009093 Bacteria 7416
182 Ga0111539_10000228 3300009094 Bacteria 67465
183 Ga0111539_10127373 3300009094 Archaea 2982
184 Ga0105245_10801876 3300009098 Unclassified 980
185 Ga0105247_10889330 3300009101 Unclassified 687
186 Ga0114129_10047384 3300009147 Bacteria 6039
187 Ga0114129_10051742 3300009147 Bacteria 5765
188 Ga0114129_10190214 3300009147 Bacteria 2788
189 Ga0114129_10246390 3300009147 Bacteria 2400
190 Ga0114129_10292569 3300009147 Bacteria 2173
191 Ga0114129_10568427 3300009147 Viruses 1472
192 Ga0114129_11055578 3300009147 Unclassified 1020
193 Ga0114129_11664815 3300009147 Unclassified 779
194 Ga0105243_10134347 3300009148 Unclassified 2103
195 Ga0105243_10213798 3300009148 Bacteria 1699
196 Ga0105243_10442901 3300009148 Unclassified 1217
197 Ga0105243_10549076 3300009148 Unclassified 1104
198 Ga0105241_10077803 3300009174 Bacteria 2590
199 Ga0105241_10145944 3300009174 Unclassified 1931
200 Ga0105241_10349614 3300009174 Bacteria 1283
201 Ga0105241_10466539 3300009174 Unclassified 1120
202 Ga0105242_10177971 3300009176 Bacteria 1874
203 Ga0105242_10204526 3300009176 Bacteria 1755
204 Ga0105248_10024875 3300009177 Bacteria 6656
205 Ga0105248_10061805 3300009177 Bacteria 4206
206 Ga0105248_10088936 3300009177 Bacteria 3476
207 Ga0105248_10093663 3300009177 Bacteria 3383
208 Ga0105248_10246886 3300009177 Bacteria 2009
209 Ga0105248_10254790 3300009177 Unclassified 1975
210 Ga0105248_10626107 3300009177 Bacteria 1214
211 Ga0105248_10948238 3300009177 Unclassified 972
212 Ga0105237_10044149 3300009545 Bacteria 4488
213 Ga0105238_10010693 3300009551 Bacteria 9217
214 Ga0105238_10013045 3300009551 Bacteria 8386
215 Ga0105249_10050422 3300009553 Bacteria 3795
216 Ga0105249_10278938 3300009553 Bacteria 1668
217 Ga0105239_10152861 3300010375 Bacteria 2576
218 Ga0105239_10557314 3300010375 Bacteria 1305
219 Ga0105246_10054595 3300011119 Bacteria 2754
220 Ga0105246_10115006 3300011119 Bacteria 1983
221 Ga0157373_10003729 3300013100 Bacteria 11529
222 Ga0157373_10014823 3300013100 Bacteria 5710
223 Ga0157373_10314465 3300013100 Bacteria 1113
224 Ga0157378_10042489 3300013297 Bacteria 4035
225 Ga0157378_10109475 3300013297 Archaea 2531
226 Ga0157378_10187821 3300013297 Bacteria 1947
227 Ga0157378_10300197 3300013297 Unclassified 1554
228 Ga0157378_10645933 3300013297 Bacteria 1073
229 Ga0163162_10037281 3300013306 Bacteria 4851
230 Ga0163162_10138992 3300013306 Bacteria 2541
231 Ga0163162_10241556 3300013306 Bacteria 1937
232 Ga0163162_10673451 3300013306 Unclassified 1157
233 Ga0157372_10032314 3300013307 Bacteria 5738
234 Ga0157372_10093420 3300013307 Bacteria 3423
235 Ga0157372_10473461 3300013307 Bacteria 1460
236 Ga0157375_10115153 3300013308 Archaea 2791
237 Ga0157375_10157222 3300013308 Bacteria 2413
238 Ga0157375_10172553 3300013308 Bacteria 2310
239 Ga0157375_10415930 3300013308 Bacteria 1511
240 Ga0157375_10847314 3300013308 Unclassified 1061
241 Ga0163163_10000792 3300014325 Bacteria 26791
242 Ga0163163_10045668 3300014325 Bacteria 4301
243 Ga0157380_10070941 3300014326 Bacteria 2817
244 Ga0157380_10170778 3300014326 Archaea 1900
245 Ga0157377_10130901 3300014745 Bacteria 1532
246 Ga0157377_10188906 3300014745 Bacteria 1301
247 Ga0157379_10095062 3300014968 Bacteria 2674
248 Ga0157379_10130928 3300014968 Bacteria 2258
249 Ga0157379_10203649 3300014968 Unclassified 1790
250 Ga0157379_10305379 3300014968 Bacteria 1451
251 Ga0157379_10355586 3300014968 Bacteria 1342
252 Ga0157376_10290497 3300014969 Bacteria 1543
253 Ga0206350_10712223 3300020080 Unclassified 990
254 Ga0207697_10067418 3300025315 Bacteria 1496
255 Ga0207656_10030077 3300025321 Bacteria 2241
256 Ga0207653_10000487 3300025885 Bacteria 15616
257 Ga0207647_10059009 3300025904 Bacteria 2349
258 Ga0207647_10150092 3300025904 Unclassified 1362
