F461209

General Info

Members Datasets Scaffolds Average Seq Length
540 294 1080 139

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100080947|Ga0070708_1000809472
Length 165
Sequence MGDRRPRRNRANPNQLELRMKKAIPAESASELIDQLIARLTDWRGKTLAGIRKSILDSDREIIEEWKWMGSPTWSRDGIIAVATALKDKMKLTFAHGASLPDPDKLFNAGLKGNAWRAIDFFEGDKINERALKNLVRAAVEYNLIKLKSKAPAGPRAKVQKRKKR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
97 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
146 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
279 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
280 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
283 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
284 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
287 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
291 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
292 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
293 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
294 2941499720 Ensifer sp. 4252 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 1.11
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 0.56
Rhizoplane 4.81
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100080947 3300005445 Bacteria 2939
2 JGI24739J22299_10001796 3300001989 Bacteria 8169
3 JGI24735J21928_10029731 3300002067 Bacteria 1625
4 Ga0065715_10952327 3300005293 Bacteria 559
5 Ga0070658_10266942 3300005327 Bacteria 1454
6 Ga0070683_100761197 3300005329 Bacteria 928
7 Ga0068869_100036281 3300005334 Bacteria 3500
8 Ga0068869_101304369 3300005334 Bacteria 640
9 Ga0070680_100129305 3300005336 Bacteria 2112
10 Ga0070682_100006405 3300005337 Bacteria 6612
11 Ga0070660_100016968 3300005339 Bacteria 5300
12 Ga0070691_10466936 3300005341 Bacteria 723
13 Ga0070661_100313911 3300005344 Bacteria 1223
14 Ga0070668_100217238 3300005347 Bacteria 1575
15 Ga0070668_100316053 3300005347 Bacteria 1314
16 Ga0070668_100690322 3300005347 Bacteria 899
17 Ga0070675_100658661 3300005354 Bacteria 952
18 Ga0070675_101715079 3300005354 Bacteria 580
19 Ga0070674_100457973 3300005356 Bacteria 1054
20 Ga0070709_10048953 3300005434 Bacteria 2640
21 Ga0070709_10107490 3300005434 Bacteria 1870
22 Ga0070709_10107498 3300005434 Bacteria 1870
23 Ga0070714_100082958 3300005435 Bacteria 2794
24 Ga0070713_100002596 3300005436 Bacteria 11802
25 Ga0070713_100005906 3300005436 Bacteria 8416
26 Ga0070713_100102727 3300005436 Bacteria 2479
27 Ga0070713_100141790 3300005436 Bacteria 2129
28 Ga0070713_100817596 3300005436 Bacteria 894
29 Ga0070713_100909191 3300005436 Bacteria 847
30 Ga0070710_10002141 3300005437 Bacteria 9362
31 Ga0070710_10014502 3300005437 Bacteria 3969
32 Ga0070710_10042314 3300005437 Bacteria 2518
33 Ga0070711_100012235 3300005439 Bacteria 5356
34 Ga0070711_100032979 3300005439 Bacteria 3446
35 Ga0070711_100037447 3300005439 Bacteria 3255
36 Ga0070711_100043172 3300005439 Bacteria 3052
37 Ga0070711_100094079 3300005439 Bacteria 2166
38 Ga0070711_100330724 3300005439 Bacteria 1220
39 Ga0070705_100021047 3300005440 Bacteria 3463
40 Ga0070705_100056053 3300005440 Bacteria 2319
41 Ga0070700_100063337 3300005441 Bacteria 2339
42 Ga0070694_100165914 3300005444 Bacteria 1624
43 Ga0070708_100040486 3300005445 Bacteria 4080
44 Ga0070708_100075327 3300005445 Bacteria 3046
45 Ga0070708_100086105 3300005445 Bacteria 2853
46 Ga0070708_100122377 3300005445 Bacteria 2401
47 Ga0070708_100305017 3300005445 Bacteria 1499
48 Ga0070708_101052223 3300005445 Bacteria 763
49 Ga0070663_100003874 3300005455 Bacteria 8717
50 Ga0070678_100775033 3300005456 Bacteria 869
51 Ga0070681_10006015 3300005458 Bacteria 11758
52 Ga0070681_10081160 3300005458 Bacteria 3199
53 Ga0068867_101252438 3300005459 Bacteria 683
54 Ga0070706_100022427 3300005467 Bacteria 5812
55 Ga0070706_100023021 3300005467 Bacteria 5737
56 Ga0070706_100024327 3300005467 Bacteria 5575
57 Ga0070706_100034029 3300005467 Bacteria 4704
58 Ga0070706_100047279 3300005467 Bacteria 3970
59 Ga0070706_100343015 3300005467 Bacteria 1393
60 Ga0070706_101032663 3300005467 Bacteria 758
61 Ga0070707_100023193 3300005468 Bacteria 5870
62 Ga0070707_100358486 3300005468 Bacteria 1416
63 Ga0070707_100469427 3300005468 Bacteria 1219
64 Ga0070707_101132262 3300005468 Bacteria 749
65 Ga0070698_100001748 3300005471 Bacteria 24226
66 Ga0070698_100046129 3300005471 Bacteria 4457
67 Ga0070698_100121276 3300005471 Bacteria 2575
68 Ga0070698_100137417 3300005471 Bacteria 2397
69 Ga0070699_100043316 3300005518 Bacteria 3896
70 Ga0070679_100027335 3300005530 Bacteria 5614
71 Ga0070679_100028299 3300005530 Bacteria 5525
72 Ga0070684_100262225 3300005535 Bacteria 1581
73 Ga0070697_100013062 3300005536 Bacteria 6509
74 Ga0070697_100018049 3300005536 Bacteria 5559
75 Ga0070697_100033791 3300005536 Bacteria 4121
76 Ga0070697_100213748 3300005536 Bacteria 1642
77 Ga0068853_100006983 3300005539 Bacteria 9021
78 Ga0068853_100289836 3300005539 Bacteria 1511
79 Ga0068853_101141857 3300005539 Bacteria 752
80 Ga0070686_100725520 3300005544 Bacteria 795
81 Ga0070695_100010259 3300005545 Bacteria 5590
82 Ga0070695_100459955 3300005545 Bacteria 977
