F461219

General Info

Members Datasets Scaffolds Average Seq Length
540 333 1080 91

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10013006|Ga0081538_100130063
Length 106
Sequence MRTSALTERPQPLGGSTMDKEFTATLQKSPNPGGWTYLIWPESVEFFGTRGLVKVRGTIDGHPFRSSFMALGDGTHKLPVKADVRRAIGKEAGDTVTVRLEERIEG

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
196 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
203 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
204 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
205 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
206 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
207 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
208 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
209 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
210 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
211 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
212 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
213 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
214 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
215 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
216 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
217 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
218 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
219 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
220 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
244 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
283 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
284 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
285 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
296 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
306 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
307 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
311 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
315 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
316 2643221647 Streptomyces sp. Root369 Isolate Unclassified
317 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
318 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
319 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
320 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
321 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
322 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
323 2862574272 Streptomyces sp. AcE210 Isolate Nodule
324 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
325 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
326 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
327 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
328 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
329 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
330 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
331 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
332 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
333 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 0
Isolates 3.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0.56
Rhizoplane 2.78
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10013006 3300005981 Bacteria 6621
2 JGI24739J22299_10002443 3300001989 Bacteria 7166
3 JGI24737J22298_10186582 3300001990 Bacteria 612
4 JGI24750J21931_1088493 3300002070 Bacteria 522
5 JGI24745J21846_1056846 3300002073 Bacteria 502
6 JGI24738J21930_10060165 3300002075 Bacteria 779
7 JGI24034J26672_10014790 3300002239 Bacteria 1192
8 JGI25153J46596_10085675 3300003215 Bacteria 774
9 rootH2_10203119 3300003320 Bacteria 1236
10 JGI25407J50210_10020426 3300003373 Bacteria 1722
11 JGI25407J50210_10059335 3300003373 Bacteria 963
12 JGI25407J50210_10113593 3300003373 Bacteria 668
13 Ga0055526_1011099 3300003771 Bacteria 4107
14 Ga0065712_10341040 3300005290 Bacteria 800
15 Ga0070676_10047381 3300005328 Bacteria 2510
16 Ga0070676_11237963 3300005328 Bacteria 568
17 Ga0070683_100870362 3300005329 Bacteria 864
18 Ga0070683_101414135 3300005329 Bacteria 668
19 Ga0070690_100004021 3300005330 Bacteria 8137
20 Ga0068869_100001880 3300005334 Bacteria 12610
21 Ga0070666_10113368 3300005335 Bacteria 1876
22 Ga0070666_11056025 3300005335 Bacteria 603
23 Ga0070680_100108886 3300005336 Bacteria 2305
24 Ga0070682_100008530 3300005337 Bacteria 5787
25 Ga0068868_100010915 3300005338 Bacteria 6593
26 Ga0068868_100661929 3300005338 Bacteria 931
27 Ga0068868_101613021 3300005338 Bacteria 610
28 Ga0070660_100009735 3300005339 Bacteria 6773
29 Ga0070660_100302651 3300005339 Bacteria 1311
30 Ga0070660_100427361 3300005339 Bacteria 1097
31 Ga0070689_100054464 3300005340 Bacteria 3097
32 Ga0070691_10002146 3300005341 Bacteria 8731
33 Ga0070692_10122222 3300005345 Bacteria 1453
34 Ga0070668_100016070 3300005347 Bacteria 5600
35 Ga0070668_100174445 3300005347 Bacteria 1752
36 Ga0070675_100024435 3300005354 Bacteria 4839
37 Ga0070671_100203276 3300005355 Bacteria 1680
38 Ga0070671_100333103 3300005355 Bacteria 1294
39 Ga0070671_101645888 3300005355 Bacteria 569
40 Ga0070674_100000574 3300005356 Bacteria 18552
41 Ga0070674_100001125 3300005356 Bacteria 14053
42 Ga0070688_100004186 3300005365 Bacteria 7493
43 Ga0070659_100022882 3300005366 Bacteria 4776
44 Ga0070667_100010725 3300005367 Bacteria 7571
45 Ga0070667_100024860 3300005367 Bacteria 4976