259 Ga0207645_10537141 3300025907 Unclassified 793
260 Ga0207643_10006471 3300025908 Bacteria 6271
261 Ga0207643_10014874 3300025908 Bacteria 4232
262 Ga0207643_10173683 3300025908 Unclassified 1302
263 Ga0207684_10000327 3300025910 Bacteria 67005
264 Ga0207654_10162303 3300025911 Bacteria 1445
265 Ga0207654_10319034 3300025911 Unclassified 1062
266 Ga0207654_10330770 3300025911 Unclassified 1044
267 Ga0207671_10010490 3300025914 Bacteria 7637
268 Ga0207671_10187473 3300025914 Bacteria 1612
269 Ga0207660_10071447 3300025917 Bacteria 2525
270 Ga0207662_10078133 3300025918 Bacteria 2014
271 Ga0207662_10124475 3300025918 Unclassified 1620
272 Ga0207662_10167155 3300025918 Bacteria 1409
273 Ga0207662_10352712 3300025918 Bacteria 989
274 Ga0207662_10485564 3300025918 Unclassified 849
275 Ga0207649_10249442 3300025920 Bacteria 1278
276 Ga0207652_10260586 3300025921 Bacteria 1564
277 Ga0207646_10336483 3300025922 Unclassified 1364
278 Ga0207646_10656221 3300025922 Bacteria 940
279 Ga0207681_10055461 3300025923 Unclassified 2699
280 Ga0207694_10006576 3300025924 Bacteria 8833
281 Ga0207694_10352403 3300025924 Bacteria 1219
282 Ga0207650_10000313 3300025925 Bacteria 47889
283 Ga0207650_10013606 3300025925 Bacteria 5638
284 Ga0207650_10070191 3300025925 Bacteria 2633
285 Ga0207650_10491648 3300025925 Unclassified 1025
286 Ga0207650_10811567 3300025925 Unclassified 793
287 Ga0207650_11061089 3300025925 Unclassified 689
288 Ga0207687_10722399 3300025927 Unclassified 846
289 Ga0207644_10281291 3300025931 Unclassified 1336
290 Ga0207690_10431498 3300025932 Unclassified 1056
291 Ga0207706_10080120 3300025933 Bacteria 2871
292 Ga0207706_10353869 3300025933 Unclassified 1277
293 Ga0207686_10089636 3300025934 Bacteria 2028
294 Ga0207686_10114059 3300025934 Bacteria 1828
295 Ga0207709_10003356 3300025935 Bacteria 9568
296 Ga0207709_10064824 3300025935 Bacteria 2295
297 Ga0207709_10255935 3300025935 Bacteria 1281
298 Ga0207709_10285755 3300025935 Bacteria 1220
299 Ga0207670_10000428 3300025936 Bacteria 23783
300 Ga0207670_10029314 3300025936 Unclassified 3505
301 Ga0207670_10119839 3300025936 Unclassified 1911
302 Ga0207670_10143303 3300025936 Bacteria 1764
303 Ga0207670_10424780 3300025936 Archaea 1067
304 Ga0207704_10504289 3300025938 Unclassified 976
305 Ga0207665_10485111 3300025939 Unclassified 953
306 Ga0207691_10176716 3300025940 Bacteria 1867
307 Ga0207691_10609583 3300025940 Unclassified 924
308 Ga0207711_10345895 3300025941 Unclassified 1376
309 Ga0207711_10394440 3300025941 Unclassified 1285
310 Ga0207711_11071419 3300025941 Unclassified 746
311 Ga0207711_11245936 3300025941 Unclassified 686
312 Ga0207689_10323515 3300025942 Unclassified 1280
313 Ga0207689_10326651 3300025942 Unclassified 1273
314 Ga0207689_10407948 3300025942 Unclassified 1133
315 Ga0207689_10491224 3300025942 Unclassified 1028
316 Ga0207689_10760424 3300025942 Bacteria 818
317 Ga0207679_10694399 3300025945 Unclassified 923
318 Ga0207679_10700288 3300025945 Unclassified 919
319 Ga0207651_10030174 3300025960 Bacteria 3448
320 Ga0207651_10397485 3300025960 Bacteria 1171
321 Ga0207651_10467121 3300025960 Unclassified 1085
322 Ga0207651_10833378 3300025960 Bacteria 819
323 Ga0207712_10264893 3300025961 Bacteria 1395
324 Ga0207640_10411875 3300025981 Unclassified 1104
325 Ga0207640_10615714 3300025981 Unclassified 921
326 Ga0207640_11373951 3300025981 Unclassified 632
327 Ga0207703_10126935 3300026035 Bacteria 2198
328 Ga0207703_10480767 3300026035 Bacteria 1164
329 Ga0207639_10240296 3300026041 Unclassified 1574
330 Ga0207708_10013913 3300026075 Bacteria 6014
331 Ga0207708_10173078 3300026075 Bacteria 1711
332 Ga0207708_10179337 3300026075 Bacteria 1681
333 Ga0207702_10030306 3300026078 Bacteria 4508
334 Ga0207641_10012008 3300026088 Bacteria 7107