83 Ga0070696_100011148 3300005546 Bacteria 6014
84 Ga0070693_100000041 3300005547 Bacteria 49532
85 Ga0070693_100017831 3300005547 Bacteria 3699
86 Ga0070665_100023861 3300005548 Bacteria 6162
87 Ga0070665_100061332 3300005548 Bacteria 3769
88 Ga0070665_100080960 3300005548 Bacteria 3253
89 Ga0070665_100284640 3300005548 Bacteria 1655
90 Ga0070704_100071898 3300005549 Bacteria 2515
91 Ga0070704_100233779 3300005549 Bacteria 1501
92 Ga0068855_100047493 3300005563 Bacteria 5072
93 Ga0068855_100083145 3300005563 Bacteria 3709
94 Ga0070664_100088415 3300005564 Bacteria 2679
95 Ga0068857_100015352 3300005577 Bacteria 6688
96 Ga0068857_100280512 3300005577 Bacteria 1532
97 Ga0068857_100860592 3300005577 Bacteria 868
98 Ga0068854_100495519 3300005578 Bacteria 1028
99 Ga0070702_100063029 3300005615 Bacteria 2163
100 Ga0068852_101173323 3300005616 Bacteria 789
101 Ga0068864_101117831 3300005618 Bacteria 785
102 Ga0068861_100174433 3300005719 Bacteria 1784
103 Ga0068851_10103943 3300005834 Bacteria 1510
104 Ga0068863_100143973 3300005841 Bacteria 2279
105 Ga0068863_101051866 3300005841 Bacteria 818
106 Ga0068858_100555228 3300005842 Bacteria 1112
107 Ga0068862_101336972 3300005844 Bacteria 719
108 Ga0070717_10002492 3300006028 Bacteria 12996
109 Ga0070717_10071533 3300006028 Bacteria 2894
110 Ga0070717_10113609 3300006028 Bacteria 2312
111 Ga0070717_10505377 3300006028 Bacteria 1092
112 Ga0070717_10907743 3300006028 Bacteria 802
113 Ga0075365_10026848 3300006038 Bacteria 3659
114 Ga0075365_10029796 3300006038 Bacteria 3491
115 Ga0075365_10413919 3300006038 Bacteria 951
116 Ga0075364_10893527 3300006051 Bacteria 605
117 Ga0070715_10052994 3300006163 Bacteria 1752
118 Ga0070715_10142821 3300006163 Bacteria 1165
119 Ga0070715_10574882 3300006163 Bacteria 657
120 Ga0070716_100003644 3300006173 Bacteria 7283
121 Ga0070716_100017213 3300006173 Bacteria 3744
122 Ga0070716_100037577 3300006173 Bacteria 2677
123 Ga0070716_100428149 3300006173 Bacteria 959
124 Ga0070712_100053669 3300006175 Bacteria 2815
125 Ga0070712_100112456 3300006175 Bacteria 2034
126 Ga0070712_100144425 3300006175 Bacteria 1820
127 Ga0075362_10000915 3300006177 Bacteria 8957
128 Ga0075367_10018929 3300006178 Bacteria 3808
129 Ga0075367_10018931 3300006178 Bacteria 3808
130 Ga0075367_10076661 3300006178 Bacteria 2018
131 Ga0075367_10193645 3300006178 Bacteria 1269
132 Ga0075367_10216652 3300006178 Bacteria 1198
133 Ga0075367_10379436 3300006178 Bacteria 893
134 Ga0075369_10004842 3300006186 Bacteria 5009
135 Ga0097621_100016551 3300006237 Bacteria 5577
136 Ga0097621_100093193 3300006237 Bacteria 2524
137 Ga0097621_100486902 3300006237 Bacteria 1116
138 Ga0097621_101359090 3300006237 Bacteria 672
139 Ga0075370_10002063 3300006353 Bacteria 9137
140 Ga0068871_100018252 3300006358 Bacteria 5328
141 Ga0068871_100027687 3300006358 Bacteria 4435
142 Ga0068871_100416416 3300006358 Bacteria 1199
143 Ga0068871_100589909 3300006358 Bacteria 1010
144 Ga0075434_100067855 3300006871 Bacteria 3553
145 Ga0075435_100136405 3300007076 Bacteria 2056
146 Ga0075435_100353482 3300007076 Bacteria 1260
147 Ga0099794_10007873 3300007265 Bacteria 4403
148 Ga0099794_10012152 3300007265 Bacteria 3705
149 Ga0099794_10038517 3300007265 Bacteria 2266
150 Ga0099794_10194962 3300007265 Bacteria 1037
151 Ga0099794_10656296 3300007265 Bacteria 557
152 Ga0105251_10000837 3300009011 Bacteria 27603
153 Ga0105240_10000034 3300009093 Bacteria 278179
154 Ga0105240_10048482 3300009093 Bacteria 5368
155 Ga0105240_10134550 3300009093 Bacteria 2961
156 Ga0105240_10546993 3300009093 Bacteria 1281
157 Ga0105247_10289079 3300009101 Bacteria 1133
158 Ga0114129_10441808 3300009147 Unclassified 1707
159 Ga0105243_10802408 3300009148 Bacteria 928
160 Ga0105241_10050154 3300009174 Bacteria 3180
161 Ga0105241_10305528 3300009174 Bacteria 1367
162 Ga0105248_10012438 3300009177 Bacteria 9388
163 Ga0105248_10776422 3300009177 Bacteria 1081
164 Ga0105237_10019001 3300009545 Bacteria 7103
165 Ga0105237_10036872 3300009545 Bacteria 4946
166 Ga0105237_10459119 3300009545 Bacteria 1280
167 Ga0105238_10655117 3300009551 Bacteria 1060
168 Ga0105238_11191184 3300009551 Bacteria 786
169 Ga0105238_11636811 3300009551 Bacteria 674
170 Ga0105249_10654580 3300009553 Bacteria 1108
171 Ga0105249_11401516 3300009553 Bacteria 771
172 Ga0105035_105789 3300009988 Bacteria 1011
173 Ga0099796_10012304 3300010159 Bacteria 2412
174 Ga0105239_10003582 3300010375 Bacteria 18986
175 Ga0105239_10154825 3300010375 Bacteria 2559
176 Ga0105239_10573449 3300010375 Bacteria 1286
177 Ga0105246_10045464 3300011119 Bacteria 2990
178 Ga0105246_10107420 3300011119 Bacteria 2044
179 Ga0157371_10701778 3300013102 Bacteria 757
180 Ga0157370_10024450 3300013104 Bacteria 5983
181 Ga0157370_10247640 3300013104 Bacteria 1648
182 Ga0157369_10018603 3300013105 Bacteria 7788
183 Ga0157369_10133350 3300013105 Bacteria 2631
184 Ga0157378_10304447 3300013297 Bacteria 1544
185 Ga0157378_10461990 3300013297 Bacteria 1262
186 Ga0157378_11130974 3300013297 Bacteria 821
187 Ga0157372_10037981 3300013307 Bacteria 5314