46 Ga0070703_10229183 3300005406 Bacteria 743
47 Ga0070709_10060837 3300005434 Bacteria 2402
48 Ga0070714_100947204 3300005435 Bacteria 837
49 Ga0070710_10001741 3300005437 Bacteria 10289
50 Ga0070710_11427740 3300005437 Unclassified 518
51 Ga0070701_10002996 3300005438 Bacteria 6609
52 Ga0070711_100000116 3300005439 Bacteria 41548
53 Ga0070711_100052191 3300005439 Bacteria 2813
54 Ga0070705_100023722 3300005440 Bacteria 3300
55 Ga0070700_100000880 3300005441 Bacteria 14816
56 Ga0070700_100229091 3300005441 Bacteria 1321
57 Ga0070694_100012805 3300005444 Bacteria 5227
58 Ga0070708_100158970 3300005445 Unclassified 2105
59 Ga0070663_100003254 3300005455 Bacteria 9346
60 Ga0070663_101006794 3300005455 Bacteria 725
61 Ga0070678_100000663 3300005456 Bacteria 16877
62 Ga0070662_100021812 3300005457 Bacteria 4378
63 Ga0070662_100268054 3300005457 Bacteria 1378
64 Ga0068867_100000745 3300005459 Bacteria 21851
65 Ga0070685_10103237 3300005466 Bacteria 1744
66 Ga0070706_100012864 3300005467 Bacteria 7746
67 Ga0070706_100212470 3300005467 Bacteria 1806
68 Ga0070706_101131495 3300005467 Unclassified 720
69 Ga0070706_101280294 3300005467 Bacteria 673
70 Ga0070707_100027153 3300005468 Bacteria 5443
71 Ga0070707_100081813 3300005468 Bacteria 3118
72 Ga0070698_100084144 3300005471 Bacteria 3169
73 Ga0070699_100453175 3300005518 Bacteria 1163
74 Ga0070679_100878200 3300005530 Bacteria 840
75 Ga0070679_101116551 3300005530 Bacteria 733
76 Ga0070684_100289687 3300005535 Bacteria 1501
77 Ga0068853_100006330 3300005539 Bacteria 9396
78 Ga0070672_100238210 3300005543 Bacteria 1530
79 Ga0070672_100298472 3300005543 Bacteria 1365
80 Ga0070695_100048699 3300005545 Bacteria 2711
81 Ga0070696_100008742 3300005546 Bacteria 6779
82 Ga0070665_100030084 3300005548 Bacteria 5464
83 Ga0070665_102648053 3300005548 Bacteria 502
84 Ga0070704_100001170 3300005549 Bacteria 13690
85 Ga0068855_100000041 3300005563 Bacteria 151653
86 Ga0068855_100307474 3300005563 Bacteria 1754
87 Ga0068855_100318406 3300005563 Bacteria 1720
88 Ga0070664_102118728 3300005564 Bacteria 534
89 Ga0068854_100001778 3300005578 Bacteria 13118
90 Ga0068856_100204787 3300005614 Bacteria 1988
91 Ga0068856_101961012 3300005614 Bacteria 596
92 Ga0070702_100000561 3300005615 Bacteria 13546
93 Ga0070702_101203307 3300005615 Bacteria 611
94 Ga0070702_101330698 3300005615 Bacteria 584
95 Ga0068852_100919958 3300005616 Bacteria 892
96 Ga0068859_100011843 3300005617 Bacteria 8758
97 Ga0068866_10003067 3300005718 Bacteria 6894
98 Ga0068858_100013105 3300005842 Bacteria 7818
99 Ga0068860_100002961 3300005843 Bacteria 17524
100 Ga0068862_100004932 3300005844 Bacteria 11234
101 Ga0068862_101159432 3300005844 Bacteria 770
102 Ga0081455_10028923 3300005937 Bacteria 5058
103 Ga0081455_10076670 3300005937 Bacteria 2753
104 Ga0081455_10092353 3300005937 Bacteria 2449
105 Ga0081455_10867598 3300005937 Bacteria 563
106 Ga0081538_10002706 3300005981 Bacteria 17045
107 Ga0081538_10008133 3300005981 Bacteria 8947
108 Ga0081538_10008975 3300005981 Bacteria 8402
109 Ga0081538_10024297 3300005981 Bacteria 4321
110 Ga0081538_10045572 3300005981 Bacteria 2716
111 Ga0081539_10036715 3300005985 Bacteria 2928
112 Ga0070715_10014930 3300006163 Bacteria 2887
113 Ga0070715_10334908 3300006163 Bacteria 821
114 Ga0070716_100001726 3300006173 Bacteria 9857
115 Ga0070712_100001799 3300006175 Bacteria 13098
116 Ga0075362_10576655 3300006177 Bacteria 580
117 Ga0097621_100412303 3300006237 Bacteria 1211
118 Ga0075428_100010844 3300006844 Bacteria 10129
119 Ga0075428_100817767 3300006844 Bacteria 990
120 Ga0075430_100002552 3300006846 Bacteria 15187
121 Ga0075431_100016967 3300006847 Bacteria 7393
122 Ga0075431_100832570 3300006847 Bacteria 895
123 Ga0075433_10027996 3300006852 Bacteria 4787
124 Ga0075433_10117731 3300006852 Bacteria 2357
125 Ga0075434_100091143 3300006871 Bacteria 3050
126 Ga0075434_100109668 3300006871 Bacteria 2770
127 Ga0075429_100119652 3300006880 Bacteria 2301
128 Ga0068865_100003056 3300006881 Bacteria 10010
129 Ga0097620_100011844 3300006931 Bacteria 8758
130 Ga0099826_10042232 3300006948 Bacteria 3155
131 Ga0075435_100036985 3300007076 Bacteria 3885
132 Ga0075435_100510170 3300007076 Bacteria 1040
133 Ga0105240_10054358 3300009093 Bacteria 5018
134 Ga0105240_10199631 3300009093 Bacteria 2345
135 Ga0111539_10013331 3300009094 Bacteria 10272
136 Ga0111539_10359838 3300009094 Bacteria 1694
137 Ga0111539_11195113 3300009094 Bacteria 883
138 Ga0105245_10002644 3300009098 Bacteria 16124
139 Ga0105245_10496001 3300009098 Bacteria 1236
140 Ga0105245_11357899 3300009098 Bacteria 760
141 Ga0105245_12445449 3300009098 Bacteria 576
142 Ga0105245_13186019 3300009098 Bacteria 508
143 Ga0105247_10005995 3300009101 Bacteria 7570
144 Ga0114129_10090162 3300009147 Bacteria 4250
145 Ga0114129_10308390 3300009147 Bacteria 2107
146 Ga0114129_10321422 3300009147 Bacteria 2057
147 Ga0114129_13159568 3300009147 Bacteria 537
148 Ga0105243_10000354 3300009148 Bacteria 48985
149 Ga0105243_10005121 3300009148 Bacteria 10280
150 Ga0105243_10303303 3300009148 Bacteria 1448
151 Ga0105241_10227495 3300009174 Bacteria 1571
152 Ga0105241_11527488 3300009174 Bacteria 643
153 Ga0105242_10000740 3300009176 Bacteria 25458
154 Ga0105242_13161191 3300009176 Bacteria 511
155 Ga0105248_10008276 3300009177 Bacteria 11428
156 Ga0105248_10223295 3300009177 Bacteria 2121
