F461111

General Info

Members Datasets Scaffolds Average Seq Length
539 330 532 150

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100642419|Ga0070705_1006424191
Length 181
Sequence MVERGLGVKVAADGDWDYSAGFPTGMSSMSLRAKINDDLKAAMKAGDKRKVSALRLMNAAIKDKDINSRTDGHDSMLTADAGLIELFAKMVTQRQESLGMYEQGGRPELAQQEREEIEVIQSYMPKQLSEDEAKKAVAAVIAAVGATSVKDMGKVMAELKARYAGQMDMAKAGGIVKGVLG

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
3 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
4 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
5 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
6 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
168 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
169 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
197 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
198 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
294 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
301 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
311 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
312 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
313 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
314 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
315 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
316 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
317 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
318 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
319 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
322 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
323 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
324 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
325 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
326 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
327 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
330 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0.37
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.76
Nodule 0
Rhizoplane 5.19
Rhizosphere 77.37
Stem 0
Stem Tuber 0
Unclassified 6.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001343 3300001915 Bacteria 7134
2 JGI24741J21665_1016365 3300001915 Bacteria 1211
3 JGI24747J21853_1039958 3300001978 Bacteria 555
4 JGI24740J21852_10044474 3300001979 Bacteria 1318
5 JGI24740J21852_10047532 3300001979 Bacteria 1252
6 JGI24740J21852_10052507 3300001979 Bacteria 1160
7 JGI24737J22298_10029642 3300001990 Bacteria 1715
8 JGI24737J22298_10181254 3300001990 Bacteria 622
9 JGI25153J46596_10000006 3300003215 Bacteria 447760
10 Ga0055525_1000051 3300003759 Bacteria 240942
11 Ga0055542_1000020 3300003762 Bacteria 335745
12 Ga0055529_1000016 3300003763 Bacteria 364775
13 Ga0055530_10000978 3300003791 Bacteria 23058
14 Ga0055531_10001645 3300003794 Bacteria 16155
15 Ga0065165_1039706 3300005262 Bacteria 1408
16 Ga0065704_10070209 3300005289 Bacteria 78459
17 Ga0065704_10288184 3300005289 Bacteria 899
18 Ga0070658_10001558 3300005327 Bacteria 19439
19 Ga0070658_10514482 3300005327 Bacteria 1035
20 Ga0070676_10537856 3300005328 Bacteria 835
21 Ga0070676_11024555 3300005328 Bacteria 621
22 Ga0070683_100105670 3300005329 Bacteria 2654
23 Ga0070683_100361830 3300005329 Bacteria 1382
24 Ga0070690_100452281 3300005330 Bacteria 952
25 Ga0070680_100025291 3300005336 Bacteria 4744
26 Ga0070680_100105728 3300005336 Bacteria 2340
27 Ga0070680_101088607 3300005336 Bacteria 691
28 Ga0070660_100616784 3300005339 Bacteria 908
29 Ga0070691_10143677 3300005341 Bacteria 1218
30 Ga0070661_100001207 3300005344 Bacteria 18191
31 Ga0070661_100227527 3300005344 Bacteria 1432
32 Ga0070661_100241612 3300005344 Bacteria 1391
33 Ga0070661_100514733 3300005344 Bacteria 959
34 Ga0070661_100624656 3300005344 Bacteria 873
35 Ga0070668_100437766 3300005347 Bacteria 1122
36 Ga0070668_100750172 3300005347 Bacteria 864
37 Ga0070668_101477547 3300005347 Bacteria 621
38 Ga0070669_101168684 3300005353 Unclassified 664
39 Ga0070675_100083570 3300005354 Bacteria 2665
40 Ga0070671_100167790 3300005355 Bacteria 1856
41 Ga0070674_100003705 3300005356 Bacteria 8611
42 Ga0070673_100105514 3300005364 Bacteria 2328
43 Ga0070688_100268431 3300005365 Bacteria 1221
44 Ga0070659_100010912 3300005366 Bacteria 6704
45 Ga0070659_100037913 3300005366 Bacteria 3758
46 Ga0070659_100135769 3300005366 Bacteria 2000
47 Ga0070659_100852005 3300005366 Bacteria 794
48 Ga0070701_10847703 3300005438 Bacteria 627
49 Ga0070705_100642419 3300005440 Bacteria 826
50 Ga0070694_101797019 3300005444 Bacteria 522
51 Ga0070663_100015002 3300005455 Bacteria 4985
52 Ga0070663_100131892 3300005455 Bacteria 1898
53 Ga0070663_100529178 3300005455 Bacteria 982
54 Ga0070678_100002746 3300005456 Bacteria 9719
55 Ga0070678_100355077 3300005456 Bacteria 1261
56 Ga0070662_100079444 3300005457 Bacteria 2439
57 Ga0070662_100102735 3300005457 Bacteria 2166
58 Ga0070662_100179222 3300005457 Bacteria 1669
59 Ga0070681_10051662 3300005458 Bacteria 4100
60 Ga0070681_10508080 3300005458 Bacteria 1118
61 Ga0070681_10830435 3300005458 Bacteria 841
62 Ga0068867_100164780 3300005459 Bacteria 1751
63 Ga0070679_100116995 3300005530 Bacteria 2650
64 Ga0070679_100311193 3300005530 Bacteria 1525
65 Ga0070684_100245445 3300005535 Bacteria 1636