188 Ga0157375_10282412 3300013308 Bacteria 1823
189 Ga0163163_11146984 3300014325 Bacteria 840
190 Ga0157380_10399834 3300014326 Bacteria 1303
191 Ga0182008_10076992 3300014497 Bacteria 1641
192 Ga0157379_10064060 3300014968 Bacteria 3286
193 Ga0157379_10311889 3300014968 Bacteria 1435
194 Ga0157376_10000037 3300014969 Bacteria 138129
195 Ga0157376_10001809 3300014969 Bacteria 14225
196 Ga0157376_10040760 3300014969 Bacteria 3797
197 Ga0182006_1131407 3300015261 Bacteria 861
198 Ga0182007_10001687 3300015262 Bacteria 11693
199 Ga0228598_1017623 3300024227 Bacteria 1409
200 Ga0209672_100188 3300025228 Bacteria 50151
201 Ga0207697_10204576 3300025315 Bacteria 869
202 Ga0207697_10390477 3300025315 Bacteria 618
203 Ga0207713_1000336 3300025735 Bacteria 52391
204 Ga0207692_10010971 3300025898 Bacteria 3836
205 Ga0207692_10023362 3300025898 Bacteria 2858
206 Ga0207692_10463983 3300025898 Bacteria 799
207 Ga0207680_10307993 3300025903 Bacteria 1105
208 Ga0207647_10041843 3300025904 Bacteria 2878
209 Ga0207685_10011587 3300025905 Bacteria 2657
210 Ga0207685_10047727 3300025905 Bacteria 1636
211 Ga0207699_10001138 3300025906 Bacteria 12588
212 Ga0207699_10007661 3300025906 Bacteria 5285
213 Ga0207699_10076551 3300025906 Bacteria 2061
214 Ga0207699_10111385 3300025906 Bacteria 1755
215 Ga0207699_10351685 3300025906 Bacteria 1040
216 Ga0207699_10412182 3300025906 Bacteria 964
217 Ga0207699_10623236 3300025906 Bacteria 786
218 Ga0207684_10004424 3300025910 Bacteria 13237
219 Ga0207684_10015802 3300025910 Bacteria 6492
220 Ga0207684_10030942 3300025910 Bacteria 4555
221 Ga0207684_10040027 3300025910 Bacteria 3973
222 Ga0207684_10093786 3300025910 Bacteria 2560
223 Ga0207684_10304734 3300025910 Bacteria 1373
224 Ga0207684_10861883 3300025910 Bacteria 763
225 Ga0207654_10198673 3300025911 Bacteria 1319
226 Ga0207654_10458761 3300025911 Bacteria 895
227 Ga0207707_10064044 3300025912 Bacteria 3200
228 Ga0207707_10103382 3300025912 Bacteria 2490
229 Ga0207695_10000101 3300025913 Bacteria 258504
230 Ga0207695_10085100 3300025913 Bacteria 3191
231 Ga0207695_10221007 3300025913 Bacteria 1801
232 Ga0207695_10510265 3300025913 Bacteria 1084
233 Ga0207671_10305912 3300025914 Bacteria 1256
234 Ga0207671_11107954 3300025914 Bacteria 622
235 Ga0207693_10009253 3300025915 Bacteria 8043
236 Ga0207693_10042206 3300025915 Bacteria 3591
237 Ga0207693_10808823 3300025915 Bacteria 722
238 Ga0207663_10000183 3300025916 Bacteria 27862
239 Ga0207663_10033085 3300025916 Bacteria 3076
240 Ga0207663_10033514 3300025916 Bacteria 3060
241 Ga0207663_10117185 3300025916 Bacteria 1817
242 Ga0207660_10099670 3300025917 Bacteria 2168
243 Ga0207660_10393413 3300025917 Bacteria 1115
244 Ga0207657_10008870 3300025919 Bacteria 10171
245 Ga0207649_10065539 3300025920 Bacteria 2300
246 Ga0207652_10012893 3300025921 Bacteria 6762
247 Ga0207646_10001256 3300025922 Bacteria 31771
248 Ga0207646_10002004 3300025922 Bacteria 24487
249 Ga0207646_10019994 3300025922 Bacteria 6211
250 Ga0207646_10047036 3300025922 Bacteria 3871
251 Ga0207646_10280116 3300025922 Bacteria 1507
252 Ga0207694_10439860 3300025924 Bacteria 1088
253 Ga0207694_11205743 3300025924 Bacteria 640
254 Ga0207659_10114365 3300025926 Bacteria 2057
255 Ga0207700_10051551 3300025928 Bacteria 3072
256 Ga0207700_10070176 3300025928 Bacteria 2692
257 Ga0207700_10083163 3300025928 Bacteria 2505
258 Ga0207700_10106174 3300025928 Bacteria 2251
259 Ga0207700_10695012 3300025928 Bacteria 908
260 Ga0207664_10020285 3300025929 Bacteria 4923
261 Ga0207664_10054201 3300025929 Bacteria 3177
262 Ga0207664_10064584 3300025929 Bacteria 2928
263 Ga0207664_10685182 3300025929 Bacteria 922
264 Ga0207709_10382498 3300025935 Bacteria 1071
265 Ga0207669_10780328 3300025937 Bacteria 791
266 Ga0207665_10005078 3300025939 Bacteria 8785
267 Ga0207665_10011802 3300025939 Bacteria 5742
268 Ga0207665_10013725 3300025939 Bacteria 5327
269 Ga0207665_10076537 3300025939 Bacteria 2295
270 Ga0207665_10561611 3300025939 Bacteria 888
271 Ga0207691_10052506 3300025940 Bacteria 3723
272 Ga0207691_10340273 3300025940 Bacteria 1284
273 Ga0207711_10004603 3300025941 Bacteria 11727
274 Ga0207689_10072110 3300025942 Bacteria 2837
275 Ga0207679_10328246 3300025945 Bacteria 1327
276 Ga0207667_10072091 3300025949 Bacteria 3591
277 Ga0207712_10913699 3300025961 Bacteria 776
278 Ga0207668_10233670 3300025972 Bacteria 1484
279 Ga0207668_10568553 3300025972 Bacteria 984
280 Ga0207640_10363833 3300025981 Bacteria 1166
281 Ga0207658_11126335 3300025986 Bacteria 717
282 Ga0207677_10460818 3300026023 Bacteria 1091
283 Ga0207703_10715013 3300026035 Bacteria 953
284 Ga0207639_10006502 3300026041 Bacteria 7949
285 Ga0207639_10537600 3300026041 Bacteria 1072
286 Ga0207639_10887861 3300026041 Bacteria 833
287 Ga0207678_10000550 3300026067 Bacteria 34309
288 Ga0207708_10142567 3300026075 Bacteria 1881
289 Ga0207641_10176919 3300026088 Bacteria 1951
290 Ga0207641_11133892 3300026088 Bacteria 781
291 Ga0207641_11156927 3300026088 Bacteria 773
292 Ga0207648_11808828 3300026089 Bacteria 573
293 Ga0207674_10036887 3300026116 Bacteria 5088