335 Ga0207641_10101154 3300026088 Bacteria 2540
336 Ga0207641_10134106 3300026088 Bacteria 2227
337 Ga0207641_10210535 3300026088 Unclassified 1798
338 Ga0207641_10306905 3300026088 Bacteria 1501
339 Ga0207641_10416398 3300026088 Bacteria 1293
340 Ga0207648_10248447 3300026089 Bacteria 1586
341 Ga0207648_10355136 3300026089 Bacteria 1322
342 Ga0207648_11324920 3300026089 Bacteria 677
343 Ga0207676_10001502 3300026095 Bacteria 17222
344 Ga0207676_10238275 3300026095 Bacteria 1630
345 Ga0207676_10940568 3300026095 Unclassified 849
346 Ga0207674_10078183 3300026116 Unclassified 3314
347 Ga0207674_10099243 3300026116 Unclassified 2894
348 Ga0207674_10242207 3300026116 Bacteria 1750
349 Ga0207674_10407753 3300026116 Bacteria 1313
350 Ga0207675_100023605 3300026118 Bacteria 5721
351 Ga0207675_100041246 3300026118 Bacteria 4310
352 Ga0207675_100194821 3300026118 Unclassified 1945
353 Ga0207675_100766240 3300026118 Unclassified 977
354 Ga0207683_10830745 3300026121 Bacteria 858
355 Ga0207698_10375901 3300026142 Bacteria 1350
356 Ga0207428_10007901 3300027907 Bacteria 9670
357 Ga0207428_10152088 3300027907 Bacteria 1761
358 Ga0268265_10034050 3300028380 Bacteria 3710
359 Ga0268265_10068838 3300028380 Bacteria 2747
360 Ga0268265_10176437 3300028380 Bacteria 1832
361 Ga0268265_10259551 3300028380 Bacteria 1544
362 Ga0268265_10383955 3300028380 Archaea 1293
363 Ga0268264_10108766 3300028381 Bacteria 2424
364 Ga0268264_10149819 3300028381 Bacteria 2090
365 Ga0268264_10149893 3300028381 Bacteria 2090
366 Ga0268264_10172262 3300028381 Unclassified 1958
367 Ga0268264_10417637 3300028381 Bacteria 1293
368 Ga0268264_10561136 3300028381 Unclassified 1121
369 Ga0307408_100677405 3300031548 Bacteria 925
370 Ga0307408_100693827 3300031548 Unclassified 914
371 Ga0307405_10163833 3300031731 Bacteria 1578
372 Ga0307405_10246494 3300031731 Bacteria 1326
373 Ga0307406_10092171 3300031901 Bacteria 2043
374 Ga0307412_10059527 3300031911 Bacteria 2560
375 Ga0307409_100014114 3300031995 Bacteria 5179
376 Ga0307416_100415454 3300032002 Bacteria 1387
377 Ga0307414_10039366 3300032004 Unclassified 3184
378 Ga0307414_10899674 3300032004 Bacteria 811
379 Ga0307411_10246384 3300032005 Bacteria 1402
380 Ga0307415_100137702 3300032126 Bacteria 1859
381 Ga0307415_100212426 3300032126 Bacteria 1545
382 Ga0373929_0107165 3300035085 Unclassified 711
383 Ga0373951_0005354 3300035091 Bacteria 2987
384 Ga0373942_0002296 3300035207 Bacteria 4670
385 Ga0395900_0779136 3300037418 Bacteria 885
386 Ga0395901_0096338 3300038443 Bacteria 3101
387 Ga0395901_0248210 3300038443 Unclassified 1855
388 Ga0242422_00837 3300038699 Bacteria 2065
389 Ga0242420_000443 3300038996 Bacteria 4679
390 Ga0439448_0008971 3300042005 Bacteria 2939
391 Ga0439458_0003287 3300042157 Unclassified 3813
392 Ga0451576_0029656 3300045051 Bacteria 5853
393 Ga0451576_0452323 3300045051 Unclassified 1348
394 Ga0495663_0000302 3300046525 Bacteria 18632
395 Ga0495598_0001309 3300046537 Unclassified 4879
396 Ga0495598_0045092 3300046537 Bacteria 1305
397 Ga0495621_0000013 3300046539 Bacteria 38261
398 Ga0495656_0062506 3300046615 Bacteria 1629
399 Ga0495685_115370 3300047447 Unclassified 883
400 Ga0496102_0276363 3300048905 Bacteria 1583
401 Ga0496104_0079076 3300048907 Bacteria 3134
402 Ga0496104_0754975 3300048907 Bacteria 880
403 Ga0496107_0143097 3300048910 Unclassified 1768
404 Ga0496110_1015706 3300048913 Unclassified 737
405 Ga0496112_0393697 3300048915 Unclassified 1326
406 Ga0496112_0533160 3300048915 Unclassified 1108
407 Ga0496113_0044727 3300048916 Unclassified 3282
408 Ga0496113_0690762 3300048916 Unclassified 815
409 Ga0501306_020259 3300049127 Unclassified 923
410 Ga0501306_023736 3300049127 Unclassified 873
411 Ga0501306_028903 3300049127 Bacteria 815
412 Ga0501308_043624 3300049128 Unclassified 638