66 Ga0068853_100277896 3300005539 Bacteria 1543
67 Ga0068853_101154062 3300005539 Bacteria 747
68 Ga0070695_100107393 3300005545 Bacteria 1889
69 Ga0070695_101871363 3300005545 Bacteria 504
70 Ga0070693_100160888 3300005547 Bacteria 1430
71 Ga0070665_100000086 3300005548 Bacteria 178229
72 Ga0068855_100014403 3300005563 Bacteria 9520
73 Ga0068855_100056391 3300005563 Bacteria 4610
74 Ga0068855_100153248 3300005563 Bacteria 2619
75 Ga0068855_102113559 3300005563 Bacteria 567
76 Ga0070664_100127003 3300005564 Bacteria 2238
77 Ga0070664_101227536 3300005564 Bacteria 707
78 Ga0068857_100113850 3300005577 Bacteria 2432
79 Ga0068857_100262150 3300005577 Bacteria 1586
80 Ga0068857_100330325 3300005577 Bacteria 1409
81 Ga0068857_100516176 3300005577 Bacteria 1123
82 Ga0068857_100703105 3300005577 Bacteria 960
83 Ga0068857_101457618 3300005577 Bacteria 666
84 Ga0068854_100007023 3300005578 Bacteria 7184
85 Ga0068854_100263108 3300005578 Bacteria 1382
86 Ga0068854_100762176 3300005578 Bacteria 840
87 Ga0068854_100912930 3300005578 Bacteria 772
88 Ga0068856_100039275 3300005614 Bacteria 4646
89 Ga0068856_100044943 3300005614 Bacteria 4347
90 Ga0068852_100294333 3300005616 Bacteria 1569
91 Ga0068852_100414429 3300005616 Bacteria 1328
92 Ga0068852_100956688 3300005616 Bacteria 874
93 Ga0068852_101261386 3300005616 Bacteria 760
94 Ga0068864_100004572 3300005618 Bacteria 11360
95 Ga0068866_11080001 3300005718 Bacteria 574
96 Ga0068858_100003942 3300005842 Bacteria 14653
97 Ga0068858_100004671 3300005842 Bacteria 13425
98 Ga0081540_1058576 3300005983 Bacteria 1854
99 Ga0075364_10000558 3300006051 Bacteria 19112
100 Ga0075364_10144158 3300006051 Bacteria 1603
101 Ga0075362_10033788 3300006177 Bacteria 2226
102 Ga0075369_10168819 3300006186 Bacteria 1004
103 Ga0075369_10355187 3300006186 Bacteria 688
104 Ga0075366_10440412 3300006195 Bacteria 804
105 Ga0075370_10064180 3300006353 Bacteria 2094
106 Ga0068871_100120143 3300006358 Bacteria 2219
107 Ga0075428_100157408 3300006844 Bacteria 2467
108 Ga0075436_100887794 3300006914 Bacteria 666
109 Ga0105240_10877559 3300009093 Bacteria 966
110 Ga0111539_10043887 3300009094 Bacteria 5358
111 Ga0105245_10001264 3300009098 Bacteria 22840
112 Ga0114129_10097405 3300009147 Bacteria 4073
113 Ga0105243_10000876 3300009148 Bacteria 28409
114 Ga0105243_10090243 3300009148 Bacteria 2521
115 Ga0105243_10378055 3300009148 Bacteria 1309
116 Ga0105241_10005567 3300009174 Bacteria 9302
117 Ga0105241_11039065 3300009174 Bacteria 768
118 Ga0105242_10315579 3300009176 Bacteria 1432
119 Ga0105242_12462550 3300009176 Bacteria 568
120 Ga0105248_10032166 3300009177 Bacteria 5863
121 Ga0105237_10572783 3300009545 Bacteria 1136
122 Ga0105237_11171168 3300009545 Bacteria 775
123 Ga0105237_11393989 3300009545 Bacteria 707
124 Ga0105238_10078871 3300009551 Bacteria 3283
125 Ga0105238_10759244 3300009551 Bacteria 984
126 Ga0105249_10129555 3300009553 Bacteria 2407
127 Ga0105249_10186603 3300009553 Bacteria 2021
128 Ga0105249_10254844 3300009553 Bacteria 1741
129 Ga0105239_10281371 3300010375 Bacteria 1873
130 Ga0105239_10552011 3300010375 Bacteria 1312
131 Ga0105239_10580702 3300010375 Bacteria 1278
132 Ga0105239_11409832 3300010375 Bacteria 804
133 Ga0105239_11573566 3300010375 Bacteria 760
134 Ga0105239_12362118 3300010375 Bacteria 619
135 Ga0105246_10087502 3300011119 Bacteria 2236
136 Ga0105246_11019284 3300011119 Bacteria 751
137 Ga0105246_11432129 3300011119 Bacteria 646
138 Ga0157326_1005102 3300012513 Bacteria 1383
139 Ga0157373_10039441 3300013100 Bacteria 3381
140 Ga0157373_10139492 3300013100 Bacteria 1705
141 Ga0157373_10429590 3300013100 Bacteria 949
142 Ga0157371_10000030 3300013102 Bacteria 241585
143 Ga0157371_10002409 3300013102 Bacteria 17899
144 Ga0157370_10019186 3300013104 Bacteria 6873
145 Ga0157370_10229647 3300013104 Bacteria 1718
146 Ga0157369_11226738 3300013105 Bacteria 765
147 Ga0157374_10452704 3300013296 Bacteria 1285
148 Ga0157374_11915949 3300013296 Bacteria 619
149 Ga0157378_10097664 3300013297 Bacteria 2677
150 Ga0163162_10007973 3300013306 Bacteria 10326
151 Ga0163162_11932419 3300013306 Bacteria 676
152 Ga0157372_10559031 3300013307 Bacteria 1334
153 Ga0157372_10583815 3300013307 Bacteria 1302
154 Ga0157372_10893478 3300013307 Bacteria 1031
155 Ga0157372_11171676 3300013307 Bacteria 888
156 Ga0157372_11475709 3300013307 Bacteria 783
157 Ga0157375_10594570 3300013308 Bacteria 1266
158 Ga0182008_10983098 3300014497 Bacteria 502
159 Ga0157376_10133664 3300014969 Bacteria 2217
160 Ga0157376_11117040 3300014969 Bacteria 814
161 Ga0163161_10040465 3300017792 Bacteria 3348
162 Ga0213876_10111727 3300021384 Bacteria 1450
163 Ga0209563_100019 3300025230 Bacteria 697828
164 Ga0209148_1000017 3300025254 Bacteria 787064
165 Ga0209233_1000154 3300025261 Bacteria 169616
166 Ga0209233_1006001 3300025261 Bacteria 3962
167 Ga0209455_1000005 3300025272 Bacteria 1416756
168 Ga0209758_1000001 3300025297 Bacteria 1981790
169 Ga0209050_1000026 3300025298 Bacteria 499134
170 Ga0209257_1000009 3300025304 Bacteria 1205047
171 Ga0207697_10051021 3300025315 Bacteria 1709
172 Ga0207688_10098205 3300025901 Bacteria 1688
173 Ga0207647_10028951 3300025904 Bacteria 3591
174 Ga0207685_10367945 3300025905 Bacteria 729