294 Ga0207674_10717373 3300026116 Bacteria 965
295 Ga0207674_11022908 3300026116 Bacteria 795
296 Ga0207675_100240290 3300026118 Bacteria 1750
297 Ga0207683_10537607 3300026121 Bacteria 1080
298 Ga0207698_10962662 3300026142 Bacteria 863
299 Ga0209588_1000347 3300027671 Bacteria 12089
300 Ga0209588_1009328 3300027671 Bacteria 2932
301 Ga0209588_1014698 3300027671 Bacteria 2400
302 Ga0209588_1103924 3300027671 Bacteria 913
303 Ga0265354_1000056 3300028016 Bacteria 18570
304 Ga0265354_1000379 3300028016 Bacteria 7822
305 Ga0265356_1014540 3300028017 Bacteria 857
306 Ga0268266_10013772 3300028379 Bacteria 6963
307 Ga0268266_10035830 3300028379 Bacteria 4220
308 Ga0268266_10083780 3300028379 Bacteria 2784
309 Ga0268266_10134471 3300028379 Bacteria 2214
310 Ga0268266_11361419 3300028379 Bacteria 685
311 Ga0268264_10037577 3300028381 Bacteria 3993
312 Ga0268264_10304756 3300028381 Bacteria 1501
313 Ga0265770_1006491 3300030878 Bacteria 1627
314 Ga0265765_1001778 3300030879 Bacteria 2021
315 Ga0265771_1001938 3300031010 Bacteria 1051
316 Ga0265760_10016582 3300031090 Bacteria 2114
317 Ga0265760_10034249 3300031090 Bacteria 1502
318 Ga0265760_10343667 3300031090 Bacteria 533
319 Ga0307513_10290494 3300031456 Bacteria 1406
320 Ga0265313_10122505 3300031595 Bacteria 1133
321 Ga0307508_10000009 3300031616 Bacteria 256966
322 Ga0307516_10064429 3300031730 Bacteria 3544
323 Ga0307416_101060453 3300032002 Bacteria 914
324 Ga0307510_10127039 3300033180 Bacteria 2236
325 Ga0316212_1000542 3300033547 Bacteria 4693
326 Ga0373926_0294366 3300035083 Bacteria 633
327 Ga0373934_0019619 3300035086 Bacteria 2597
328 Ga0373923_0245540 3300035111 Bacteria 837
329 Ga0373936_0024169 3300035113 Bacteria 2371
330 Ga0373941_0143837 3300035115 Bacteria 869
331 Ga0373954_0353275 3300035118 Bacteria 726
332 Ga0373943_0105902 3300035170 Bacteria 1477
333 Ga0373946_0062964 3300035171 Bacteria 1583
334 Ga0373946_0287744 3300035171 Bacteria 810
335 Ga0373955_0031406 3300035172 Bacteria 2782
336 Ga0373955_0103924 3300035172 Bacteria 1634
337 Ga0373955_0475577 3300035172 Bacteria 762
338 Ga0373924_0149452 3300035410 Bacteria 1021
339 Ga0373935_0034197 3300035692 Bacteria 3167
340 Ga0373927_0002258 3300035695 Bacteria 14120
341 Ga0373927_0298738 3300035695 Bacteria 1060
342 Ga0373933_0022308 3300035724 Bacteria 3604
343 Ga0373933_0122096 3300035724 Bacteria 1632
344 Ga0373933_0131048 3300035724 Bacteria 1577
345 Ga0373947_0002634 3300035725 Bacteria 10777
346 Ga0373947_0190355 3300035725 Bacteria 1338
347 Ga0373937_0003695 3300036401 Bacteria 12924
348 Ga0373937_0023089 3300036401 Bacteria 5596
349 Ga0373937_0191954 3300036401 Bacteria 1919
350 Ga0373937_2068850 3300036401 Bacteria 515
351 Ga0373925_0008340 3300037068 Bacteria 7544
352 Ga0395900_0449883 3300037418 Bacteria 1244
353 Ga0395900_1402007 3300037418 Bacteria 612
354 Ga0395898_0715208 3300037466 Bacteria 943
355 Ga0395905_0108415 3300037471 Bacteria 2607
356 Ga0395901_0082211 3300038443 Bacteria 3365
357 Ga0395901_0924934 3300038443 Bacteria 852
358 Ga0436362_1062010 3300039453 Bacteria 594
359 Ga0439435_0023193 3300042436 Bacteria 1627
360 Ga0439460_0071111 3300042461 Bacteria 1078
361 Ga0451577_0722169 3300042876 Bacteria 902
362 Ga0453683_0015908 3300044673 Bacteria 4861
363 Ga0453684_0791839 3300044712 Bacteria 1023
364 Ga0466957_0092700 3300044842 Bacteria 1895
365 Ga0451576_0801449 3300045051 Bacteria 989
366 Ga0495592_0003387 3300046454 Bacteria 11434
367 Ga0495603_0003346 3300046455 Bacteria 9541
368 Ga0495629_0008183 3300046459 Bacteria 7690
369 Ga0495629_0248510 3300046459 Bacteria 1224
370 Ga0495641_0020228 3300046461 Bacteria 3381
371 Ga0495641_0391637 3300046461 Bacteria 630
372 Ga0495651_0035793 3300046462 Bacteria 3865
373 Ga0495651_0174608 3300046462 Bacteria 1527
374 Ga0495651_0329452 3300046462 Bacteria 1015
375 Ga0495580_0001179 3300046472 Bacteria 22977
376 Ga0495580_0085541 3300046472 Bacteria 2196
377 Ga0495580_0216484 3300046472 Bacteria 1317
378 Ga0495580_0286580 3300046472 Bacteria 1123
379 Ga0495580_0442737 3300046472 Bacteria 872
380 Ga0495582_0000177 3300046473 Bacteria 34588
381 Ga0495582_0000446 3300046473 Bacteria 22516
382 Ga0495582_0088995 3300046473 Bacteria 1720
383 Ga0495639_0001782 3300046475 Bacteria 9535
384 Ga0495662_0000028 3300046476 Bacteria 51556
385 Ga0495662_0044625 3300046476 Bacteria 2140
386 Ga0495664_0026254 3300046477 Bacteria 3393
387 Ga0495594_0000020 3300046499 Bacteria 80534
388 Ga0495596_0395344 3300046500 Bacteria 539
389 Ga0495608_0505080 3300046511 Bacteria 732
390 Ga0495618_0564327 3300046514 Bacteria 680
391 Ga0495628_0008113 3300046516 Bacteria 9035
392 Ga0495628_0011150 3300046516 Bacteria 7609
393 Ga0495630_0106607 3300046517 Bacteria 2122
394 Ga0495630_0283717 3300046517 Bacteria 1265
395 Ga0495630_0693227 3300046517 Bacteria 779
396 Ga0495630_0757479 3300046517 Bacteria 742
397 Ga0495666_0045189 3300046526 Bacteria 2125
398 Ga0495666_0063300 3300046526 Bacteria 1766
399 Ga0495652_0002010 3300046529 Bacteria 21660
400 Ga0495652_0032762 3300046529 Bacteria 4542
401 Ga0495665_0012167 3300046531 Bacteria 4656