413 Ga0501341_07743 3300049131 Unclassified 677
414 Ga0501343_009815 3300049132 Unclassified 777
415 Ga0501305_020977 3300049161 Bacteria 964
416 Ga0501307_024592 3300049162 Bacteria 804
417 Ga0501307_026113 3300049162 Unclassified 788
418 Ga0501291_001924 3300049514 Unclassified 2441
419 Ga0501291_014489 3300049514 Unclassified 1180
420 Ga0501292_017659 3300049515 Bacteria 1130
421 Ga0501292_048408 3300049515 Unclassified 748
422 Ga0501296_001159 3300049519 Bacteria 2647
423 Ga0501296_002469 3300049519 Unclassified 1938
424 Ga0501298_007505 3300049521 Bacteria 1809
425 Ga0501299_000534 3300049522 Bacteria 4540
426 Ga0501299_013033 3300049522 Unclassified 1429
427 Ga0501299_021824 3300049522 Bacteria 1177
428 Ga0501312_039402 3300049528 Bacteria 768
429 Ga0501313_011936 3300049529 Bacteria 1007
430 Ga0501313_022192 3300049529 Unclassified 790
431 Ga0501315_014171 3300049531 Bacteria 1008
432 Ga0501315_019523 3300049531 Unclassified 902
433 Ga0501315_021924 3300049531 Unclassified 868
434 Ga0501315_024657 3300049531 Bacteria 833
435 Ga0501317_016699 3300049533 Unclassified 955
436 Ga0501320_015452 3300049536 Unclassified 835
437 Ga0501325_009505 3300049541 Unclassified 864
438 Ga0501333_005601 3300049549 Unclassified 819
439 Ga0501334_08015 3300049550 Unclassified 736
440 Ga0501335_008428 3300049551 Unclassified 969
441 Ga0501336_005303 3300049552 Unclassified 928
442 Ga0501337_007280 3300049553 Unclassified 770
443 Ga0501340_003823 3300049556 Unclassified 928
444 Ga0501340_006948 3300049556 Bacteria 770
445 Ga0501036_0681774 3300049572 Unclassified 850
446 Ga0501198_007940 3300049649 Bacteria 1533
447 Ga0501198_031246 3300049649 Unclassified 890
448 Ga0501202_003620 3300049652 Bacteria 2661
449 Ga0501202_010524 3300049652 Bacteria 1719
450 Ga0501202_150443 3300049652 Unclassified 609
451 Ga0501207_032033 3300049654 Unclassified 887
452 Ga0501209_128524 3300049656 Bacteria 755
453 Ga0501214_032193 3300049659 Unclassified 725
454 Ga0501216_013793 3300049660 Bacteria 1345
455 Ga0501216_019949 3300049660 Bacteria 1167
456 Ga0501217_004299 3300049661 Bacteria 2920
457 Ga0501223_009265 3300049663 Bacteria 1997
458 Ga0501223_034923 3300049663 Bacteria 978
459 Ga0501227_012800 3300049665 Unclassified 1841
460 Ga0501228_014712 3300049666 Bacteria 829
461 Ga0501228_019912 3300049666 Bacteria 751
462 Ga0501230_031008 3300049667 Bacteria 995
463 Ga0501233_030073 3300049668 Bacteria 1222
464 Ga0501235_002897 3300049669 Bacteria 3698
465 Ga0501235_013657 3300049669 Bacteria 1788
466 Ga0501235_045449 3300049669 Bacteria 1010
467 Ga0501236_010630 3300049670 Bacteria 1209
468 Ga0501243_007754 3300049675 Unclassified 1644
469 Ga0501246_003636 3300049676 Bacteria 1247
470 Ga0501246_014576 3300049676 Unclassified 758
471 Ga0501249_009197 3300049679 Bacteria 2055
472 Ga0501250_046201 3300049680 Bacteria 655
473 Ga0501251_004133 3300049681 Bacteria 1485
474 Ga0501256_006094 3300049685 Unclassified 1081
475 Ga0501261_005476 3300049690 Unclassified 1598
476 Ga0501261_016228 3300049690 Bacteria 1032
477 Ga0501221_006125 3300049704 Unclassified 2026
478 Ga0501225_0034774 3300049705 Bacteria 1387
479 Ga0501225_0066819 3300049705 Bacteria 1017
480 Ga0501229_002441 3300049706 Unclassified 2193
481 Ga0501229_009077 3300049706 Bacteria 1247
482 Ga0501234_009456 3300049707 Bacteria 1521
483 Ga0501245_007026 3300049708 Bacteria 1586
484 Ga0501232_029136 3300049757 Unclassified 757
485 Ga0501267_009219 3300049764 Bacteria 983
486 Ga0501268_001158 3300049765 Bacteria 3196
487 Ga0501268_025249 3300049765 Bacteria 1043
488 Ga0501270_062004 3300049767 Bacteria 704
489 Ga0501271_010881 3300049768 Unclassified 967
490 Ga0501272_003569 3300049769 Unclassified 1587
491 Ga0501273_010370 3300049770 Bacteria 1144
492 Ga0501273_011742 3300049770 Unclassified 1095