175 Ga0207699_10101340 3300025906 Bacteria 1828
176 Ga0207645_10063405 3300025907 Bacteria 2361
177 Ga0207645_10226838 3300025907 Bacteria 1232
178 Ga0207705_10000531 3300025909 Bacteria 32288
179 Ga0207654_10000190 3300025911 Bacteria 37976
180 Ga0207707_10025034 3300025912 Bacteria 5222
181 Ga0207707_10052670 3300025912 Bacteria 3542
182 Ga0207695_10042726 3300025913 Bacteria 4837
183 Ga0207695_10271977 3300025913 Bacteria 1590
184 Ga0207671_10003175 3300025914 Bacteria 16591
185 Ga0207671_10966219 3300025914 Bacteria 672
186 Ga0207657_10071975 3300025919 Bacteria 2926
187 Ga0207657_10264374 3300025919 Bacteria 1368
188 Ga0207657_10427421 3300025919 Bacteria 1041
189 Ga0207649_10011496 3300025920 Bacteria 4882
190 Ga0207649_10199092 3300025920 Bacteria 1414
191 Ga0207649_10395839 3300025920 Bacteria 1033
192 Ga0207649_10453742 3300025920 Bacteria 968
193 Ga0207652_10048264 3300025921 Bacteria 3639
194 Ga0207694_10081519 3300025924 Bacteria 2542
195 Ga0207694_10094568 3300025924 Bacteria 2361
196 Ga0207694_10097248 3300025924 Bacteria 2329
197 Ga0207694_10466872 3300025924 Bacteria 1055
198 Ga0207694_10704448 3300025924 Bacteria 852
199 Ga0207659_10013104 3300025926 Bacteria 5301
200 Ga0207687_10003410 3300025927 Bacteria 10718
201 Ga0207690_10001685 3300025932 Bacteria 13618
202 Ga0207690_10285531 3300025932 Bacteria 1286
203 Ga0207706_10001012 3300025933 Bacteria 28668
204 Ga0207706_10052514 3300025933 Bacteria 3599
205 Ga0207686_10730249 3300025934 Bacteria 789
206 Ga0207709_10000031 3300025935 Bacteria 329046
207 Ga0207709_10220463 3300025935 Bacteria 1368
208 Ga0207669_10000077 3300025937 Bacteria 49918
209 Ga0207669_10029565 3300025937 Bacteria 3032
210 Ga0207711_10017656 3300025941 Bacteria 5926
211 Ga0207689_10191169 3300025942 Bacteria 1689
212 Ga0207689_11728374 3300025942 Bacteria 518
213 Ga0207661_10239584 3300025944 Bacteria 1609
214 Ga0207661_10318223 3300025944 Bacteria 1398
215 Ga0207679_10180840 3300025945 Bacteria 1744
216 Ga0207667_10000004 3300025949 Bacteria 737718
217 Ga0207667_10121091 3300025949 Bacteria 2696
218 Ga0207651_10030156 3300025960 Bacteria 3449
219 Ga0207712_10079964 3300025961 Bacteria 2376
220 Ga0207668_10221701 3300025972 Bacteria 1519
221 Ga0207640_10029437 3300025981 Bacteria 3371
222 Ga0207640_10416612 3300025981 Bacteria 1098
223 Ga0207658_10071753 3300025986 Bacteria 2623
224 Ga0207677_11010558 3300026023 Bacteria 754
225 Ga0207677_11201815 3300026023 Bacteria 694
226 Ga0207703_10001326 3300026035 Bacteria 22701
227 Ga0207703_10002565 3300026035 Bacteria 15695
228 Ga0207703_11384412 3300026035 Bacteria 677
229 Ga0207639_10037912 3300026041 Bacteria 3583
230 Ga0207639_10097153 3300026041 Bacteria 2371
231 Ga0207678_10171549 3300026067 Bacteria 1852
232 Ga0207678_10311323 3300026067 Bacteria 1354
233 Ga0207678_10758873 3300026067 Bacteria 855
234 Ga0207702_10000642 3300026078 Bacteria 38293
235 Ga0207648_10040752 3300026089 Bacteria 4080
236 Ga0207648_10404454 3300026089 Bacteria 1237
237 Ga0207676_10007867 3300026095 Bacteria 7580
238 Ga0207674_10087556 3300026116 Bacteria 3108
239 Ga0207674_10307914 3300026116 Bacteria 1533
240 Ga0207674_10394029 3300026116 Bacteria 1338
241 Ga0207674_10400558 3300026116 Bacteria 1326
242 Ga0207698_10105894 3300026142 Bacteria 2344
243 Ga0207698_10749307 3300026142 Bacteria 975
244 Ga0207698_10999615 3300026142 Bacteria 847
245 Ga0207698_11011503 3300026142 Bacteria 842
246 Ga0210002_1032920 3300027617 Bacteria 866
247 Ga0209971_1154517 3300027682 Bacteria 566
248 Ga0209998_10011875 3300027717 Bacteria 1808
249 Ga0268266_10000002 3300028379 Bacteria 3059047
250 Ga0307517_10035306 3300028786 Bacteria 5665
251 Ga0265338_11035185 3300028800 Bacteria 555
252 Ga0316182_1308535 3300030745 Bacteria 568
253 Ga0265327_10123173 3300031251 Bacteria 1226
254 Ga0307513_10235409 3300031456 Bacteria 1641
255 Ga0307513_10371019 3300031456 Bacteria 1173
256 Ga0307513_10480595 3300031456 Bacteria 962
257 Ga0307509_10623807 3300031507 Bacteria 749
258 Ga0307408_100076682 3300031548 Bacteria 2487
259 Ga0316579_10006704 3300031691 Bacteria 4713
260 Ga0316579_10417458 3300031691 Bacteria 649
261 Ga0265314_10008944 3300031711 Bacteria 8529
262 Ga0316576_10435361 3300031727 Bacteria 969
263 Ga0316576_10650699 3300031727 Bacteria 766
264 Ga0316576_10681855 3300031727 Bacteria 746
265 Ga0316578_10023162 3300031728 Bacteria 3473
266 Ga0316578_10188511 3300031728 Bacteria 1242
267 Ga0307516_10536883 3300031730 Bacteria 823
268 Ga0307405_10316380 3300031731 Bacteria 1190
269 Ga0307405_10759391 3300031731 Bacteria 809
270 Ga0307405_10798462 3300031731 Bacteria 790
271 Ga0316577_10179788 3300031733 Bacteria 1194
272 Ga0307413_10186022 3300031824 Bacteria 1486
273 Ga0307413_10599412 3300031824 Bacteria 901
274 Ga0307410_10346822 3300031852 Bacteria 1185
275 Ga0307410_10991444 3300031852 Bacteria 724
276 Ga0307412_10023153 3300031911 Bacteria 3818
277 Ga0307412_10076349 3300031911 Bacteria 2301
278 Ga0307412_10513923 3300031911 Bacteria 999
279 Ga0307416_100311290 3300032002 Bacteria 1571
280 Ga0307416_100661116 3300032002 Bacteria 1131
281 Ga0307414_11019294 3300032004 Bacteria 762
282 Ga0307411_10540412 3300032005 Bacteria 992