157 Ga0105248_12173784 3300009177 Bacteria 631
158 Ga0105237_10084752 3300009545 Bacteria 3159
159 Ga0105237_10847746 3300009545 Bacteria 921
160 Ga0105238_10030486 3300009551 Bacteria 5490
161 Ga0105238_10128530 3300009551 Bacteria 2512
162 Ga0105238_12238593 3300009551 Bacteria 581
163 Ga0105249_10091980 3300009553 Bacteria 2839
164 Ga0105239_10011949 3300010375 Bacteria 9683
165 Ga0105246_11106412 3300011119 Bacteria 724
166 Ga0157374_10150338 3300013296 Bacteria 2264
167 Ga0157374_11328711 3300013296 Bacteria 741
168 Ga0157378_10032730 3300013297 Bacteria 4595
169 Ga0157378_11778687 3300013297 Bacteria 664
170 Ga0163162_10121915 3300013306 Bacteria 2712
171 Ga0163162_13174961 3300013306 Bacteria 527
172 Ga0157375_10001039 3300013308 Bacteria 23979
173 Ga0157375_10015432 3300013308 Bacteria 6838
174 Ga0157375_10896799 3300013308 Bacteria 1031
175 Ga0157375_11414201 3300013308 Bacteria 820
176 Ga0157380_10000278 3300014326 Bacteria 30716
177 Ga0157380_11383702 3300014326 Bacteria 754
178 Ga0157377_10093460 3300014745 Bacteria 1780
179 Ga0157379_10056028 3300014968 Bacteria 3523
180 Ga0157376_10008320 3300014969 Bacteria 7479
181 Ga0157376_12006166 3300014969 Bacteria 616
182 Ga0157376_12461241 3300014969 Bacteria 560
183 Ga0163161_10001911 3300017792 Bacteria 15208
184 Ga0163161_11965891 3300017792 Bacteria 520
185 Ga0209455_1011253 3300025272 Bacteria 2215
186 Ga0209564_1000997 3300025295 Bacteria 35369
187 Ga0209758_1008355 3300025297 Bacteria 6735
188 Ga0207692_10010560 3300025898 Bacteria 3898
189 Ga0207642_10003614 3300025899 Bacteria 4906
190 Ga0207710_10104596 3300025900 Bacteria 1339
191 Ga0207688_10000743 3300025901 Bacteria 16183
192 Ga0207680_10028039 3300025903 Bacteria 3145
193 Ga0207647_10032864 3300025904 Bacteria 3328
194 Ga0207685_10003998 3300025905 Bacteria 3678
195 Ga0207685_10241330 3300025905 Bacteria 869
196 Ga0207699_10374741 3300025906 Bacteria 1009
197 Ga0207699_10440912 3300025906 Bacteria 933
198 Ga0207645_10020868 3300025907 Bacteria 4280
199 Ga0207684_10019287 3300025910 Bacteria 5834
200 Ga0207684_10111609 3300025910 Unclassified 2340
201 Ga0207684_11391649 3300025910 Bacteria 574
202 Ga0207695_10279004 3300025913 Bacteria 1565
203 Ga0207695_10335280 3300025913 Bacteria 1401
204 Ga0207671_10048249 3300025914 Bacteria 3152
205 Ga0207671_10568115 3300025914 Bacteria 904
206 Ga0207693_10004614 3300025915 Bacteria 11624
207 Ga0207663_10012178 3300025916 Bacteria 4641
208 Ga0207663_10054692 3300025916 Bacteria 2501
209 Ga0207657_10017907 3300025919 Bacteria 6778
210 Ga0207646_10023682 3300025922 Bacteria 5636
211 Ga0207646_10197799 3300025922 Bacteria 1815
212 Ga0207646_10445127 3300025922 Unclassified 1169
213 Ga0207681_10290120 3300025923 Bacteria 1291
214 Ga0207694_10005110 3300025924 Bacteria 10133
215 Ga0207659_10161211 3300025926 Bacteria 1761
216 Ga0207687_10006446 3300025927 Bacteria 7753
217 Ga0207687_10152440 3300025927 Bacteria 1765
218 Ga0207687_11855282 3300025927 Bacteria 515
219 Ga0207700_10026674 3300025928 Bacteria 4032
220 Ga0207664_10118821 3300025929 Bacteria 2209
221 Ga0207644_10044792 3300025931 Bacteria 3145
222 Ga0207644_11217873 3300025931 Bacteria 633
223 Ga0207690_11018035 3300025932 Bacteria 689
224 Ga0207706_10001473 3300025933 Bacteria 23528
225 Ga0207706_10013458 3300025933 Bacteria 7435
226 Ga0207686_10002695 3300025934 Bacteria 9639
227 Ga0207709_10005038 3300025935 Bacteria 7546
228 Ga0207709_10130013 3300025935 Bacteria 1715
229 Ga0207709_10195090 3300025935 Bacteria 1442
230 Ga0207670_10804555 3300025936 Bacteria 783
231 Ga0207669_10002808 3300025937 Bacteria 7459
232 Ga0207669_10011810 3300025937 Bacteria 4267
233 Ga0207669_10522479 3300025937 Bacteria 953
234 Ga0207704_10009035 3300025938 Bacteria 4790
235 Ga0207665_10027866 3300025939 Bacteria 3731
236 Ga0207691_10156961 3300025940 Bacteria 1998
237 Ga0207691_10425699 3300025940 Bacteria 1131
238 Ga0207711_10006148 3300025941 Bacteria 10146
239 Ga0207711_10615257 3300025941 Bacteria 1013
240 Ga0207689_10043322 3300025942 Bacteria 3721
241 Ga0207661_10035141 3300025944 Bacteria 3903
242 Ga0207679_10121280 3300025945 Bacteria 2082
243 Ga0207667_10000621 3300025949 Bacteria 45894
244 Ga0207667_10628689 3300025949 Bacteria 1081
245 Ga0207712_10020323 3300025961 Bacteria 4348
246 Ga0207668_10110887 3300025972 Bacteria 2058
247 Ga0207640_10004277 3300025981 Bacteria 7729
248 Ga0207658_10053353 3300025986 Bacteria 2987
249 Ga0207658_10118067 3300025986 Bacteria 2109
250 Ga0207677_10023535 3300026023 Bacteria 3808
251 Ga0207677_10905430 3300026023 Bacteria 795
252 Ga0207677_11579503 3300026023 Bacteria 607
253 Ga0207703_10031836 3300026035 Bacteria 4172
254 Ga0207639_10003677 3300026041 Bacteria 10306
255 Ga0207639_10071491 3300026041 Bacteria 2714
256 Ga0207678_10036054 3300026067 Bacteria 4306
257 Ga0207708_10000742 3300026075 Bacteria 24488
258 Ga0207708_10218360 3300026075 Bacteria 1527
259 Ga0207648_10000085 3300026089 Bacteria 88563
260 Ga0207648_10062401 3300026089 Bacteria 3249
261 Ga0207675_100001558 3300026118 Bacteria 22972
262 Ga0207683_10001356 3300026121 Bacteria 22136
263 Ga0207698_10690977 3300026142 Bacteria 1014
264 Ga0209282_1117494 3300027666 Bacteria 1337
265 Ga0207428_10002338 3300027907 Bacteria 18972
266 Ga0207428_10356368 3300027907 Bacteria 1076
267 Ga0207428_10546182 3300027907 Bacteria 838