402 Ga0495665_0620900 3300046531 Bacteria 539
403 Ga0495640_0019131 3300046533 Bacteria 5061
404 Ga0495640_0081257 3300046533 Bacteria 2154
405 Ga0495586_0034604 3300046535 Bacteria 2714
406 Ga0495645_0001520 3300046543 Bacteria 15645
407 Ga0495622_0014903 3300046557 Bacteria 3614
408 Ga0495622_0076057 3300046557 Bacteria 1547
409 Ga0495667_0004655 3300046559 Bacteria 9279
410 Ga0495667_0187193 3300046559 Bacteria 1327
411 Ga0495634_0000324 3300046642 Bacteria 46211
412 Ga0495634_0409670 3300046642 Bacteria 804
413 Ga0495635_0000496 3300046663 Bacteria 24850
414 Ga0495635_0006618 3300046663 Bacteria 8087
415 Ga0495635_0144936 3300046663 Bacteria 1617
416 Ga0495588_0089055 3300046674 Bacteria 1616
417 Ga0495588_0133328 3300046674 Bacteria 1311
418 Ga0495657_0015671 3300046675 Bacteria 5540
419 Ga0495657_0200651 3300046675 Bacteria 1216
420 Ga0495599_0512563 3300046678 Bacteria 705
421 Ga0495623_0076898 3300046679 Bacteria 2071
422 Ga0495647_0055218 3300046681 Bacteria 1554
423 Ga0495658_0001003 3300046683 Bacteria 14903
424 Ga0495658_0079682 3300046683 Bacteria 1919
425 Ga0495613_0101891 3300046689 Bacteria 2073
426 Ga0495624_0000436 3300046690 Bacteria 32813
427 Ga0495624_0010163 3300046690 Bacteria 6490
428 Ga0495624_0222888 3300046690 Bacteria 1143
429 Ga0495624_0251760 3300046690 Bacteria 1068
430 Ga0495600_0031585 3300046809 Bacteria 3432
431 Ga0495581_0000160 3300047315 Bacteria 30015
432 Ga0495604_0114369 3300047317 Bacteria 1962
433 Ga0495604_0139964 3300047317 Bacteria 1729
434 Ga0495604_0140039 3300047317 Bacteria 1729
435 Ga0495636_0016705 3300047318 Bacteria 2933
436 Ga0495674_0295389 3300047319 Bacteria 1324
437 Ga0495674_0644891 3300047319 Bacteria 835
438 Ga0495674_1030542 3300047319 Bacteria 629
439 Ga0495674_1149078 3300047319 Bacteria 589
440 Ga0495676_0389504 3300047321 Bacteria 926
441 Ga0495680_0015818 3300047322 Bacteria 6495
442 Ga0495680_0109923 3300047322 Bacteria 2043
443 Ga0495680_0110172 3300047322 Bacteria 2041
444 Ga0495680_0230891 3300047322 Bacteria 1317
445 Ga0495680_0498149 3300047322 Bacteria 827
446 Ga0495687_003859 3300047443 Bacteria 10542
447 Ga0495675_0072067 3300047444 Bacteria 2180
448 Ga0495675_0097729 3300047444 Bacteria 1840
449 Ga0495684_0027880 3300047471 Bacteria 4338
450 Ga0495684_0115399 3300047471 Bacteria 2024
451 Ga0495593_0000241 3300047673 Bacteria 29466
452 Ga0495593_0307604 3300047673 Bacteria 792
453 Ga0495602_0045537 3300048088 Bacteria 3969
454 Ga0495602_0126364 3300048088 Bacteria 2048
455 Ga0496100_0559893 3300048903 Bacteria 885
456 Ga0496101_0033641 3300048904 Bacteria 3616
457 Ga0496101_1025325 3300048904 Bacteria 649
458 Ga0496102_0038124 3300048905 Bacteria 4336
459 Ga0496103_0068330 3300048906 Bacteria 2220
460 Ga0496103_0464962 3300048906 Bacteria 811
461 Ga0496104_0002811 3300048907 Bacteria 15006
462 Ga0496104_0318332 3300048907 Bacteria 1469
463 Ga0496105_0470457 3300048908 Bacteria 990
464 Ga0496105_0929585 3300048908 Bacteria 654
465 Ga0496107_0004988 3300048910 Bacteria 9036
466 Ga0496108_0473613 3300048911 Bacteria 1094
467 Ga0496109_0324926 3300048912 Bacteria 1452
468 Ga0496110_0569389 3300048913 Bacteria 1029
469 Ga0496111_0524388 3300048914 Bacteria 871
470 Ga0496112_0363809 3300048915 Bacteria 1388
471 Ga0496113_0941372 3300048916 Bacteria 682
472 Ga0496114_0027750 3300048917 Bacteria 4640
473 Ga0496114_0060269 3300048917 Bacteria 3172
474 Ga0496114_0200495 3300048917 Bacteria 1748
475 Ga0496114_0309686 3300048917 Bacteria 1395
476 Ga0496115_0004936 3300048918 Bacteria 9690
477 Ga0496115_0007417 3300048918 Bacteria 8069
478 Ga0496115_0030699 3300048918 Bacteria 4230
479 Ga0496115_0059696 3300048918 Bacteria 3072
480 Ga0496115_0085448 3300048918 Bacteria 2573
481 Ga0496117_0328514 3300048920 Bacteria 798
482 Ga0496118_0005091 3300048921 Bacteria 15118
483 Ga0501034_0275421 3300049571 Bacteria 1623
484 Ga0501036_0169118 3300049572 Bacteria 1842
485 Ga0501036_0416667 3300049572 Bacteria 1120
486 Ga0501039_0385611 3300049575 Bacteria 1101
487 Ga0501047_0706501 3300049581 Bacteria 825
488 Ga0501069_0065386 3300049585 Bacteria 2033
489 Ga0501070_0041761 3300049586 Bacteria 3819
490 Ga0501073_0066376 3300049589 Bacteria 2515
491 Ga0501079_0066579 3300049741 Bacteria 2780
492 Ga0501080_0438150 3300049742 Bacteria 1173
493 Ga0501083_0034286 3300049744 Bacteria 3471
494 nmdc:mga03683_45140_c1 3300050489 Bacteria 1823
495 nmdc:mga03683_533315_c1 3300050489 Bacteria 570
496 nmdc:mga03n38_16046_c1 3300050490 Bacteria 2906
497 nmdc:mga00v17_449746_c1 3300050491 Bacteria 836
498 nmdc:mga0yw44_193474_c1 3300050492 Bacteria 1342
499 nmdc:mga0yw44_709365_c1 3300050492 Bacteria 683
500 nmdc:mga0yw44_74742_c1 3300050492 Bacteria 2111
501 nmdc:mga0k408_45488_c1 3300050493 Bacteria 2532
502 nmdc:mga06z11_1472_c1 3300050494 Bacteria 8770
503 nmdc:mga06z11_19806_c1 3300050494 Bacteria 3101
504 nmdc:mga06z11_199898_c1 3300050494 Bacteria 1160
505 nmdc:mga04h51_31928_c1 3300050495 Bacteria 1667
506 nmdc:mga07m45_113971_c1 3300050496 Bacteria 1558
507 nmdc:mga07m45_1638_c1 3300050496 Bacteria 10308
508 nmdc:mga07m45_260711_c1 3300050496 Bacteria 1008