283 Ga0307415_100167809 3300032126 Bacteria 1709
284 Ga0307415_100238801 3300032126 Bacteria 1468
285 Ga0307415_101740959 3300032126 Bacteria 602
286 Ga0316583_10018558 3300032133 Bacteria 2497
287 Ga0316585_10272369 3300032137 Bacteria 561
288 Ga0316580_10030556 3300032139 Bacteria 1668
289 Ga0307510_10195604 3300033180 Bacteria 1564
290 Ga0373926_0028754 3300035083 Bacteria 1952
291 Ga0373932_0122345 3300035112 Bacteria 869
292 Ga0373943_0049186 3300035170 Bacteria 2068
293 Ga0373946_0184367 3300035171 Bacteria 992
294 Ga0373961_0164171 3300035241 Bacteria 765
295 Ga0316574_0701526 3300035398 Bacteria 620
296 Ga0373924_0514666 3300035410 Bacteria 538
297 Ga0373931_0017764 3300035691 Bacteria 3524
298 Ga0373935_0227642 3300035692 Bacteria 1297
299 Ga0373935_0770095 3300035692 Bacteria 710
300 Ga0373927_0012254 3300035695 Bacteria 5705
301 Ga0373933_0306367 3300035724 Bacteria 1029
302 Ga0373947_0013628 3300035725 Bacteria 4656
303 Ga0316582_0858058 3300036647 Bacteria 621
304 Ga0316584_0036331 3300036712 Bacteria 3655
305 Ga0373925_0054302 3300037068 Bacteria 2996
306 Ga0373925_0096599 3300037068 Unclassified 2265
307 Ga0395899_0316674 3300037312 Bacteria 1052
308 Ga0395905_0081929 3300037471 Bacteria 3024
309 Ga0395905_0082380 3300037471 Bacteria 3015
310 Ga0395905_0271644 3300037471 Bacteria 1581
311 Ga0395905_0365844 3300037471 Bacteria 1335
312 Ga0316581_0053247 3300037588 Bacteria 1240
313 Ga0395901_0078158 3300038443 Bacteria 3455
314 Ga0395901_0133979 3300038443 Bacteria 2604
315 Ga0395901_1404846 3300038443 Bacteria 656
316 Ga0400483_118183 3300039062 Bacteria 7064
317 Ga0436365_0451774 3300039437 Bacteria 987
318 Ga0436365_1683674 3300039437 Bacteria 1837
319 Ga0436363_1555732 3300039450 Bacteria 776
320 Ga0436362_1224760 3300039453 Bacteria 1040
321 Ga0451791_0405096 3300041451 Bacteria 1034
322 Ga0451793_0536722 3300041452 Bacteria 739
323 Ga0451797_0626230 3300041453 Bacteria 856
324 Ga0451845_0355435 3300041501 Bacteria 677
325 Ga0451855_0355703 3300041511 Bacteria 669
326 Ga0451853_1144479 3300041512 Bacteria 674
327 Ga0439448_0076338 3300042005 Bacteria 1121
328 Ga0451576_0000007 3300045051 Bacteria 782228
329 Ga0495627_001497 3300046453 Bacteria 13504
330 Ga0495603_0002724 3300046455 Bacteria 10418
331 Ga0495629_0000907 3300046459 Bacteria 23785
332 Ga0495638_0007575 3300046460 Bacteria 7766
333 Ga0495650_0000340 3300046471 Bacteria 83278
334 Ga0495580_0013222 3300046472 Bacteria 6309
335 Ga0495582_0018038 3300046473 Bacteria 3859
336 Ga0495639_0004636 3300046475 Bacteria 5901
337 Ga0495584_0015856 3300046491 Bacteria 3844
338 Ga0495584_0630224 3300046491 Bacteria 547
339 Ga0495594_0001129 3300046499 Bacteria 13930
340 Ga0495596_0052404 3300046500 Bacteria 1597
341 Ga0495583_0019131 3300046506 Bacteria 3583
342 Ga0495583_0019651 3300046506 Bacteria 3520
343 Ga0495583_0034397 3300046506 Bacteria 2427
344 Ga0495583_0148538 3300046506 Bacteria 972
345 Ga0495606_0000824 3300046507 Bacteria 47072
346 Ga0495630_0211328 3300046517 Bacteria 1481
347 Ga0495631_0208054 3300046518 Bacteria 836
348 Ga0495632_0083915 3300046519 Bacteria 1517
349 Ga0495637_0014507 3300046520 Bacteria 3718
350 Ga0495643_0008432 3300046522 Bacteria 6522
351 Ga0495643_0012592 3300046522 Bacteria 5096
352 Ga0495643_0013731 3300046522 Bacteria 4837
353 Ga0495643_0051552 3300046522 Bacteria 2213
354 Ga0495643_0382958 3300046522 Bacteria 623
355 Ga0495643_0384346 3300046522 Bacteria 622
356 Ga0495643_0434514 3300046522 Bacteria 574
357 Ga0495644_0073745 3300046523 Bacteria 1284
358 Ga0495648_0000303 3300046524 Bacteria 54717
359 Ga0495663_0014875 3300046525 Bacteria 2186
360 Ga0495666_0144415 3300046526 Bacteria 1108
361 Ga0495642_0106863 3300046528 Bacteria 1194
362 Ga0495609_0014516 3300046538 Bacteria 3701
363 Ga0495622_0018094 3300046557 Bacteria 3282
364 Ga0495622_0032906 3300046557 Bacteria 2420
365 Ga0495633_0007722 3300046558 Bacteria 6152
366 Ga0495633_0043068 3300046558 Bacteria 2142
367 Ga0495633_0091765 3300046558 Bacteria 1412
368 Ga0495633_0103301 3300046558 Bacteria 1322
369 Ga0495668_0000007 3300046616 Bacteria 552902
370 Ga0495634_0047892 3300046642 Bacteria 2879
371 Ga0495611_0150263 3300046648 Bacteria 1087
372 Ga0495625_0001479 3300046660 Bacteria 28402
373 Ga0495625_0009233 3300046660 Bacteria 8278
374 Ga0495625_0013066 3300046660 Bacteria 6691
375 Ga0495625_0025766 3300046660 Bacteria 4453
376 Ga0495625_0144593 3300046660 Bacteria 1602
377 Ga0495625_0214403 3300046660 Bacteria 1264
378 Ga0495625_0284306 3300046660 Bacteria 1063
379 Ga0495625_0789239 3300046660 Bacteria 553
380 Ga0495661_0086288 3300046665 Bacteria 1797
381 Ga0495588_0026414 3300046674 Bacteria 2898
382 Ga0495669_0000507 3300046684 Bacteria 17678
383 Ga0495669_0396514 3300046684 Bacteria 669
384 Ga0495613_0006945 3300046689 Bacteria 8444
385 Ga0495624_0102958 3300046690 Bacteria 1757
386 Ga0495670_0049902 3300046691 Bacteria 2094
387 Ga0495670_0052447 3300046691 Bacteria 2042
388 Ga0495671_0080673 3300046692 Bacteria 1594
389 Ga0495671_0424616 3300046692 Bacteria 636
390 Ga0495600_0013303 3300046809 Bacteria 5167
391 Ga0495660_0157130 3300046810 Bacteria 1118
392 Ga0495581_0017676 3300047315 Bacteria 4143
393 Ga0495676_0448560 3300047321 Bacteria 851