268 Ga0268266_10035750 3300028379 Bacteria 4225
269 Ga0268265_10015195 3300028380 Bacteria 5262
270 Ga0268264_10021581 3300028381 Bacteria 5257
271 Ga0316179_1088580 3300030734 Bacteria 1240
272 Ga0307408_100060114 3300031548 Bacteria 2769
273 Ga0307408_100090747 3300031548 Bacteria 2306
274 Ga0307408_100136138 3300031548 Bacteria 1922
275 Ga0265314_10085513 3300031711 Unclassified 2067
276 Ga0265342_10008995 3300031712 Bacteria 7093
277 Ga0307516_10297099 3300031730 Bacteria 1292
278 Ga0307405_10008108 3300031731 Bacteria 5304
279 Ga0307405_10111516 3300031731 Bacteria 1854
280 Ga0307405_10234927 3300031731 Bacteria 1354
281 Ga0307405_11578409 3300031731 Bacteria 578
282 Ga0307413_10009215 3300031824 Bacteria 4714
283 Ga0307413_10142235 3300031824 Bacteria 1659
284 Ga0307413_10259665 3300031824 Bacteria 1294
285 Ga0307413_10849098 3300031824 Bacteria 771
286 Ga0307413_12111475 3300031824 Bacteria 510
287 Ga0307410_10001770 3300031852 Bacteria 10000
288 Ga0307410_10009103 3300031852 Bacteria 5551
289 Ga0307410_10062177 3300031852 Bacteria 2557
290 Ga0307410_10130570 3300031852 Bacteria 1845
291 Ga0307410_10499580 3300031852 Bacteria 1001
292 Ga0307410_10900661 3300031852 Bacteria 758
293 Ga0307406_10010236 3300031901 Bacteria 5285
294 Ga0307406_10020047 3300031901 Bacteria 3931
295 Ga0307406_10151519 3300031901 Bacteria 1655
296 Ga0307406_10181318 3300031901 Bacteria 1533
297 Ga0307406_10190816 3300031901 Bacteria 1500
298 Ga0307406_10237673 3300031901 Bacteria 1364
299 Ga0307407_10188909 3300031903 Bacteria 1371
300 Ga0307407_10190358 3300031903 Bacteria 1367
301 Ga0307407_10383133 3300031903 Bacteria 1004
302 Ga0307407_10432251 3300031903 Bacteria 951
303 Ga0307407_11053294 3300031903 Bacteria 630
304 Ga0307412_10053540 3300031911 Bacteria 2675
305 Ga0307412_10112067 3300031911 Bacteria 1950
306 Ga0307412_10152898 3300031911 Bacteria 1705
307 Ga0307412_10284194 3300031911 Bacteria 1300
308 Ga0307412_10476988 3300031911 Bacteria 1034
309 Ga0307412_10734282 3300031911 Bacteria 851
310 Ga0307409_100000495 3300031995 Bacteria 16945
311 Ga0307409_100012856 3300031995 Bacteria 5355
312 Ga0307409_100023585 3300031995 Bacteria 4268
313 Ga0307409_100206990 3300031995 Bacteria 1760
314 Ga0307409_100284796 3300031995 Bacteria 1529
315 Ga0307409_100511301 3300031995 Bacteria 1172
316 Ga0307409_101151043 3300031995 Bacteria 798
317 Ga0307409_101878310 3300031995 Bacteria 628
318 Ga0307416_100002455 3300032002 Bacteria 10649
319 Ga0307416_100031769 3300032002 Bacteria 3979
320 Ga0307416_100103762 3300032002 Bacteria 2483
321 Ga0307416_100204408 3300032002 Bacteria 1877
322 Ga0307416_100300777 3300032002 Bacteria 1594
323 Ga0307416_100320047 3300032002 Bacteria 1553
324 Ga0307416_101956841 3300032002 Bacteria 689
325 Ga0307416_103705601 3300032002 Bacteria 511
326 Ga0307414_10270302 3300032004 Bacteria 1423
327 Ga0307414_10765152 3300032004 Bacteria 879
328 Ga0307414_11238311 3300032004 Bacteria 691
329 Ga0307411_10009062 3300032005 Bacteria 5207
330 Ga0307411_10110946 3300032005 Bacteria 1962
331 Ga0307411_10317646 3300032005 Bacteria 1256
332 Ga0307411_10338814 3300032005 Bacteria 1221
333 Ga0307411_11114246 3300032005 Bacteria 712
334 Ga0307415_100001884 3300032126 Bacteria 10292
335 Ga0307415_100054701 3300032126 Bacteria 2726
336 Ga0307415_100080385 3300032126 Bacteria 2325
337 Ga0307415_100155660 3300032126 Bacteria 1764
338 Ga0307415_100500280 3300032126 Bacteria 1062
339 Ga0307415_100693040 3300032126 Bacteria 918
340 Ga0307415_102580334 3300032126 Bacteria 501
341 Ga0373950_0138980 3300034818 Bacteria 549
342 Ga0373926_0126756 3300035083 Bacteria 965
343 Ga0373942_0335721 3300035207 Bacteria 531
344 Ga0373962_0267222 3300035242 Bacteria 598
345 Ga0373931_0234345 3300035691 Bacteria 1110
346 Ga0395900_0805364 3300037418 Bacteria 867
347 Ga0395898_0011359 3300037466 Bacteria 9251
348 Ga0395905_1751674 3300037471 Bacteria 527
349 Ga0436364_0016193 3300037853 Unclassified 819
350 Ga0395901_0346249 3300038443 Bacteria 1534
351 Ga0395901_0376823 3300038443 Bacteria 1461
352 Ga0395901_1064529 3300038443 Bacteria 781
353 Ga0436362_0578189 3300039453 Unclassified 1044
354 Ga0439439_0196618 3300041406 Bacteria 585
355 Ga0451787_101789 3300041441 Bacteria 742
356 Ga0451793_1186035 3300041452 Bacteria 558
357 Ga0451806_474195 3300041462 Bacteria 820
358 Ga0451833_0992680 3300041491 Bacteria 641
359 Ga0451849_0530828 3300041505 Bacteria 693
360 Ga0451853_0130194 3300041512 Bacteria 930
361 Ga0451853_1234117 3300041512 Bacteria 518
362 Ga0439431_0005254 3300041997 Bacteria 2856
363 Ga0439431_0141327 3300041997 Bacteria 680
364 Ga0439448_0042181 3300042005 Bacteria 1479
365 Ga0439450_000215 3300042008 Bacteria 6902
366 Ga0439450_113960 3300042008 Bacteria 693
367 Ga0439451_120054 3300042009 Bacteria 535
368 Ga0439455_0001143 3300042012 Bacteria 4274
369 Ga0439455_0003906 3300042012 Bacteria 2903
370 Ga0439463_001355 3300042016 Bacteria 6529
371 Ga0439463_075262 3300042016 Bacteria 866
372 Ga0439463_097064 3300042016 Bacteria 759
373 Ga0450914_043659 3300042118 Bacteria 575
374 Ga0450920_030220 3300042122 Bacteria 1065
375 Ga0450891_020440 3300042129 Bacteria 649
376 Ga0450900_004990 3300042136 Bacteria 1551
377 Ga0450903_000207 3300042138 Bacteria 13042
378 Ga0450906_031092 3300042145 Bacteria 944
379 Ga0450907_062987 3300042146 Bacteria 641