509 nmdc:mga07m45_41120_c1 3300050496 Bacteria 2588
510 nmdc:mga05p37_701540_c1 3300050507 Bacteria 1124
511 nmdc:mga0rr50_140254_c1 3300050513 Bacteria 1944
512 nmdc:mga0rr50_849990_c1 3300050513 Bacteria 778
513 nmdc:mga0a205_312488_c1 3300050515 Bacteria 1443
514 nmdc:mga0sz30_27450_c1 3300050516 Bacteria 2338
515 nmdc:mga0sz30_4567_c1 3300050516 Bacteria 5014
516 Ga0495601_0000159 3300053077 Bacteria 37216
517 Ga0495601_0014154 3300053077 Bacteria 4806
518 Ga0495601_0159939 3300053077 Bacteria 1472
519 Ga0500610_0000259 3300053079 Bacteria 15982
520 Ga0500635_0030657 3300053080 Bacteria 1735
521 Ga0495595_0000978 3300053084 Bacteria 11011
522 Ga0495619_0000190 3300053085 Bacteria 45343
523 Ga0500583_0522578 3300053092 Bacteria 555
524 Ga0500566_0210947 3300053094 Bacteria 973
525 Ga0500641_0036145 3300053096 Bacteria 1975
526 Ga0500595_035751 3300053119 Bacteria 1633
527 Ga0500595_218199 3300053119 Bacteria 524
528 Ga0500642_0095142 3300053130 Bacteria 1380
529 Ga0500577_0188002 3300053142 Bacteria 888
530 Ga0500588_0076403 3300053146 Bacteria 1111
531 Ga0500616_0003319 3300053153 Bacteria 12406
532 Ga0500620_131227 3300053155 Bacteria 877
533 Ga0500552_002069 3300053733 Bacteria 1936
534 Ga0501084_0103152 3300054114 Bacteria 2395
535 Ga0501082_0077006 3300060353 Bacteria 2875
536 2723878235 2721755763 Bacteria 4464185
537 2842327636 2842324504 Bacteria 9364110
538 2842351757 2842348783 Bacteria 9002918
539 2842460739 2842454564 Bacteria 8730687
540 2941502259 2941499720 Bacteria 7599444
541 Ga0070708_100080947
542 JGI24739J22299_10001796
543 JGI24735J21928_10029731
544 Ga0065715_10952327
545 Ga0070658_10266942
546 Ga0070683_100761197
547 Ga0068869_100036281
548 Ga0068869_101304369
549 Ga0070680_100129305
550 Ga0070682_100006405
551 Ga0070660_100016968
552 Ga0070691_10466936
553 Ga0070661_100313911
554 Ga0070668_100217238
555 Ga0070668_100316053
556 Ga0070668_100690322
557 Ga0070675_100658661
558 Ga0070675_101715079
559 Ga0070674_100457973
560 Ga0070709_10048953
561 Ga0070709_10107490
562 Ga0070709_10107498
563 Ga0070714_100082958
564 Ga0070713_100002596
565 Ga0070713_100005906
566 Ga0070713_100102727
567 Ga0070713_100141790
568 Ga0070713_100817596
569 Ga0070713_100909191
570 Ga0070710_10002141
571 Ga0070710_10014502
572 Ga0070710_10042314
573 Ga0070711_100012235
574 Ga0070711_100032979
575 Ga0070711_100037447
576 Ga0070711_100043172
577 Ga0070711_100094079
578 Ga0070711_100330724
579 Ga0070705_100021047
580 Ga0070705_100056053
581 Ga0070700_100063337
582 Ga0070694_100165914
583 Ga0070708_100040486
584 Ga0070708_100075327
585 Ga0070708_100086105
586 Ga0070708_100122377
587 Ga0070708_100305017
588 Ga0070708_101052223
589 Ga0070663_100003874
590 Ga0070678_100775033
591 Ga0070681_10006015
592 Ga0070681_10081160
593 Ga0068867_101252438
594 Ga0070706_100022427
595 Ga0070706_100023021
596 Ga0070706_100024327
597 Ga0070706_100034029
598 Ga0070706_100047279
599 Ga0070706_100343015
600 Ga0070706_101032663
601 Ga0070707_100023193
602 Ga0070707_100358486
603 Ga0070707_100469427
604 Ga0070707_101132262
605 Ga0070698_100001748
606 Ga0070698_100046129
607 Ga0070698_100121276
608 Ga0070698_100137417
609 Ga0070699_100043316
610 Ga0070679_100027335
611 Ga0070679_100028299
612 Ga0070684_100262225
613 Ga0070697_100013062
614 Ga0070697_100018049
615 Ga0070697_100033791
616 Ga0070697_100213748
617 Ga0068853_100006983
618 Ga0068853_100289836
619 Ga0068853_101141857
620 Ga0070686_100725520
621 Ga0070695_100010259
622 Ga0070695_100459955
623 Ga0070696_100011148
624 Ga0070693_100000041
625 Ga0070693_100017831
626 Ga0070665_100023861
627 Ga0070665_100061332
628 Ga0070665_100080960
629 Ga0070665_100284640
630 Ga0070704_100071898
631 Ga0070704_100233779
632 Ga0068855_100047493
633 Ga0068855_100083145
634 Ga0070664_100088415
635 Ga0068857_100015352
636 Ga0068857_100280512
637 Ga0068857_100860592
638 Ga0068854_100495519
639 Ga0070702_100063029
640 Ga0068852_101173323
641 Ga0068864_101117831
642 Ga0068861_100174433
643 Ga0068851_10103943
644 Ga0068863_100143973
645 Ga0068863_101051866
646 Ga0068858_100555228
647 Ga0068862_101336972
648 Ga0070717_10002492
649 Ga0070717_10071533
650 Ga0070717_10113609
651 Ga0070717_10505377
652 Ga0070717_10907743
653 Ga0075365_10026848
654 Ga0075365_10029796
655 Ga0075365_10413919
656 Ga0075364_10893527
657 Ga0070715_10052994
658 Ga0070715_10142821
659 Ga0070715_10574882
660 Ga0070716_100003644
661 Ga0070716_100017213
662 Ga0070716_100037577
663 Ga0070716_100428149
664 Ga0070712_100053669
665 Ga0070712_100112456
666 Ga0070712_100144425
667 Ga0075362_10000915
668 Ga0075367_10018929
669 Ga0075367_10018931
670 Ga0075367_10076661
671 Ga0075367_10193645
672 Ga0075367_10216652
673 Ga0075367_10379436
674 Ga0075369_10004842
675 Ga0097621_100016551
676 Ga0097621_100093193
677 Ga0097621_100486902
678 Ga0097621_101359090
679 Ga0075370_10002063
680 Ga0068871_100018252
681 Ga0068871_100027687
682 Ga0068871_100416416
683 Ga0068871_100589909
684 Ga0075434_100067855
685 Ga0075435_100136405
686 Ga0075435_100353482
687 Ga0099794_10007873
688 Ga0099794_10012152
689 Ga0099794_10038517
690 Ga0099794_10194962