493 Ga0501273_030859 3300049770 Bacteria 762
494 Ga0501274_004344 3300049771 Bacteria 1169
495 Ga0501276_003701 3300049773 Unclassified 1122
496 Ga0501279_014115 3300049775 Bacteria 1098
497 Ga0501283_002014 3300049779 Bacteria 2633
498 Ga0501212_027288 3300049851 Unclassified 908
499 Ga0501212_065739 3300049851 Bacteria 634
500 Ga0501226_004617 3300049853 Bacteria 1591
501 nmdc:mga05p37_12436_c1 3300050507 Bacteria 10166
502 nmdc:mga05p37_1567755_c1 3300050507 Unclassified 651
503 nmdc:mga05p37_160070_c1 3300050507 Bacteria 2750
504 nmdc:mga05p37_185361_c1 3300050507 Bacteria 2530
505 nmdc:mga05p37_235075_c1 3300050507 Bacteria 2206
506 nmdc:mga09592_101553_c1 3300050508 Archaea 2464
507 nmdc:mga09592_239364_c1 3300050508 Bacteria 1572
508 nmdc:mga0qj67_331412_c1 3300050509 Archaea 1232
509 nmdc:mga0qj67_699419_c1 3300050509 Unclassified 806
510 nmdc:mga0qj67_95751_c1 3300050509 Bacteria 2390
511 nmdc:mga06r32_172087_c1 3300050510 Unclassified 2149
512 nmdc:mga06r32_508798_c1 3300050510 Archaea 1181
513 nmdc:mga06r32_93825_c1 3300050510 Unclassified 2936
514 nmdc:mga06r32_967577_c1 3300050510 Unclassified 805
515 nmdc:mga08y16_163722_c1 3300050511 Bacteria 2311
516 nmdc:mga08y16_229996_c1 3300050511 Bacteria 1918
517 nmdc:mga08y16_281125_c1 3300050511 Bacteria 1716
518 nmdc:mga0n895_179954_c1 3300050512 Bacteria 2146
519 nmdc:mga0n895_247071_c1 3300050512 Bacteria 1811
520 nmdc:mga0n895_60342_c1 3300050512 Bacteria 3742
521 nmdc:mga0a205_150954_c1 3300050515 Bacteria 2223
522 nmdc:mga0a205_172682_c1 3300050515 Unclassified 2057
523 nmdc:mga0a205_193091_c1 3300050515 Unclassified 1928
524 nmdc:mga0a205_30108_c2 3300050515 Bacteria 4555
525 nmdc:mga0a205_96138_c1 3300050515 Bacteria 2861
526 Ga0587093_015396 3300059478 Bacteria 965
527 Ga0587093_017661 3300059478 Unclassified 923
528 Ga0587093_024455 3300059478 Unclassified 832
529 Ga0587073_0044570 3300059492 Bacteria 981
530 Ga0587073_0046796 3300059492 Unclassified 965
531 Ga0587088_044275 3300059508 Bacteria 850
532 Ga0587090_024885 3300059510 Bacteria 963
533 Ga0587091_018242 3300059511 Bacteria 1192
534 Ga0587091_121414 3300059511 Bacteria 635
535 Ga0587094_035384 3300059513 Bacteria 792
536 Ga0587098_019864 3300059604 Unclassified 844
537 Ga0587072_026637 3300059643 Bacteria 1057
538 Ga0587072_028818 3300059643 Unclassified 1026
539 Ga0587072_086719 3300059643 Bacteria 684
540 Ga0587076_025418 3300059645 Unclassified 1012
541 Ga0530510_0205854 3300061734 Bacteria 1462
542 Ga0068857_100418563
543 CNAas_1000782
544 JGI24751J29686_10000099
545 JGI25406J46586_10031847
546 rootL2_10147728
547 rootL2_10275350
548 Ga0065714_10086485
549 Ga0065704_10117579
550 Ga0065712_10264966
551 Ga0065715_10157711
552 Ga0065715_10204310
553 Ga0065715_10240127
554 Ga0065715_10257096
555 Ga0065707_10000953
556 Ga0065707_10249104
557 Ga0070670_100000297
558 Ga0070670_100092547
559 Ga0070670_100123522
560 Ga0070670_100579209
561 Ga0070670_100759766
562 Ga0068869_100224013
563 Ga0068869_100509344
564 Ga0068869_100625393
565 Ga0070680_100041292
566 Ga0070682_100000909
567 Ga0070682_100008627
568 Ga0070682_100102049
569 Ga0070689_100000425
570 Ga0070689_100051849
571 Ga0070689_100101425
572 Ga0070687_100025728
573 Ga0070687_100547394
574 Ga0070692_10005197
575 Ga0070692_10008680
576 Ga0070692_10705093
577 Ga0070669_100000225
578 Ga0070669_101030159
579 Ga0070675_100980991
580 Ga0070671_100262355
581 Ga0070671_100281571
582 Ga0070671_100958524
583 Ga0070673_100104093
584 Ga0070673_100448959
585 Ga0070659_100696467
586 Ga0070659_100950111
587 Ga0070703_10005823
588 Ga0070701_10262762
589 Ga0070705_100104096
590 Ga0070705_100604824
591 Ga0070700_100049422
592 Ga0070700_100083336
593 Ga0070700_100133015
594 Ga0070700_100585337
595 Ga0070694_100000781
596 Ga0070694_100035426