394 Ga0495680_0418595 3300047322 Bacteria 922
395 Ga0495683_0030887 3300047323 Bacteria 2731
396 Ga0495683_0204867 3300047323 Bacteria 887
397 Ga0495687_004439 3300047443 Bacteria 9474
398 Ga0495687_013793 3300047443 Bacteria 4194
399 Ga0495677_0006691 3300047445 Bacteria 4339
400 Ga0495681_0000011 3300047470 Bacteria 201843
401 Ga0495681_0150222 3300047470 Bacteria 978
402 Ga0495684_0544525 3300047471 Bacteria 791
403 Ga0495686_0052596 3300047472 Bacteria 2553
404 Ga0495593_0004291 3300047673 Bacteria 8477
405 Ga0495614_0015186 3300048089 Bacteria 3359
406 Ga0496101_0459223 3300048904 Bacteria 1005
407 Ga0496102_0011729 3300048905 Bacteria 7563
408 Ga0496102_0177808 3300048905 Bacteria 2004
409 Ga0496102_0779161 3300048905 Bacteria 879
410 Ga0496102_1407386 3300048905 Bacteria 616
411 Ga0496102_1609536 3300048905 Bacteria 568
412 Ga0496103_0000836 3300048906 Bacteria 22508
413 Ga0496103_0121314 3300048906 Bacteria 1665
414 Ga0496104_0033295 3300048907 Bacteria 4800
415 Ga0496104_0831456 3300048907 Bacteria 829
416 Ga0496105_0052177 3300048908 Bacteria 3376
417 Ga0496105_0196454 3300048908 Bacteria 1648
418 Ga0496105_0343701 3300048908 Bacteria 1193
419 Ga0496106_0288845 3300048909 Bacteria 1315
420 Ga0496107_0141097 3300048910 Bacteria 1781
421 Ga0496107_0754666 3300048910 Bacteria 714
422 Ga0496110_0501370 3300048913 Bacteria 1105
423 Ga0496111_0007641 3300048914 Bacteria 7105
424 Ga0496112_0011677 3300048915 Bacteria 8035
425 Ga0496113_0163203 3300048916 Bacteria 1762
426 Ga0496113_1172694 3300048916 Bacteria 601
427 Ga0496114_0137219 3300048917 Bacteria 2115
428 Ga0496114_0195286 3300048917 Bacteria 1771
429 Ga0496115_0000597 3300048918 Bacteria 27647
430 Ga0496115_0002445 3300048918 Bacteria 13344
431 Ga0496116_0017799 3300048919 Bacteria 5501
432 Ga0496117_0000182 3300048920 Bacteria 128076
433 Ga0496117_0179801 3300048920 Bacteria 1217
434 Ga0496118_0000125 3300048921 Bacteria 136422
435 Ga0496118_0073182 3300048921 Bacteria 2456
436 Ga0496119_0010214 3300048922 Bacteria 7921
437 Ga0496120_0033907 3300048923 Bacteria 3063
438 Ga0496121_0000367 3300048924 Bacteria 92745
439 Ga0496121_0007290 3300048924 Bacteria 13381
440 Ga0496121_0034537 3300048924 Bacteria 4551
441 Ga0496121_0129749 3300048924 Bacteria 1889
442 Ga0496122_0023643 3300048925 Bacteria 5406
443 Ga0496122_0036059 3300048925 Bacteria 4009
444 Ga0496123_0024694 3300048926 Bacteria 4559
445 Ga0496123_0041016 3300048926 Bacteria 3215
446 Ga0496124_0000082 3300048927 Bacteria 208248
447 Ga0496125_0002269 3300048928 Bacteria 25512
448 Ga0496126_0000221 3300048929 Bacteria 124193
449 Ga0496126_0633262 3300048929 Bacteria 839
450 Ga0495678_226482 3300049459 Bacteria 565
451 Ga0501031_0475813 3300049568 Bacteria 806
452 Ga0501036_0300804 3300049572 Bacteria 1342
453 Ga0501036_0698343 3300049572 Bacteria 838
454 Ga0501037_0130539 3300049573 Bacteria 1802
455 Ga0501037_0419393 3300049573 Bacteria 916
456 Ga0501038_0024065 3300049574 Bacteria 5435
457 Ga0501038_0162203 3300049574 Bacteria 1816
458 Ga0501038_0272083 3300049574 Bacteria 1335
459 Ga0501039_0121841 3300049575 Bacteria 2044
460 Ga0501039_0590748 3300049575 Bacteria 870
461 Ga0501040_0053816 3300049576 Bacteria 2758
462 Ga0501041_0163729 3300049577 Bacteria 1391
463 Ga0501042_0090173 3300049578 Bacteria 2200
464 Ga0501042_0140537 3300049578 Bacteria 1741
465 Ga0501042_0281248 3300049578 Bacteria 1202
466 Ga0501046_0171634 3300049580 Bacteria 1627
467 Ga0501046_0356179 3300049580 Bacteria 1062
468 Ga0501046_0886504 3300049580 Bacteria 623
469 Ga0501068_0082693 3300049584 Bacteria 1973
470 Ga0501070_0582583 3300049586 Bacteria 893
471 Ga0501071_0014849 3300049587 Bacteria 5335
472 Ga0501072_0207638 3300049588 Bacteria 1561
473 Ga0501073_0913935 3300049589 Bacteria 604
474 Ga0501074_0561793 3300049590 Bacteria 808
475 Ga0501074_1062612 3300049590 Bacteria 569
476 Ga0501075_0084906 3300049591 Bacteria 2398
477 Ga0501076_0099355 3300049592 Bacteria 2344
478 Ga0501076_0107757 3300049592 Bacteria 2250
479 Ga0501077_0321028 3300049593 Bacteria 987
480 Ga0501079_0074851 3300049741 Bacteria 2618
481 Ga0501080_0510921 3300049742 Bacteria 1073
482 Ga0501081_0058001 3300049743 Bacteria 2678
483 Ga0501081_0136410 3300049743 Bacteria 1756
484 Ga0501081_0688437 3300049743 Bacteria 767
485 Ga0501081_1150548 3300049743 Bacteria 587
486 Ga0501044_0327664 3300049823 Bacteria 1455
487 Ga0501045_0304397 3300049824 Bacteria 1186
488 Ga0501045_0782595 3300049824 Bacteria 703
489 nmdc:mga03683_7580_c1 3300050489 Bacteria 3774
490 nmdc:mga00v17_302228_c1 3300050491 Bacteria 1039
491 nmdc:mga00v17_5943_c1 3300050491 Bacteria 6454
492 nmdc:mga0k408_214869_c1 3300050493 Bacteria 1148
493 nmdc:mga0k408_53081_c1 3300050493 Bacteria 2349
494 nmdc:mga07m45_41377_c1 3300050496 Bacteria 2580
495 nmdc:mga08y16_142307_c1 3300050511 Bacteria 1523
496 nmdc:mga08y16_821233_c1 3300050511 Bacteria 921
497 nmdc:mga0a205_699074_c1 3300050515 Bacteria 864
498 nmdc:mga0sz30_18727_c2 3300050516 Bacteria 886
499 Ga0495612_0128142 3300053078 Bacteria 1095
500 Ga0500610_0000140 3300053079 Bacteria 21620
501 Ga0495619_0004011 3300053085 Bacteria 9435
502 Ga0500643_000001 3300053087 Bacteria 1440111
503 Ga0500643_009771 3300053087 Bacteria 3637