691 Ga0099794_10656296
692 Ga0105251_10000837
693 Ga0105240_10000034
694 Ga0105240_10048482
695 Ga0105240_10134550
696 Ga0105240_10546993
697 Ga0105247_10289079
698 Ga0114129_10441808
699 Ga0105243_10802408
700 Ga0105241_10050154
701 Ga0105241_10305528
702 Ga0105248_10012438
703 Ga0105248_10776422
704 Ga0105237_10019001
705 Ga0105237_10036872
706 Ga0105237_10459119
707 Ga0105238_10655117
708 Ga0105238_11191184
709 Ga0105238_11636811
710 Ga0105249_10654580
711 Ga0105249_11401516
712 Ga0105035_105789
713 Ga0099796_10012304
714 Ga0105239_10003582
715 Ga0105239_10154825
716 Ga0105239_10573449
717 Ga0105246_10045464
718 Ga0105246_10107420
719 Ga0157371_10701778
720 Ga0157370_10024450
721 Ga0157370_10247640
722 Ga0157369_10018603
723 Ga0157369_10133350
724 Ga0157378_10304447
725 Ga0157378_10461990
726 Ga0157378_11130974
727 Ga0157372_10037981
728 Ga0157375_10282412
729 Ga0163163_11146984
730 Ga0157380_10399834
731 Ga0182008_10076992
732 Ga0157379_10064060
733 Ga0157379_10311889
734 Ga0157376_10000037
735 Ga0157376_10001809
736 Ga0157376_10040760
737 Ga0182006_1131407
738 Ga0182007_10001687
739 Ga0228598_1017623
740 Ga0209672_100188
741 Ga0207697_10204576
742 Ga0207697_10390477
743 Ga0207713_1000336
744 Ga0207692_10010971
745 Ga0207692_10023362
746 Ga0207692_10463983
747 Ga0207680_10307993
748 Ga0207647_10041843
749 Ga0207685_10011587
750 Ga0207685_10047727
751 Ga0207699_10001138
752 Ga0207699_10007661
753 Ga0207699_10076551
754 Ga0207699_10111385
755 Ga0207699_10351685
756 Ga0207699_10412182
757 Ga0207699_10623236
758 Ga0207684_10004424
759 Ga0207684_10015802
760 Ga0207684_10030942
761 Ga0207684_10040027
762 Ga0207684_10093786
763 Ga0207684_10304734
764 Ga0207684_10861883
765 Ga0207654_10198673
766 Ga0207654_10458761
767 Ga0207707_10064044
768 Ga0207707_10103382
769 Ga0207695_10000101
770 Ga0207695_10085100
771 Ga0207695_10221007
772 Ga0207695_10510265
773 Ga0207671_10305912
774 Ga0207671_11107954
775 Ga0207693_10009253
776 Ga0207693_10042206
777 Ga0207693_10808823
778 Ga0207663_10000183
779 Ga0207663_10033085
780 Ga0207663_10033514
781 Ga0207663_10117185
782 Ga0207660_10099670
783 Ga0207660_10393413
784 Ga0207657_10008870
785 Ga0207649_10065539
786 Ga0207652_10012893
787 Ga0207646_10001256
788 Ga0207646_10002004
789 Ga0207646_10019994
790 Ga0207646_10047036
791 Ga0207646_10280116
792 Ga0207694_10439860
793 Ga0207694_11205743
794 Ga0207659_10114365
795 Ga0207700_10051551
796 Ga0207700_10070176
797 Ga0207700_10083163
798 Ga0207700_10106174
799 Ga0207700_10695012
800 Ga0207664_10020285
801 Ga0207664_10054201
802 Ga0207664_10064584
803 Ga0207664_10685182
804 Ga0207709_10382498
805 Ga0207669_10780328
806 Ga0207665_10005078
807 Ga0207665_10011802
808 Ga0207665_10013725
809 Ga0207665_10076537
810 Ga0207665_10561611
811 Ga0207691_10052506
812 Ga0207691_10340273
813 Ga0207711_10004603
814 Ga0207689_10072110
815 Ga0207679_10328246
816 Ga0207667_10072091
817 Ga0207712_10913699
818 Ga0207668_10233670
819 Ga0207668_10568553
820 Ga0207640_10363833
821 Ga0207658_11126335
822 Ga0207677_10460818
823 Ga0207703_10715013
824 Ga0207639_10006502
825 Ga0207639_10537600
826 Ga0207639_10887861
827 Ga0207678_10000550
828 Ga0207708_10142567
829 Ga0207641_10176919
830 Ga0207641_11133892
831 Ga0207641_11156927
832 Ga0207648_11808828
833 Ga0207674_10036887
834 Ga0207674_10717373
835 Ga0207674_11022908
836 Ga0207675_100240290
837 Ga0207683_10537607
838 Ga0207698_10962662
839 Ga0209588_1000347
840 Ga0209588_1009328
841 Ga0209588_1014698
842 Ga0209588_1103924
843 Ga0265354_1000056
844 Ga0265354_1000379
845 Ga0265356_1014540
846 Ga0268266_10013772
847 Ga0268266_10035830
848 Ga0268266_10083780
849 Ga0268266_10134471
850 Ga0268266_11361419
851 Ga0268264_10037577
852 Ga0268264_10304756
853 Ga0265770_1006491
854 Ga0265765_1001778
855 Ga0265771_1001938
856 Ga0265760_10016582
857 Ga0265760_10034249
858 Ga0265760_10343667
859 Ga0307513_10290494
860 Ga0265313_10122505
861 Ga0307508_10000009
862 Ga0307516_10064429
863 Ga0307416_101060453
864 Ga0307510_10127039
865 Ga0316212_1000542
866 Ga0373926_0294366
867 Ga0373934_0019619
868 Ga0373923_0245540
869 Ga0373936_0024169
870 Ga0373941_0143837
871 Ga0373954_0353275
872 Ga0373943_0105902
873 Ga0373946_0062964
874 Ga0373946_0287744
875 Ga0373955_0031406
876 Ga0373955_0103924
877 Ga0373955_0475577
878 Ga0373924_0149452
879 Ga0373935_0034197
880 Ga0373927_0002258
881 Ga0373927_0298738
882 Ga0373933_0022308
883 Ga0373933_0122096
884 Ga0373933_0131048
885 Ga0373947_0002634
886 Ga0373947_0190355
887 Ga0373937_0003695
888 Ga0373937_0023089
889 Ga0373937_0191954
890 Ga0373937_2068850
891 Ga0373925_0008340
892 Ga0395900_0449883
893 Ga0395900_1402007
894 Ga0395898_0715208
895 Ga0395905_0108415
896 Ga0395901_0082211
897 Ga0395901_0924934
898 Ga0436362_1062010
899 Ga0439435_0023193
900 Ga0439460_0071111
901 Ga0451577_0722169
902 Ga0453683_0015908
903 Ga0453684_0791839
904 Ga0466957_0092700
905 Ga0451576_0801449
906 Ga0495592_0003387
907 Ga0495603_0003346
908 Ga0495629_0008183
909 Ga0495629_0248510
910 Ga0495641_0020228
911 Ga0495641_0391637
912 Ga0495651_0035793
913 Ga0495651_0174608