597 Ga0070694_100044415
598 Ga0070694_100148471
599 Ga0070694_100535998
600 Ga0070662_100096486
601 Ga0070681_10145741
602 Ga0068867_100211854
603 Ga0068867_100386526
604 Ga0070706_100000146
605 Ga0070706_100065317
606 Ga0070707_100023345
607 Ga0070707_100584332
608 Ga0070707_100799546
609 Ga0070698_100006997
610 Ga0070698_100028883
611 Ga0070698_100152967
612 Ga0070699_100006092
613 Ga0070699_100372988
614 Ga0070679_100302900
615 Ga0070679_100414081
616 Ga0070697_100014032
617 Ga0070697_100049396
618 Ga0068853_100101724
619 Ga0070686_100744645
620 Ga0070695_100041890
621 Ga0070695_100063145
622 Ga0070695_100122242
623 Ga0070695_100448379
624 Ga0070696_100053424
625 Ga0070696_100075088
626 Ga0070696_100120372
627 Ga0070696_100254226
628 Ga0070696_100484283
629 Ga0070693_100001960
630 Ga0070693_100006717
631 Ga0070693_100230147
632 Ga0070693_100262267
633 Ga0070665_101537663
634 Ga0068855_100282162
635 Ga0070664_100614163
636 Ga0068857_100086592
637 Ga0068857_100125612
638 Ga0068857_100199444
639 Ga0068857_100418156
640 Ga0068857_100459062
641 Ga0068854_100998808
642 Ga0068856_100213805
643 Ga0070702_100004099
644 Ga0070702_100048821
645 Ga0070702_100381115
646 Ga0070702_100445753
647 Ga0070702_100499914
648 Ga0068852_100023736
649 Ga0068859_100009899
650 Ga0068859_100048683
651 Ga0068859_100111553
652 Ga0068859_100131349
653 Ga0068859_100161126
654 Ga0068859_100266259
655 Ga0068859_100315253
656 Ga0068859_100392878
657 Ga0068859_100759064
658 Ga0068859_101035600
659 Ga0068864_100060231
660 Ga0068864_100083716
661 Ga0068864_100441962
662 Ga0068861_100080241
663 Ga0068861_100169537
664 Ga0068861_100224714
665 Ga0068861_100319395
666 Ga0068861_100956802
667 Ga0068851_10086684
668 Ga0068870_10014907
669 Ga0068870_10019358
670 Ga0068863_100114811
671 Ga0068863_100131015
672 Ga0068863_100150453
673 Ga0068863_100285872
674 Ga0068863_100457856
675 Ga0068863_100731083
676 Ga0068863_101003129
677 Ga0068858_100067550
678 Ga0068858_100237231
679 Ga0068858_100650923
680 Ga0068860_100061844
681 Ga0068860_100244035
682 Ga0068860_100743998
683 Ga0068862_100058906
684 Ga0068862_100251457
685 Ga0068862_100376675
686 Ga0081539_10000537
687 Ga0070716_100292431
688 Ga0070716_100470873
689 Ga0070716_100707947
690 Ga0097621_100034139
691 Ga0097621_100393356
692 Ga0075428_100406937
693 Ga0075428_100687396
694 Ga0075428_101104606
695 Ga0075430_100048770
696 Ga0075430_100079724
697 Ga0075431_100154686
698 Ga0075431_100204600
699 Ga0075431_100251606
700 Ga0075433_10038377
701 Ga0075433_10067317
702 Ga0075433_10294383
703 Ga0075433_10333118
704 Ga0075434_100076411
705 Ga0075434_100118976
706 Ga0075429_100035090
707 Ga0075429_100182996
708 Ga0068865_100796525
709 Ga0097620_100009901
710 Ga0097620_100048686
711 Ga0097620_100111556
712 Ga0097620_100131342
713 Ga0097620_100161125
714 Ga0097620_100266275
715 Ga0097620_100315268
716 Ga0097620_100392888
717 Ga0097620_100759066
718 Ga0097620_101035851
719 Ga0075435_100350845
720 Ga0105251_10061476
721 Ga0105251_10268093
722 Ga0105240_10027698
723 Ga0111539_10000228
724 Ga0111539_10127373
725 Ga0105245_10801876
726 Ga0105247_10889330
727 Ga0114129_10047384
728 Ga0114129_10051742
729 Ga0114129_10190214
730 Ga0114129_10246390
731 Ga0114129_10292569
732 Ga0114129_10568427
733 Ga0114129_11055578
734 Ga0114129_11664815
735 Ga0105243_10134347
736 Ga0105243_10213798
737 Ga0105243_10442901
738 Ga0105243_10549076
739 Ga0105241_10077803
740 Ga0105241_10145944
741 Ga0105241_10349614
742 Ga0105241_10466539
743 Ga0105242_10177971
744 Ga0105242_10204526
745 Ga0105248_10024875
746 Ga0105248_10061805
747 Ga0105248_10088936
748 Ga0105248_10093663
749 Ga0105248_10246886
750 Ga0105248_10254790
751 Ga0105248_10626107
752 Ga0105248_10948238
753 Ga0105237_10044149
754 Ga0105238_10010693
755 Ga0105238_10013045
756 Ga0105249_10050422