504 Ga0500643_009963 3300053087 Bacteria 3581
505 Ga0500643_059905 3300053087 Bacteria 1070
506 Ga0500647_0253708 3300053091 Bacteria 772
507 Ga0500651_0497353 3300053093 Bacteria 673
508 Ga0500641_0040456 3300053096 Bacteria 1883
509 Ga0500555_002842 3300053103 Bacteria 4971
510 Ga0500562_011833 3300053108 Bacteria 2217
511 Ga0500562_070644 3300053108 Bacteria 942
512 Ga0500595_010172 3300053119 Bacteria 3750
513 Ga0500642_0000804 3300053130 Bacteria 9202
514 Ga0500559_0103072 3300053136 Bacteria 1316
515 Ga0500559_0183075 3300053136 Bacteria 987
516 Ga0500559_0322299 3300053136 Bacteria 724
517 Ga0500573_0239100 3300053140 Bacteria 943
518 Ga0500616_0007018 3300053153 Bacteria 7233
519 Ga0500616_0081604 3300053153 Bacteria 1624
520 Ga0500616_0133312 3300053153 Bacteria 1171
521 Ga0500619_176045 3300053154 Bacteria 723
522 Ga0500624_000666 3300053157 Bacteria 8884
523 Ga0500636_0033551 3300053177 Bacteria 3038
524 Ga0500636_0088068 3300053177 Bacteria 1781
525 Ga0500645_000080 3300053730 Bacteria 76756
526 Ga0500645_142269 3300053730 Bacteria 663
527 Ga0500596_004831 3300053735 Bacteria 2435
528 Ga0500661_026348 3300055283 Bacteria 1027
529 Ga0500661_085737 3300055283 Bacteria 587
530 Ga0587101_048128 3300059623 Bacteria 726
531 Ga0587111_0089978 3300060346 Bacteria 748
532 Ga0530510_0020509 3300061734 Bacteria 4699

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0000007 Ga0451576_0000007_117923_118378 128
2 3300046491 Ga0495584_0630224 Ga0495584_0630224_65_514 131
3 3300005328 Ga0070676_10537856 Ga0070676_105378561 133
4 3300005341 Ga0070691_10143677 Ga0070691_101436772 133
5 3300005344 Ga0070661_100514733 Ga0070661_1005147332 133
6 3300005347 Ga0070668_100437766 Ga0070668_1004377662 133
7 3300005365 Ga0070688_100268431 Ga0070688_1002684312 133
8 3300005438 Ga0070701_10847703 Ga0070701_108477031 133
9 3300005547 Ga0070693_100160888 Ga0070693_1001608882 133
10 3300009147 Ga0114129_10097405 Ga0114129_100974052 133
11 3300009553 Ga0105249_10129555 Ga0105249_101295552 133
12 3300025907 Ga0207645_10063405 Ga0207645_100634053 134
13 3300025920 Ga0207649_10453742 Ga0207649_104537421 134
14 3300025942 Ga0207689_11728374 Ga0207689_117283741 134
15 3300025961 Ga0207712_10079964 Ga0207712_100799642 134
16 3300025972 Ga0207668_10221701 Ga0207668_102217012 134
17 3300031691 Ga0316579_10006704 Ga0316579_100067041 134
18 3300031727 Ga0316576_10435361 Ga0316576_104353611 134
19 3300031727 Ga0316576_10650699 Ga0316576_106506991 134
20 3300031728 Ga0316578_10023162 Ga0316578_100231621 134
21 3300031728 Ga0316578_10188511 Ga0316578_101885112 134
22 3300031733 Ga0316577_10179788 Ga0316577_101797882 134
23 3300032133 Ga0316583_10018558 Ga0316583_100185582 134
24 3300032137 Ga0316585_10272369 Ga0316585_102723691 134
25 3300032139 Ga0316580_10030556 Ga0316580_100305561 134
26 3300035398 Ga0316574_0701526 Ga0316574_0701526_80_529 134
27 3300036647 Ga0316582_0858058 Ga0316582_0858058_161_610 134
28 3300036712 Ga0316584_0036331 Ga0316584_0036331_674_1123 134
29 3300037588 Ga0316581_0053247 Ga0316581_0053247_724_1173 134
30 3300010375 Ga0105239_10552011 Ga0105239_105520112 135
31 3300026035 Ga0207703_11384412 Ga0207703_113844121 135
32 3300035112 Ga0373932_0122345 Ga0373932_0122345_107_556 135
33 3300035691 Ga0373931_0017764 Ga0373931_0017764_2315_2764 135
34 3300048905 Ga0496102_0779161 Ga0496102_0779161_417_866 135
35 3300049588 Ga0501072_0207638 Ga0501072_0207638_230_679 135
36 3300049592 Ga0501076_0107757 Ga0501076_0107757_190_639 135
37 3300005545 Ga0070695_100107393 Ga0070695_1001073932 136
38 3300005718 Ga0068866_11080001 Ga0068866_110800012 136
39 3300009176 Ga0105242_12462550 Ga0105242_124625501 136
40 3300025934 Ga0207686_10730249 Ga0207686_107302491 136
41 3300046684 Ga0495669_0396514 Ga0495669_0396514_66_515 136
42 3300048910 Ga0496107_0754666 Ga0496107_0754666_252_701 136
43 3300050511 nmdc:mga08y16_821233_c1 nmdc:mga08y16_821233_c1_44_493 137
44 3300009148 Ga0105243_10378055 Ga0105243_103780552 138
45 3300011119 Ga0105246_11432129 Ga0105246_114321291 138
46 3300046558 Ga0495633_0043068 Ga0495633_0043068_379_831 139
47 3300053087 Ga0500643_009963 Ga0500643_009963_2475_2927 139
48 3300053140 Ga0500573_0239100 Ga0500573_0239100_55_507 139
49 3300053157 Ga0500624_000666 Ga0500624_000666_7054_7506 139
50 3300053177 Ga0500636_0033551 Ga0500636_0033551_563_1015 139
51 3300026023 Ga0207677_11201815 Ga0207677_112018152 140
52 3300053078 Ga0495612_0128142 Ga0495612_0128142_116_565 142
53 3300048907 Ga0496104_0831456 Ga0496104_0831456_228_746 144
54 3300050493 nmdc:mga0k408_214869_c1 nmdc:mga0k408_214869_c1_26_466 146
55 iso_pu_bacteria 2751185897 2753764448 146
56 iso_pu_bacteria 2879163058 2879165714 146
57 iso_pu_bacteria 2882806704 2882807873 146
58 iso_pu_bacteria 2928526807 2928527570 146
59 iso_pu_bacteria 3000865235 3000865972 146
60 iso_pu_bacteria 2511231221 2512032812 147
61 iso_pu_bacteria 8054002106 8054006304 147
62 3300005289 Ga0065704_10288184 Ga0065704_102881841 149
63 3300005563 Ga0068855_100014403 Ga0068855_1000144034 149
64 3300006914 Ga0075436_100887794 Ga0075436_1008877942 149
65 3300009094 Ga0111539_10043887 Ga0111539_100438872 149
66 3300014497 Ga0182008_10983098 Ga0182008_109830981 149
67 3300025905 Ga0207685_10367945 Ga0207685_103679451 149