380 Ga0439458_0002982 3300042157 Bacteria 4053
381 Ga0439458_0022568 3300042157 Bacteria 1463
382 Ga0439458_0153005 3300042157 Bacteria 619
383 Ga0439444_0000243 3300042437 Bacteria 5363
384 Ga0439459_0085479 3300042438 Bacteria 751
385 Ga0439464_0000168 3300042439 Bacteria 11019
386 Ga0450916_000120 3300042530 Bacteria 5335
387 Ga0450901_018295 3300042533 Bacteria 745
388 Ga0439440_0000111 3300042993 Bacteria 11142
389 Ga0439440_0013992 3300042993 Bacteria 1728
390 Ga0439440_0031025 3300042993 Bacteria 1262
391 Ga0466969_0001140 3300044656 Bacteria 14311
392 Ga0466969_0005042 3300044656 Bacteria 7027
393 Ga0466969_0020886 3300044656 Bacteria 3387
394 Ga0466972_0037699 3300044658 Bacteria 2363
395 Ga0466965_0005719 3300044683 Bacteria 5607
396 Ga0466966_0041865 3300044684 Bacteria 2942
397 Ga0466966_0075328 3300044684 Bacteria 2108
398 Ga0466966_0228575 3300044684 Bacteria 1123
399 Ga0466961_0017761 3300044693 Bacteria 4570
400 Ga0466961_0178592 3300044693 Bacteria 1319
401 Ga0466963_0000279 3300044694 Bacteria 22827
402 Ga0466963_0128825 3300044694 Bacteria 1747
403 Ga0466964_0011874 3300044706 Bacteria 3293
404 Ga0466971_0039878 3300044719 Bacteria 2108
405 Ga0466968_0133362 3300044735 Bacteria 1132
406 Ga0466970_0002248 3300044765 Bacteria 9322
407 Ga0466957_0000404 3300044842 Bacteria 21092
408 Ga0466960_0204223 3300044901 Bacteria 1081
409 Ga0466959_0000297 3300045049 Bacteria 29628
410 Ga0466959_0002662 3300045049 Bacteria 11459
411 Ga0466958_0020949 3300045836 Bacteria 3816
412 Ga0466958_0149759 3300045836 Bacteria 1472
413 Ga0466967_0018653 3300045976 Bacteria 5553
414 Ga0466967_0072321 3300045976 Bacteria 3090
415 Ga0466967_1284580 3300045976 Bacteria 729
416 Ga0495629_0142819 3300046459 Bacteria 1665
417 Ga0495582_0239112 3300046473 Bacteria 1041
418 Ga0495584_0057210 3300046491 Bacteria 1962
419 Ga0495628_0272730 3300046516 Unclassified 1258
420 Ga0495630_0480067 3300046517 Bacteria 953
421 Ga0495631_0142820 3300046518 Bacteria 1028
422 Ga0495663_0010474 3300046525 Bacteria 2580
423 Ga0495642_0061623 3300046528 Bacteria 1557
424 Ga0495609_0142533 3300046538 Bacteria 1022
425 Ga0495597_0402101 3300046542 Bacteria 521
426 Ga0495656_0659420 3300046615 Bacteria 562
427 Ga0495625_0026266 3300046660 Bacteria 4403
428 Ga0495635_0065670 3300046663 Bacteria 2489
429 Ga0495635_0227971 3300046663 Bacteria 1259
430 Ga0495670_0107312 3300046691 Bacteria 1443
431 Ga0495589_0017567 3300046794 Bacteria 3671
432 Ga0495674_0954863 3300047319 Bacteria 659
433 Ga0495672_0006947 3300047320 Bacteria 8614
434 Ga0495676_0130834 3300047321 Bacteria 1812
435 Ga0495676_0451287 3300047321 Bacteria 848
436 Ga0495680_0312219 3300047322 Unclassified 1102
437 Ga0495685_002836 3300047447 Bacteria 5470
438 Ga0496100_0008669 3300048903 Bacteria 5678
439 Ga0496101_0017508 3300048904 Bacteria 4860
440 Ga0496102_0000938 3300048905 Bacteria 27521
441 Ga0496103_0001784 3300048906 Bacteria 14044
442 Ga0496103_0568261 3300048906 Bacteria 723
443 Ga0496106_0001034 3300048909 Bacteria 20471
444 Ga0496107_0001740 3300048910 Bacteria 13694
445 Ga0496112_0110745 3300048915 Bacteria 2716
446 Ga0496113_1221932 3300048916 Unclassified 586
447 Ga0496114_0010783 3300048917 Bacteria 7274
448 Ga0496114_0777931 3300048917 Bacteria 835
449 Ga0496115_0002053 3300048918 Bacteria 14415
450 Ga0501031_0046867 3300049568 Bacteria 2819
451 Ga0501031_0253868 3300049568 Bacteria 1143
452 Ga0501031_0629901 3300049568 Bacteria 690
453 Ga0501037_0332062 3300049573 Bacteria 1051
454 Ga0501038_0877021 3300049574 Bacteria 663
455 Ga0501039_0360826 3300049575 Bacteria 1142
456 Ga0501040_0315928 3300049576 Bacteria 1117
457 Ga0501040_0435119 3300049576 Bacteria 944
458 Ga0501040_0879499 3300049576 Bacteria 649
459 Ga0501042_0604560 3300049578 Bacteria 797
460 Ga0501046_0583052 3300049580 Bacteria 795
461 Ga0501067_0004905 3300049583 Bacteria 7434
462 Ga0501068_0482844 3300049584 Bacteria 803
463 Ga0501068_0705351 3300049584 Bacteria 660
464 Ga0501069_0048125 3300049585 Bacteria 2367
465 Ga0501071_1445475 3300049587 Bacteria 531
466 Ga0501072_0265096 3300049588 Bacteria 1367
467 Ga0501072_0686838 3300049588 Bacteria 805
468 Ga0501073_0041605 3300049589 Bacteria 3247
469 Ga0501074_0043448 3300049590 Bacteria 3253
470 Ga0501076_1303556 3300049592 Bacteria 597
471 Ga0501208_053951 3300049655 Bacteria 773
472 Ga0501243_101339 3300049675 Bacteria 582
473 Ga0501225_0172019 3300049705 Bacteria 672
474 Ga0501245_055077 3300049708 Bacteria 714
475 Ga0501079_0046025 3300049741 Bacteria 3367
476 Ga0501080_0031206 3300049742 Bacteria 4965
477 Ga0501080_0421272 3300049742 Bacteria 1199
478 Ga0501081_0736148 3300049743 Bacteria 741
479 Ga0501083_0974273 3300049744 Bacteria 552
480 Ga0501271_004724 3300049768 Bacteria 1303
481 Ga0501035_0608165 3300049822 Bacteria 890
482 Ga0501035_0996287 3300049822 Bacteria 659
483 Ga0501045_0152443 3300049824 Bacteria 1720
484 Ga0501212_016293 3300049851 Bacteria 1115
485 nmdc:mga05p37_1251_c1 3300050507 Bacteria 29488
486 nmdc:mga05p37_406738_c1 3300050507 Bacteria 1588
487 nmdc:mga05p37_544736_c1 3300050507 Bacteria 1322
488 nmdc:mga09592_4153_c1 3300050508 Bacteria 11702
489 nmdc:mga0qj67_1821_c1 3300050509 Bacteria 15093
490 nmdc:mga06r32_1271612_c1 3300050510 Bacteria 680
491 nmdc:mga06r32_3460_c1 3300050510 Bacteria 14096
492 nmdc:mga08y16_145946_c1 3300050511 Bacteria 2460