757 Ga0105249_10278938
758 Ga0105239_10152861
759 Ga0105239_10557314
760 Ga0105246_10054595
761 Ga0105246_10115006
762 Ga0157373_10003729
763 Ga0157373_10014823
764 Ga0157373_10314465
765 Ga0157378_10042489
766 Ga0157378_10109475
767 Ga0157378_10187821
768 Ga0157378_10300197
769 Ga0157378_10645933
770 Ga0163162_10037281
771 Ga0163162_10138992
772 Ga0163162_10241556
773 Ga0163162_10673451
774 Ga0157372_10032314
775 Ga0157372_10093420
776 Ga0157372_10473461
777 Ga0157375_10115153
778 Ga0157375_10157222
779 Ga0157375_10172553
780 Ga0157375_10415930
781 Ga0157375_10847314
782 Ga0163163_10000792
783 Ga0163163_10045668
784 Ga0157380_10070941
785 Ga0157380_10170778
786 Ga0157377_10130901
787 Ga0157377_10188906
788 Ga0157379_10095062
789 Ga0157379_10130928
790 Ga0157379_10203649
791 Ga0157379_10305379
792 Ga0157379_10355586
793 Ga0157376_10290497
794 Ga0206350_10712223
795 Ga0207697_10067418
796 Ga0207656_10030077
797 Ga0207653_10000487
798 Ga0207647_10059009
799 Ga0207647_10150092
800 Ga0207645_10537141
801 Ga0207643_10006471
802 Ga0207643_10014874
803 Ga0207643_10173683
804 Ga0207684_10000327
805 Ga0207654_10162303
806 Ga0207654_10319034
807 Ga0207654_10330770
808 Ga0207671_10010490
809 Ga0207671_10187473
810 Ga0207660_10071447
811 Ga0207662_10078133
812 Ga0207662_10124475
813 Ga0207662_10167155
814 Ga0207662_10352712
815 Ga0207662_10485564
816 Ga0207649_10249442
817 Ga0207652_10260586
818 Ga0207646_10336483
819 Ga0207646_10656221
820 Ga0207681_10055461
821 Ga0207694_10006576
822 Ga0207694_10352403
823 Ga0207650_10000313
824 Ga0207650_10013606
825 Ga0207650_10070191
826 Ga0207650_10491648
827 Ga0207650_10811567
828 Ga0207650_11061089
829 Ga0207687_10722399
830 Ga0207644_10281291
831 Ga0207690_10431498
832 Ga0207706_10080120
833 Ga0207706_10353869
834 Ga0207686_10089636
835 Ga0207686_10114059
836 Ga0207709_10003356
837 Ga0207709_10064824
838 Ga0207709_10255935
839 Ga0207709_10285755
840 Ga0207670_10000428
841 Ga0207670_10029314
842 Ga0207670_10119839
843 Ga0207670_10143303
844 Ga0207670_10424780
845 Ga0207704_10504289
846 Ga0207665_10485111
847 Ga0207691_10176716
848 Ga0207691_10609583
849 Ga0207711_10345895
850 Ga0207711_10394440
851 Ga0207711_11071419
852 Ga0207711_11245936
853 Ga0207689_10323515
854 Ga0207689_10326651
855 Ga0207689_10407948
856 Ga0207689_10491224
857 Ga0207689_10760424
858 Ga0207679_10694399
859 Ga0207679_10700288
860 Ga0207651_10030174
861 Ga0207651_10397485
862 Ga0207651_10467121
863 Ga0207651_10833378
864 Ga0207712_10264893
865 Ga0207640_10411875
866 Ga0207640_10615714
867 Ga0207640_11373951
868 Ga0207703_10126935
869 Ga0207703_10480767
870 Ga0207639_10240296
871 Ga0207708_10013913
872 Ga0207708_10173078
873 Ga0207708_10179337
874 Ga0207702_10030306
875 Ga0207641_10012008
876 Ga0207641_10101154
877 Ga0207641_10134106
878 Ga0207641_10210535
879 Ga0207641_10306905
880 Ga0207641_10416398
881 Ga0207648_10248447
882 Ga0207648_10355136
883 Ga0207648_11324920
884 Ga0207676_10001502
885 Ga0207676_10238275
886 Ga0207676_10940568
887 Ga0207674_10078183
888 Ga0207674_10099243
889 Ga0207674_10242207
890 Ga0207674_10407753
891 Ga0207675_100023605
892 Ga0207675_100041246
893 Ga0207675_100194821
894 Ga0207675_100766240
895 Ga0207683_10830745
896 Ga0207698_10375901
897 Ga0207428_10007901
898 Ga0207428_10152088
899 Ga0268265_10034050
900 Ga0268265_10068838
901 Ga0268265_10176437
902 Ga0268265_10259551
903 Ga0268265_10383955
904 Ga0268264_10108766
905 Ga0268264_10149819
906 Ga0268264_10149893
907 Ga0268264_10172262
908 Ga0268264_10417637
909 Ga0268264_10561136
910 Ga0307408_100677405
911 Ga0307408_100693827
912 Ga0307405_10163833
913 Ga0307405_10246494
914 Ga0307406_10092171
915 Ga0307412_10059527
916 Ga0307409_100014114
917 Ga0307416_100415454
918 Ga0307414_10039366
919 Ga0307414_10899674
920 Ga0307411_10246384