68 3300025906 Ga0207699_10101340 Ga0207699_101013402 149
69 3300027617 Ga0210002_1032920 Ga0210002_10329201 149
70 3300027682 Ga0209971_1154517 Ga0209971_11545171 149
71 3300027717 Ga0209998_10011875 Ga0209998_100118751 149
72 3300031691 Ga0316579_10417458 Ga0316579_104174581 149
73 3300035083 Ga0373926_0028754 Ga0373926_0028754_546_995 149
74 3300035170 Ga0373943_0049186 Ga0373943_0049186_1130_1579 149
75 3300035171 Ga0373946_0184367 Ga0373946_0184367_364_813 149
76 3300035241 Ga0373961_0164171 Ga0373961_0164171_289_738 149
77 3300035410 Ga0373924_0514666 Ga0373924_0514666_53_502 149
78 3300035692 Ga0373935_0227642 Ga0373935_0227642_669_1118 149
79 3300035695 Ga0373927_0012254 Ga0373927_0012254_1744_2193 149
80 3300035724 Ga0373933_0306367 Ga0373933_0306367_489_938 149
81 3300035725 Ga0373947_0013628 Ga0373947_0013628_2344_2793 149
82 3300037068 Ga0373925_0054302 Ga0373925_0054302_796_1245 149
83 3300046455 Ga0495603_0002724 Ga0495603_0002724_2590_3039 149
84 3300046459 Ga0495629_0000907 Ga0495629_0000907_2906_3355 149
85 3300046472 Ga0495580_0013222 Ga0495580_0013222_5707_6156 149
86 3300046473 Ga0495582_0018038 Ga0495582_0018038_918_1367 149
87 3300046475 Ga0495639_0004636 Ga0495639_0004636_2453_2902 149
88 3300046491 Ga0495584_0015856 Ga0495584_0015856_94_543 149
89 3300046499 Ga0495594_0001129 Ga0495594_0001129_2373_2822 149
90 3300046517 Ga0495630_0211328 Ga0495630_0211328_250_699 149
91 3300046523 Ga0495644_0073745 Ga0495644_0073745_753_1205 149
92 3300046557 Ga0495622_0018094 Ga0495622_0018094_325_774 149
93 3300046558 Ga0495633_0091765 Ga0495633_0091765_190_642 149
94 3300046642 Ga0495634_0047892 Ga0495634_0047892_2262_2711 149
95 3300046674 Ga0495588_0026414 Ga0495588_0026414_1581_2030 149
96 3300046689 Ga0495613_0006945 Ga0495613_0006945_5597_6046 149
97 3300046690 Ga0495624_0102958 Ga0495624_0102958_44_493 149
98 3300047315 Ga0495581_0017676 Ga0495581_0017676_2958_3407 149
99 3300047321 Ga0495676_0448560 Ga0495676_0448560_14_463 149
100 3300047322 Ga0495680_0418595 Ga0495680_0418595_113_562 149
101 3300047471 Ga0495684_0544525 Ga0495684_0544525_283_732 149
102 3300047673 Ga0495593_0004291 Ga0495593_0004291_5438_5887 149
103 3300048089 Ga0495614_0015186 Ga0495614_0015186_440_889 149
104 3300048904 Ga0496101_0459223 Ga0496101_0459223_19_471 149
105 3300048905 Ga0496102_0177808 Ga0496102_0177808_645_1094 149
106 3300048905 Ga0496102_1407386 Ga0496102_1407386_48_497 149
107 3300048906 Ga0496103_0121314 Ga0496103_0121314_1139_1591 149
108 3300048908 Ga0496105_0196454 Ga0496105_0196454_1093_1545 149
109 3300048909 Ga0496106_0288845 Ga0496106_0288845_18_470 149
110 3300048915 Ga0496112_0011677 Ga0496112_0011677_3638_4090 149
111 3300048916 Ga0496113_0163203 Ga0496113_0163203_143_634 149
112 3300049568 Ga0501031_0475813 Ga0501031_0475813_258_707 149
113 3300049572 Ga0501036_0300804 Ga0501036_0300804_565_1014 149
114 3300049572 Ga0501036_0698343 Ga0501036_0698343_356_805 149
115 3300049573 Ga0501037_0419393 Ga0501037_0419393_199_648 149
116 3300049574 Ga0501038_0162203 Ga0501038_0162203_880_1329 149
117 3300049574 Ga0501038_0272083 Ga0501038_0272083_469_918 149
118 3300049575 Ga0501039_0121841 Ga0501039_0121841_44_493 149
119 3300049575 Ga0501039_0590748 Ga0501039_0590748_112_561 149
120 3300049576 Ga0501040_0053816 Ga0501040_0053816_168_617 149
121 3300049577 Ga0501041_0163729 Ga0501041_0163729_598_1047 149
122 3300049578 Ga0501042_0090173 Ga0501042_0090173_1010_1459 149
123 3300049578 Ga0501042_0140537 Ga0501042_0140537_252_701 149
124 3300049578 Ga0501042_0281248 Ga0501042_0281248_66_515 149
125 3300049580 Ga0501046_0171634 Ga0501046_0171634_234_683 149
126 3300049580 Ga0501046_0886504 Ga0501046_0886504_38_487 149
127 3300049584 Ga0501068_0082693 Ga0501068_0082693_476_925 149
128 3300049587 Ga0501071_0014849 Ga0501071_0014849_1826_2275 149
129 3300049589 Ga0501073_0913935 Ga0501073_0913935_26_475 149
130 3300049590 Ga0501074_0561793 Ga0501074_0561793_279_728 149
131 3300049590 Ga0501074_1062612 Ga0501074_1062612_27_476 149
132 3300049591 Ga0501075_0084906 Ga0501075_0084906_1321_1770 149
133 3300049592 Ga0501076_0099355 Ga0501076_0099355_1751_2200 149
134 3300049593 Ga0501077_0321028 Ga0501077_0321028_381_830 149
135 3300049741 Ga0501079_0074851 Ga0501079_0074851_1011_1460 149
136 3300049742 Ga0501080_0510921 Ga0501080_0510921_531_980 149
137 3300049743 Ga0501081_0058001 Ga0501081_0058001_513_962 149
138 3300049743 Ga0501081_0136410 Ga0501081_0136410_277_726 149
139 3300049743 Ga0501081_0688437 Ga0501081_0688437_259_708 149
140 3300049743 Ga0501081_1150548 Ga0501081_1150548_126_575 149
141 3300049824 Ga0501045_0304397 Ga0501045_0304397_258_707 149
142 3300049824 Ga0501045_0782595 Ga0501045_0782595_172_621 149
143 3300050511 nmdc:mga08y16_142307_c1 nmdc:mga08y16_142307_c1_31_480 149
144 3300050515 nmdc:mga0a205_699074_c1 nmdc:mga0a205_699074_c1_237_686 149
145 3300053085 Ga0495619_0004011 Ga0495619_0004011_3113_3562 149
146 3300061734 Ga0530510_0020509 Ga0530510_0020509_1904_2353 149
147 3300001915 JGI24741J21665_1001343 JGI24741J21665_10013431 150
148 3300001915 JGI24741J21665_1016365 JGI24741J21665_10163652 150
149 3300001978 JGI24747J21853_1039958 JGI24747J21853_10399581 150