493 nmdc:mga08y16_26562_c1 3300050511 Bacteria 6103
494 nmdc:mga08y16_999871_c1 3300050511 Bacteria 816
495 nmdc:mga0n895_110938_c1 3300050512 Bacteria 2759
496 nmdc:mga0n895_135544_c1 3300050512 Bacteria 2489
497 nmdc:mga0rr50_1745393_c1 3300050513 Unclassified 524
498 nmdc:mga0rr50_295636_c1 3300050513 Bacteria 1354
499 nmdc:mga0rr50_704124_c1 3300050513 Bacteria 862
500 nmdc:mga0rr50_946381_c1 3300050513 Bacteria 734
501 nmdc:mga0a205_501620_c1 3300050515 Bacteria 1070
502 nmdc:mga0a205_5577_c1 3300050515 Bacteria 11338
503 nmdc:mga0a205_9374_c1 3300050515 Bacteria 8946
504 Ga0495601_0214791 3300053077 Bacteria 1256
505 Ga0495601_0423900 3300053077 Unclassified 862
506 Ga0495595_0044962 3300053084 Bacteria 2030
507 Ga0495619_0293552 3300053085 Bacteria 1126
508 Ga0495619_0403934 3300053085 Bacteria 943
509 Ga0500566_0190342 3300053094 Bacteria 1045
510 Ga0500618_000013 3300053125 Bacteria 183026
511 Ga0500600_0055739 3300053149 Bacteria 2225
512 Ga0501084_0204218 3300054114 Bacteria 1668
513 Ga0590071_002810 3300059421 Bacteria 4360
514 Ga0590074_001398 3300059423 Bacteria 3875
515 Ga0590075_003016 3300059424 Bacteria 4008
516 Ga0590075_080528 3300059424 Bacteria 844
517 Ga0590077_008918 3300059426 Bacteria 2054
518 Ga0466962_0002489 3300061719 Bacteria 8730
519 Ga0466962_0613225 3300061719 Bacteria 555
520 Ga0530510_0657886 3300061734 Bacteria 798
521 Ga0530510_0684280 3300061734 Bacteria 781
522 2558908216 2558860112 Bacteria 9931328
523 2644265135 2643221647 Bacteria 10741251
524 2738887341 2738541308 Bacteria 7020677
525 2739238950 2738543011 Bacteria 5731169
526 2785346932 2784746763 Bacteria 9783172
527 2786667206 2786546132 Bacteria 10419719
528 2808873666 2808606365 Bacteria 4301966
529 2862294846 2862290372 Bacteria 7471434
530 2862574897 2862574272 Bacteria 10567477
531 2889303920 2889300758 Bacteria 5690814
532 2939745702 2939743619 Bacteria 5762299
533 2954389614 2954380949 Bacteria 10050426
534 2954682294 2954673503 Bacteria 9685905
535 2954690630 2954682443 Bacteria 9862841
536 2954700455 2954691527 Bacteria 10720516
537 2954701773 2954701450 Bacteria 10834262
538 2990066042 2990059506 Bacteria 9321252
539 3003000491 3002998708 Bacteria 11715108
540 8023625307 8023623736 Bacteria 8593882
541 Ga0081538_10013006
542 JGI24739J22299_10002443
543 JGI24737J22298_10186582
544 JGI24750J21931_1088493
545 JGI24745J21846_1056846
546 JGI24738J21930_10060165
547 JGI24034J26672_10014790
548 JGI25153J46596_10085675
549 rootH2_10203119
550 JGI25407J50210_10020426
551 JGI25407J50210_10059335
552 JGI25407J50210_10113593
553 Ga0055526_1011099
554 Ga0065712_10341040
555 Ga0070676_10047381
556 Ga0070676_11237963
557 Ga0070683_100870362
558 Ga0070683_101414135
559 Ga0070690_100004021
560 Ga0068869_100001880
561 Ga0070666_10113368
562 Ga0070666_11056025
563 Ga0070680_100108886
564 Ga0070682_100008530
565 Ga0068868_100010915
566 Ga0068868_100661929
567 Ga0068868_101613021
568 Ga0070660_100009735
569 Ga0070660_100302651
570 Ga0070660_100427361
571 Ga0070689_100054464
572 Ga0070691_10002146
573 Ga0070692_10122222
574 Ga0070668_100016070
575 Ga0070668_100174445
576 Ga0070675_100024435
577 Ga0070671_100203276
578 Ga0070671_100333103
579 Ga0070671_101645888
580 Ga0070674_100000574
581 Ga0070674_100001125
582 Ga0070688_100004186
583 Ga0070659_100022882
584 Ga0070667_100010725
585 Ga0070667_100024860
586 Ga0070703_10229183
587 Ga0070709_10060837
588 Ga0070714_100947204
589 Ga0070710_10001741
590 Ga0070710_11427740
591 Ga0070701_10002996
592 Ga0070711_100000116
593 Ga0070711_100052191
594 Ga0070705_100023722
595 Ga0070700_100000880
596 Ga0070700_100229091
597 Ga0070694_100012805
598 Ga0070708_100158970
599 Ga0070663_100003254
600 Ga0070663_101006794
601 Ga0070678_100000663
602 Ga0070662_100021812
603 Ga0070662_100268054
604 Ga0068867_100000745
605 Ga0070685_10103237
606 Ga0070706_100012864
607 Ga0070706_100212470
608 Ga0070706_101131495
609 Ga0070706_101280294
610 Ga0070707_100027153
611 Ga0070707_100081813
612 Ga0070698_100084144
613 Ga0070699_100453175
614 Ga0070679_100878200
615 Ga0070679_101116551
616 Ga0070684_100289687
617 Ga0068853_100006330
618 Ga0070672_100238210
619 Ga0070672_100298472
620 Ga0070695_100048699
621 Ga0070696_100008742
622 Ga0070665_100030084
623 Ga0070665_102648053
624 Ga0070704_100001170
625 Ga0068855_100000041
626 Ga0068855_100307474
627 Ga0068855_100318406
628 Ga0070664_102118728
629 Ga0068854_100001778
630 Ga0068856_100204787
631 Ga0068856_101961012
632 Ga0070702_100000561
633 Ga0070702_101203307
634 Ga0070702_101330698
635 Ga0068852_100919958
636 Ga0068859_100011843
637 Ga0068866_10003067
638 Ga0068858_100013105
639 Ga0068860_100002961
640 Ga0068862_100004932
641 Ga0068862_101159432
642 Ga0081455_10028923
643 Ga0081455_10076670
644 Ga0081455_10092353
645 Ga0081455_10867598
646 Ga0081538_10002706
647 Ga0081538_10008133
648 Ga0081538_10008975
649 Ga0081538_10024297
650 Ga0081538_10045572
651 Ga0081539_10036715
652 Ga0070715_10014930
653 Ga0070715_10334908
654 Ga0070716_100001726
655 Ga0070712_100001799
656 Ga0075362_10576655
657 Ga0097621_100412303
658 Ga0075428_100010844
659 Ga0075428_100817767
660 Ga0075430_100002552
661 Ga0075431_100016967
662 Ga0075431_100832570
663 Ga0075433_10027996
664 Ga0075433_10117731
665 Ga0075434_100091143
666 Ga0075434_100109668
667 Ga0075429_100119652
668 Ga0068865_100003056
669 Ga0097620_100011844