921 Ga0307415_100137702
922 Ga0307415_100212426
923 Ga0373929_0107165
924 Ga0373951_0005354
925 Ga0373942_0002296
926 Ga0395900_0779136
927 Ga0395901_0096338
928 Ga0395901_0248210
929 Ga0242422_00837
930 Ga0242420_000443
931 Ga0439448_0008971
932 Ga0439458_0003287
933 Ga0451576_0029656
934 Ga0451576_0452323
935 Ga0495663_0000302
936 Ga0495598_0001309
937 Ga0495598_0045092
938 Ga0495621_0000013
939 Ga0495656_0062506
940 Ga0495685_115370
941 Ga0496102_0276363
942 Ga0496104_0079076
943 Ga0496104_0754975
944 Ga0496107_0143097
945 Ga0496110_1015706
946 Ga0496112_0393697
947 Ga0496112_0533160
948 Ga0496113_0044727
949 Ga0496113_0690762
950 Ga0501306_020259
951 Ga0501306_023736
952 Ga0501306_028903
953 Ga0501308_043624
954 Ga0501341_07743
955 Ga0501343_009815
956 Ga0501305_020977
957 Ga0501307_024592
958 Ga0501307_026113
959 Ga0501291_001924
960 Ga0501291_014489
961 Ga0501292_017659
962 Ga0501292_048408
963 Ga0501296_001159
964 Ga0501296_002469
965 Ga0501298_007505
966 Ga0501299_000534
967 Ga0501299_013033
968 Ga0501299_021824
969 Ga0501312_039402
970 Ga0501313_011936
971 Ga0501313_022192
972 Ga0501315_014171
973 Ga0501315_019523
974 Ga0501315_021924
975 Ga0501315_024657
976 Ga0501317_016699
977 Ga0501320_015452
978 Ga0501325_009505
979 Ga0501333_005601
980 Ga0501334_08015
981 Ga0501335_008428
982 Ga0501336_005303
983 Ga0501337_007280
984 Ga0501340_003823
985 Ga0501340_006948
986 Ga0501036_0681774
987 Ga0501198_007940
988 Ga0501198_031246
989 Ga0501202_003620
990 Ga0501202_010524
991 Ga0501202_150443
992 Ga0501207_032033
993 Ga0501209_128524
994 Ga0501214_032193
995 Ga0501216_013793
996 Ga0501216_019949
997 Ga0501217_004299
998 Ga0501223_009265
999 Ga0501223_034923
1000 Ga0501227_012800
1001 Ga0501228_014712
1002 Ga0501228_019912
1003 Ga0501230_031008
1004 Ga0501233_030073
1005 Ga0501235_002897
1006 Ga0501235_013657
1007 Ga0501235_045449
1008 Ga0501236_010630
1009 Ga0501243_007754
1010 Ga0501246_003636
1011 Ga0501246_014576
1012 Ga0501249_009197
1013 Ga0501250_046201
1014 Ga0501251_004133
1015 Ga0501256_006094
1016 Ga0501261_005476
1017 Ga0501261_016228
1018 Ga0501221_006125
1019 Ga0501225_0034774
1020 Ga0501225_0066819
1021 Ga0501229_002441
1022 Ga0501229_009077
1023 Ga0501234_009456
1024 Ga0501245_007026
1025 Ga0501232_029136
1026 Ga0501267_009219
1027 Ga0501268_001158
1028 Ga0501268_025249
1029 Ga0501270_062004
1030 Ga0501271_010881
1031 Ga0501272_003569
1032 Ga0501273_010370
1033 Ga0501273_011742
1034 Ga0501273_030859
1035 Ga0501274_004344
1036 Ga0501276_003701
1037 Ga0501279_014115
1038 Ga0501283_002014
1039 Ga0501212_027288
1040 Ga0501212_065739
1041 Ga0501226_004617
1042 nmdc:mga05p37_12436_c1
1043 nmdc:mga05p37_1567755_c1
1044 nmdc:mga05p37_160070_c1
1045 nmdc:mga05p37_185361_c1
1046 nmdc:mga05p37_235075_c1
1047 nmdc:mga09592_101553_c1
1048 nmdc:mga09592_239364_c1
1049 nmdc:mga0qj67_331412_c1
1050 nmdc:mga0qj67_699419_c1
1051 nmdc:mga0qj67_95751_c1
1052 nmdc:mga06r32_172087_c1
1053 nmdc:mga06r32_508798_c1
1054 nmdc:mga06r32_93825_c1
1055 nmdc:mga06r32_967577_c1
1056 nmdc:mga08y16_163722_c1
1057 nmdc:mga08y16_229996_c1
1058 nmdc:mga08y16_281125_c1
1059 nmdc:mga0n895_179954_c1
1060 nmdc:mga0n895_247071_c1
1061 nmdc:mga0n895_60342_c1
1062 nmdc:mga0a205_150954_c1
1063 nmdc:mga0a205_172682_c1
1064 nmdc:mga0a205_193091_c1
1065 nmdc:mga0a205_30108_c2
1066 nmdc:mga0a205_96138_c1
1067 Ga0587093_015396
1068 Ga0587093_017661
1069 Ga0587093_024455
1070 Ga0587073_0044570
1071 Ga0587073_0046796
1072 Ga0587088_044275
1073 Ga0587090_024885
1074 Ga0587091_018242
1075 Ga0587091_121414
1076 Ga0587094_035384
1077 Ga0587098_019864
1078 Ga0587072_026637
1079 Ga0587072_028818
1080 Ga0587072_086719
1081 Ga0587076_025418
1082 Ga0530510_0205854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04972

BON

BON domain

106

174

0.98

Map