914 Ga0495651_0329452
915 Ga0495580_0001179
916 Ga0495580_0085541
917 Ga0495580_0216484
918 Ga0495580_0286580
919 Ga0495580_0442737
920 Ga0495582_0000177
921 Ga0495582_0000446
922 Ga0495582_0088995
923 Ga0495639_0001782
924 Ga0495662_0000028
925 Ga0495662_0044625
926 Ga0495664_0026254
927 Ga0495594_0000020
928 Ga0495596_0395344
929 Ga0495608_0505080
930 Ga0495618_0564327
931 Ga0495628_0008113
932 Ga0495628_0011150
933 Ga0495630_0106607
934 Ga0495630_0283717
935 Ga0495630_0693227
936 Ga0495630_0757479
937 Ga0495666_0045189
938 Ga0495666_0063300
939 Ga0495652_0002010
940 Ga0495652_0032762
941 Ga0495665_0012167
942 Ga0495665_0620900
943 Ga0495640_0019131
944 Ga0495640_0081257
945 Ga0495586_0034604
946 Ga0495645_0001520
947 Ga0495622_0014903
948 Ga0495622_0076057
949 Ga0495667_0004655
950 Ga0495667_0187193
951 Ga0495634_0000324
952 Ga0495634_0409670
953 Ga0495635_0000496
954 Ga0495635_0006618
955 Ga0495635_0144936
956 Ga0495588_0089055
957 Ga0495588_0133328
958 Ga0495657_0015671
959 Ga0495657_0200651
960 Ga0495599_0512563
961 Ga0495623_0076898
962 Ga0495647_0055218
963 Ga0495658_0001003
964 Ga0495658_0079682
965 Ga0495613_0101891
966 Ga0495624_0000436
967 Ga0495624_0010163
968 Ga0495624_0222888
969 Ga0495624_0251760
970 Ga0495600_0031585
971 Ga0495581_0000160
972 Ga0495604_0114369
973 Ga0495604_0139964
974 Ga0495604_0140039
975 Ga0495636_0016705
976 Ga0495674_0295389
977 Ga0495674_0644891
978 Ga0495674_1030542
979 Ga0495674_1149078
980 Ga0495676_0389504
981 Ga0495680_0015818
982 Ga0495680_0109923
983 Ga0495680_0110172
984 Ga0495680_0230891
985 Ga0495680_0498149
986 Ga0495687_003859
987 Ga0495675_0072067
988 Ga0495675_0097729
989 Ga0495684_0027880
990 Ga0495684_0115399
991 Ga0495593_0000241
992 Ga0495593_0307604
993 Ga0495602_0045537
994 Ga0495602_0126364
995 Ga0496100_0559893
996 Ga0496101_0033641
997 Ga0496101_1025325
998 Ga0496102_0038124
999 Ga0496103_0068330
1000 Ga0496103_0464962
1001 Ga0496104_0002811
1002 Ga0496104_0318332
1003 Ga0496105_0470457
1004 Ga0496105_0929585
1005 Ga0496107_0004988
1006 Ga0496108_0473613
1007 Ga0496109_0324926
1008 Ga0496110_0569389
1009 Ga0496111_0524388
1010 Ga0496112_0363809
1011 Ga0496113_0941372
1012 Ga0496114_0027750
1013 Ga0496114_0060269
1014 Ga0496114_0200495
1015 Ga0496114_0309686
1016 Ga0496115_0004936
1017 Ga0496115_0007417
1018 Ga0496115_0030699
1019 Ga0496115_0059696
1020 Ga0496115_0085448
1021 Ga0496117_0328514
1022 Ga0496118_0005091
1023 Ga0501034_0275421
1024 Ga0501036_0169118
1025 Ga0501036_0416667
1026 Ga0501039_0385611
1027 Ga0501047_0706501
1028 Ga0501069_0065386
1029 Ga0501070_0041761
1030 Ga0501073_0066376
1031 Ga0501079_0066579
1032 Ga0501080_0438150
1033 Ga0501083_0034286
1034 nmdc:mga03683_45140_c1
1035 nmdc:mga03683_533315_c1
1036 nmdc:mga03n38_16046_c1
1037 nmdc:mga00v17_449746_c1
1038 nmdc:mga0yw44_193474_c1
1039 nmdc:mga0yw44_709365_c1
1040 nmdc:mga0yw44_74742_c1
1041 nmdc:mga0k408_45488_c1
1042 nmdc:mga06z11_1472_c1
1043 nmdc:mga06z11_19806_c1
1044 nmdc:mga06z11_199898_c1
1045 nmdc:mga04h51_31928_c1
1046 nmdc:mga07m45_113971_c1
1047 nmdc:mga07m45_1638_c1
1048 nmdc:mga07m45_260711_c1
1049 nmdc:mga07m45_41120_c1
1050 nmdc:mga05p37_701540_c1
1051 nmdc:mga0rr50_140254_c1
1052 nmdc:mga0rr50_849990_c1
1053 nmdc:mga0a205_312488_c1
1054 nmdc:mga0sz30_27450_c1
1055 nmdc:mga0sz30_4567_c1
1056 Ga0495601_0000159
1057 Ga0495601_0014154
1058 Ga0495601_0159939
1059 Ga0500610_0000259
1060 Ga0500635_0030657
1061 Ga0495595_0000978
1062 Ga0495619_0000190
1063 Ga0500583_0522578
1064 Ga0500566_0210947
1065 Ga0500641_0036145
1066 Ga0500595_035751
1067 Ga0500595_218199
1068 Ga0500642_0095142
1069 Ga0500577_0188002
1070 Ga0500588_0076403
1071 Ga0500616_0003319
1072 Ga0500620_131227
1073 Ga0500552_002069
1074 Ga0501084_0103152
1075 Ga0501082_0077006
1076 2723878235
1077 2842327636
1078 2842351757
1079 2842460739
1080 2941502259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

44

140

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ez6-assembly1.cif.gz_A structure of para-adp complex:tetragonal form 0.8415 99 123
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.71 5 125
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6954 1 121
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6855 1 121
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6714 5 125
ID Description Score Start End Superfamily
3ez6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8415 99 123 3.40.50.300
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8275 5 114 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7954 5 114 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7114 5 121 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6956 5 121 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A3S1PJM5-F1-model_v4 DUF1801 domain-containing protein 0.9861 1 115
AF-A0A0F5Q6T3-F1-model_v4 YdhG-like domain-containing protein 0.986 1 125
AF-A0A2V9FIH0-F1-model_v4 YdhG-like domain-containing protein 0.9845 1 125
AF-A0A7Z0AXJ3-F1-model_v4 YdhG-like domain-containing protein 0.9844 2 119
AF-A0A543DME6-F1-model_v4 YdhG-like domain-containing protein 0.9842 3 124

Map