670 Ga0099826_10042232
671 Ga0075435_100036985
672 Ga0075435_100510170
673 Ga0105240_10054358
674 Ga0105240_10199631
675 Ga0111539_10013331
676 Ga0111539_10359838
677 Ga0111539_11195113
678 Ga0105245_10002644
679 Ga0105245_10496001
680 Ga0105245_11357899
681 Ga0105245_12445449
682 Ga0105245_13186019
683 Ga0105247_10005995
684 Ga0114129_10090162
685 Ga0114129_10308390
686 Ga0114129_10321422
687 Ga0114129_13159568
688 Ga0105243_10000354
689 Ga0105243_10005121
690 Ga0105243_10303303
691 Ga0105241_10227495
692 Ga0105241_11527488
693 Ga0105242_10000740
694 Ga0105242_13161191
695 Ga0105248_10008276
696 Ga0105248_10223295
697 Ga0105248_12173784
698 Ga0105237_10084752
699 Ga0105237_10847746
700 Ga0105238_10030486
701 Ga0105238_10128530
702 Ga0105238_12238593
703 Ga0105249_10091980
704 Ga0105239_10011949
705 Ga0105246_11106412
706 Ga0157374_10150338
707 Ga0157374_11328711
708 Ga0157378_10032730
709 Ga0157378_11778687
710 Ga0163162_10121915
711 Ga0163162_13174961
712 Ga0157375_10001039
713 Ga0157375_10015432
714 Ga0157375_10896799
715 Ga0157375_11414201
716 Ga0157380_10000278
717 Ga0157380_11383702
718 Ga0157377_10093460
719 Ga0157379_10056028
720 Ga0157376_10008320
721 Ga0157376_12006166
722 Ga0157376_12461241
723 Ga0163161_10001911
724 Ga0163161_11965891
725 Ga0209455_1011253
726 Ga0209564_1000997
727 Ga0209758_1008355
728 Ga0207692_10010560
729 Ga0207642_10003614
730 Ga0207710_10104596
731 Ga0207688_10000743
732 Ga0207680_10028039
733 Ga0207647_10032864
734 Ga0207685_10003998
735 Ga0207685_10241330
736 Ga0207699_10374741
737 Ga0207699_10440912
738 Ga0207645_10020868
739 Ga0207684_10019287
740 Ga0207684_10111609
741 Ga0207684_11391649
742 Ga0207695_10279004
743 Ga0207695_10335280
744 Ga0207671_10048249
745 Ga0207671_10568115
746 Ga0207693_10004614
747 Ga0207663_10012178
748 Ga0207663_10054692
749 Ga0207657_10017907
750 Ga0207646_10023682
751 Ga0207646_10197799
752 Ga0207646_10445127
753 Ga0207681_10290120
754 Ga0207694_10005110
755 Ga0207659_10161211
756 Ga0207687_10006446
757 Ga0207687_10152440
758 Ga0207687_11855282
759 Ga0207700_10026674
760 Ga0207664_10118821
761 Ga0207644_10044792
762 Ga0207644_11217873
763 Ga0207690_11018035
764 Ga0207706_10001473
765 Ga0207706_10013458
766 Ga0207686_10002695
767 Ga0207709_10005038
768 Ga0207709_10130013
769 Ga0207709_10195090
770 Ga0207670_10804555
771 Ga0207669_10002808
772 Ga0207669_10011810
773 Ga0207669_10522479
774 Ga0207704_10009035
775 Ga0207665_10027866
776 Ga0207691_10156961
777 Ga0207691_10425699
778 Ga0207711_10006148
779 Ga0207711_10615257
780 Ga0207689_10043322
781 Ga0207661_10035141
782 Ga0207679_10121280
783 Ga0207667_10000621
784 Ga0207667_10628689
785 Ga0207712_10020323
786 Ga0207668_10110887
787 Ga0207640_10004277
788 Ga0207658_10053353
789 Ga0207658_10118067
790 Ga0207677_10023535
791 Ga0207677_10905430
792 Ga0207677_11579503
793 Ga0207703_10031836
794 Ga0207639_10003677
795 Ga0207639_10071491
796 Ga0207678_10036054
797 Ga0207708_10000742
798 Ga0207708_10218360
799 Ga0207648_10000085
800 Ga0207648_10062401
801 Ga0207675_100001558
802 Ga0207683_10001356
803 Ga0207698_10690977
804 Ga0209282_1117494
805 Ga0207428_10002338
806 Ga0207428_10356368
807 Ga0207428_10546182
808 Ga0268266_10035750
809 Ga0268265_10015195
810 Ga0268264_10021581
811 Ga0316179_1088580
812 Ga0307408_100060114
813 Ga0307408_100090747
814 Ga0307408_100136138
815 Ga0265314_10085513
816 Ga0265342_10008995
817 Ga0307516_10297099
818 Ga0307405_10008108
819 Ga0307405_10111516
820 Ga0307405_10234927
821 Ga0307405_11578409
822 Ga0307413_10009215
823 Ga0307413_10142235
824 Ga0307413_10259665
825 Ga0307413_10849098
826 Ga0307413_12111475
827 Ga0307410_10001770
828 Ga0307410_10009103
829 Ga0307410_10062177
830 Ga0307410_10130570
831 Ga0307410_10499580
832 Ga0307410_10900661
833 Ga0307406_10010236
834 Ga0307406_10020047
835 Ga0307406_10151519
836 Ga0307406_10181318
837 Ga0307406_10190816
838 Ga0307406_10237673
839 Ga0307407_10188909
840 Ga0307407_10190358
841 Ga0307407_10383133
842 Ga0307407_10432251
843 Ga0307407_11053294
844 Ga0307412_10053540
845 Ga0307412_10112067
846 Ga0307412_10152898
847 Ga0307412_10284194
848 Ga0307412_10476988
849 Ga0307412_10734282
850 Ga0307409_100000495
851 Ga0307409_100012856
852 Ga0307409_100023585
853 Ga0307409_100206990
854 Ga0307409_100284796
855 Ga0307409_100511301
856 Ga0307409_101151043
857 Ga0307409_101878310
858 Ga0307416_100002455
859 Ga0307416_100031769
860 Ga0307416_100103762
861 Ga0307416_100204408
862 Ga0307416_100300777
863 Ga0307416_100320047
864 Ga0307416_101956841
865 Ga0307416_103705601
866 Ga0307414_10270302
867 Ga0307414_10765152
868 Ga0307414_11238311
869 Ga0307411_10009062
870 Ga0307411_10110946
871 Ga0307411_10317646
872 Ga0307411_10338814
873 Ga0307411_11114246
874 Ga0307415_100001884
875 Ga0307415_100054701
876 Ga0307415_100080385
877 Ga0307415_100155660
878 Ga0307415_100500280
879 Ga0307415_100693040
880 Ga0307415_102580334
881 Ga0373950_0138980
882 Ga0373926_0126756
883 Ga0373942_0335721
884 Ga0373962_0267222
885 Ga0373931_0234345
886 Ga0395900_0805364
887 Ga0395898_0011359
888 Ga0395905_1751674
889 Ga0436364_0016193
890 Ga0395901_0346249
891 Ga0395901_0376823
892 Ga0395901_1064529
893 Ga0436362_0578189
894 Ga0439439_0196618
895 Ga0451787_101789
896 Ga0451793_1186035
897 Ga0451806_474195
898 Ga0451833_0992680
899 Ga0451849_0530828
900 Ga0451853_0130194
901 Ga0451853_1234117
902 Ga0439431_0005254
903 Ga0439431_0141327
904 Ga0439448_0042181
905 Ga0439450_000215
906 Ga0439450_113960
907 Ga0439451_120054
908 Ga0439455_0001143
909 Ga0439455_0003906
910 Ga0439463_001355
911 Ga0439463_075262
912 Ga0439463_097064
913 Ga0450914_043659
914 Ga0450920_030220
915 Ga0450891_020440
916 Ga0450900_004990
917 Ga0450903_000207
918 Ga0450906_031092
919 Ga0450907_062987
920 Ga0439458_0002982
921 Ga0439458_0022568
922 Ga0439458_0153005
923 Ga0439444_0000243
924 Ga0439459_0085479
925 Ga0439464_0000168
926 Ga0450916_000120
927 Ga0450901_018295
928 Ga0439440_0000111
929 Ga0439440_0013992
930 Ga0439440_0031025
931 Ga0466969_0001140
932 Ga0466969_0005042
933 Ga0466969_0020886
934 Ga0466972_0037699
935 Ga0466965_0005719
936 Ga0466966_0041865
937 Ga0466966_0075328
938 Ga0466966_0228575
939 Ga0466961_0017761
940 Ga0466961_0178592
941 Ga0466963_0000279
942 Ga0466963_0128825
943 Ga0466964_0011874
944 Ga0466971_0039878
945 Ga0466968_0133362
946 Ga0466970_0002248
947 Ga0466957_0000404
948 Ga0466960_0204223
949 Ga0466959_0000297
950 Ga0466959_0002662
951 Ga0466958_0020949
952 Ga0466958_0149759
953 Ga0466967_0018653
954 Ga0466967_0072321
955 Ga0466967_1284580
956 Ga0495629_0142819
957 Ga0495582_0239112
958 Ga0495584_0057210
959 Ga0495628_0272730
960 Ga0495630_0480067
961 Ga0495631_0142820
962 Ga0495663_0010474
963 Ga0495642_0061623
964 Ga0495609_0142533
965 Ga0495597_0402101
966 Ga0495656_0659420
967 Ga0495625_0026266
968 Ga0495635_0065670
969 Ga0495635_0227971
970 Ga0495670_0107312
971 Ga0495589_0017567
972 Ga0495674_0954863
973 Ga0495672_0006947
974 Ga0495676_0130834
975 Ga0495676_0451287
976 Ga0495680_0312219
977 Ga0495685_002836
978 Ga0496100_0008669
979 Ga0496101_0017508
980 Ga0496102_0000938
981 Ga0496103_0001784
982 Ga0496103_0568261
983 Ga0496106_0001034
984 Ga0496107_0001740
985 Ga0496112_0110745
986 Ga0496113_1221932
987 Ga0496114_0010783
988 Ga0496114_0777931
989 Ga0496115_0002053
990 Ga0501031_0046867
991 Ga0501031_0253868
992 Ga0501031_0629901
993 Ga0501037_0332062
994 Ga0501038_0877021
995 Ga0501039_0360826
996 Ga0501040_0315928
997 Ga0501040_0435119
998 Ga0501040_0879499
999 Ga0501042_0604560
1000 Ga0501046_0583052
1001 Ga0501067_0004905
1002 Ga0501068_0482844
1003 Ga0501068_0705351
1004 Ga0501069_0048125
1005 Ga0501071_1445475
1006 Ga0501072_0265096
1007 Ga0501072_0686838
1008 Ga0501073_0041605
1009 Ga0501074_0043448
1010 Ga0501076_1303556
1011 Ga0501208_053951
1012 Ga0501243_101339
1013 Ga0501225_0172019
1014 Ga0501245_055077
1015 Ga0501079_0046025
1016 Ga0501080_0031206
1017 Ga0501080_0421272
1018 Ga0501081_0736148
1019 Ga0501083_0974273
1020 Ga0501271_004724
1021 Ga0501035_0608165
1022 Ga0501035_0996287
1023 Ga0501045_0152443
1024 Ga0501212_016293
1025 nmdc:mga05p37_1251_c1
1026 nmdc:mga05p37_406738_c1
1027 nmdc:mga05p37_544736_c1
1028 nmdc:mga09592_4153_c1
1029 nmdc:mga0qj67_1821_c1
1030 nmdc:mga06r32_1271612_c1
1031 nmdc:mga06r32_3460_c1
1032 nmdc:mga08y16_145946_c1
1033 nmdc:mga08y16_26562_c1
1034 nmdc:mga08y16_999871_c1
1035 nmdc:mga0n895_110938_c1
1036 nmdc:mga0n895_135544_c1
1037 nmdc:mga0rr50_1745393_c1
1038 nmdc:mga0rr50_295636_c1
1039 nmdc:mga0rr50_704124_c1
1040 nmdc:mga0rr50_946381_c1
1041 nmdc:mga0a205_501620_c1
1042 nmdc:mga0a205_5577_c1
1043 nmdc:mga0a205_9374_c1
1044 Ga0495601_0214791
1045 Ga0495601_0423900
1046 Ga0495595_0044962
1047 Ga0495619_0293552
1048 Ga0495619_0403934
1049 Ga0500566_0190342
1050 Ga0500618_000013
1051 Ga0500600_0055739
1052 Ga0501084_0204218
1053 Ga0590071_002810
1054 Ga0590074_001398
1055 Ga0590075_003016
1056 Ga0590075_080528
1057 Ga0590077_008918
1058 Ga0466962_0002489
1059 Ga0466962_0613225
1060 Ga0530510_0657886
1061 Ga0530510_0684280
1062 2558908216
1063 2644265135
1064 2738887341
1065 2739238950
1066 2785346932
1067 2786667206
1068 2808873666
1069 2862294846
1070 2862574897
1071 2889303920
1072 2939745702
1073 2954389614
1074 2954682294
1075 2954690630
1076 2954700455
1077 2954701773
1078 2990066042
1079 3003000491
1080 8023625307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08922

DUF1905

Domain of unknown function (DUF1905)

22

100

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8604 14 98
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8421 14 98
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.692 12 102
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.679 12 102
5trd-assembly1.cif.gz_B structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator 0.6487 9 97
ID Description Score Start End Superfamily
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8662 14 98 2.40.30.100
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8473 14 98 2.40.30.100
5trdB02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Riboflavin kinase-like 0.6909 12 97 2.40.30.30
af_A0A0R0IAC5_4_96_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6359 14 101 2.40.330.10
af_P0DH85_455_552_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6244 15 95 2.40.330.10
ID Description Score Start End GO Terms
AF-A0A7Y6I7L9-F1-model_v4 DUF1905 domain-containing protein 0.9617 14 66
AF-A0A239CKZ0-F1-model_v4 DUF1905 domain-containing protein 0.955 14 102
AF-A0A841BEH2-F1-model_v4 DUF1905 domain-containing protein 0.955 14 102
AF-A0A3N1DDJ7-F1-model_v4 deleted 0.9547 14 102
AF-A0A538J657-F1-model_v4 DUF1905 domain-containing protein 0.9526 12 101

Map