150 3300001979 JGI24740J21852_10044474 JGI24740J21852_100444742 150
151 3300001979 JGI24740J21852_10047532 JGI24740J21852_100475322 150
152 3300001979 JGI24740J21852_10052507 JGI24740J21852_100525072 150
153 3300001990 JGI24737J22298_10029642 JGI24737J22298_100296422 150
154 3300001990 JGI24737J22298_10181254 JGI24737J22298_101812541 150
155 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006211 150
156 3300003759 Ga0055525_1000051 Ga0055525_100005143 150
157 3300003762 Ga0055542_1000020 Ga0055542_1000020158 150
158 3300003763 Ga0055529_1000016 Ga0055529_1000016189 150
159 3300003791 Ga0055530_10000978 Ga0055530_1000097815 150
160 3300003794 Ga0055531_10001645 Ga0055531_1000164515 150
161 3300005262 Ga0065165_1039706 Ga0065165_10397062 150
162 3300005289 Ga0065704_10070209 Ga0065704_1007020948 150
163 3300005327 Ga0070658_10001558 Ga0070658_1000155817 150
164 3300005327 Ga0070658_10514482 Ga0070658_105144821 150
165 3300005328 Ga0070676_11024555 Ga0070676_110245551 150
166 3300005329 Ga0070683_100105670 Ga0070683_1001056703 150
167 3300005329 Ga0070683_100361830 Ga0070683_1003618302 150
168 3300005330 Ga0070690_100452281 Ga0070690_1004522811 150
169 3300005336 Ga0070680_100025291 Ga0070680_1000252914 150
170 3300005336 Ga0070680_100105728 Ga0070680_1001057282 150
171 3300005336 Ga0070680_101088607 Ga0070680_1010886071 150
172 3300005339 Ga0070660_100616784 Ga0070660_1006167841 150
173 3300005344 Ga0070661_100001207 Ga0070661_10000120711 150
174 3300005344 Ga0070661_100227527 Ga0070661_1002275272 150
175 3300005344 Ga0070661_100241612 Ga0070661_1002416122 150
176 3300005344 Ga0070661_100624656 Ga0070661_1006246561 150
177 3300005347 Ga0070668_100750172 Ga0070668_1007501722 150
178 3300005347 Ga0070668_101477547 Ga0070668_1014775471 150
179 3300005353 Ga0070669_101168684 Ga0070669_1011686841 150
180 3300005354 Ga0070675_100083570 Ga0070675_1000835702 150
181 3300005355 Ga0070671_100167790 Ga0070671_1001677902 150
182 3300005356 Ga0070674_100003705 Ga0070674_1000037056 150
183 3300005364 Ga0070673_100105514 Ga0070673_1001055143 150
184 3300005366 Ga0070659_100010912 Ga0070659_1000109124 150
185 3300005366 Ga0070659_100037913 Ga0070659_1000379134 150
186 3300005366 Ga0070659_100135769 Ga0070659_1001357693 150
187 3300005366 Ga0070659_100852005 Ga0070659_1008520051 150
188 3300005440 Ga0070705_100642419 Ga0070705_1006424191 150
189 3300005444 Ga0070694_101797019 Ga0070694_1017970191 150
190 3300005455 Ga0070663_100015002 Ga0070663_1000150025 150
191 3300005455 Ga0070663_100131892 Ga0070663_1001318921 150
192 3300005455 Ga0070663_100529178 Ga0070663_1005291782 150
193 3300005456 Ga0070678_100002746 Ga0070678_1000027465 150
194 3300005456 Ga0070678_100355077 Ga0070678_1003550772 150
195 3300005457 Ga0070662_100079444 Ga0070662_1000794442 150
196 3300005457 Ga0070662_100102735 Ga0070662_1001027351 150
197 3300005457 Ga0070662_100179222 Ga0070662_1001792222 150
198 3300005458 Ga0070681_10051662 Ga0070681_100516622 150
199 3300005458 Ga0070681_10508080 Ga0070681_105080802 150
200 3300005458 Ga0070681_10830435 Ga0070681_108304351 150
201 3300005459 Ga0068867_100164780 Ga0068867_1001647802 150
202 3300005530 Ga0070679_100116995 Ga0070679_1001169954 150
203 3300005530 Ga0070679_100311193 Ga0070679_1003111932 150
204 3300005535 Ga0070684_100245445 Ga0070684_1002454452 150
205 3300005539 Ga0068853_100277896 Ga0068853_1002778961 150
206 3300005539 Ga0068853_101154062 Ga0068853_1011540621 150
207 3300005545 Ga0070695_101871363 Ga0070695_1018713631 150
208 3300005548 Ga0070665_100000086 Ga0070665_1000000866 150
209 3300005563 Ga0068855_100056391 Ga0068855_1000563914 150
210 3300005563 Ga0068855_100153248 Ga0068855_1001532481 150
211 3300005563 Ga0068855_102113559 Ga0068855_1021135591 150
212 3300005564 Ga0070664_100127003 Ga0070664_1001270032 150
213 3300005564 Ga0070664_101227536 Ga0070664_1012275361 150
214 3300005577 Ga0068857_100113850 Ga0068857_1001138501 150
215 3300005577 Ga0068857_100262150 Ga0068857_1002621501 150
216 3300005577 Ga0068857_100330325 Ga0068857_1003303253 150
217 3300005577 Ga0068857_100516176 Ga0068857_1005161761 150
218 3300005577 Ga0068857_100703105 Ga0068857_1007031052 150
219 3300005577 Ga0068857_101457618 Ga0068857_1014576181 150
220 3300005578 Ga0068854_100007023 Ga0068854_1000070234 150
221 3300005578 Ga0068854_100263108 Ga0068854_1002631082 150
222 3300005578 Ga0068854_100762176 Ga0068854_1007621762 150
223 3300005578 Ga0068854_100912930 Ga0068854_1009129302 150
224 3300005614 Ga0068856_100039275 Ga0068856_1000392753 150
225 3300005614 Ga0068856_100044943 Ga0068856_1000449432 150
226 3300005616 Ga0068852_100294333 Ga0068852_1002943332 150
227 3300005616 Ga0068852_100414429 Ga0068852_1004144292 150
228 3300005616 Ga0068852_100956688 Ga0068852_1009566882 150
229 3300005616 Ga0068852_101261386 Ga0068852_1012613861 150
230 3300005618 Ga0068864_100004572 Ga0068864_1000045729 150
231 3300005842 Ga0068858_100003942 Ga0068858_1000039428 150
232 3300005842 Ga0068858_100004671 Ga0068858_10000467112 150
233 3300005983 Ga0081540_1058576 Ga0081540_10585762 150
234 3300006051 Ga0075364_10000558 Ga0075364_1000055813 150
235 3300006051 Ga0075364_10144158 Ga0075364_101441581 150
236 3300006177 Ga0075362_10033788 Ga0075362_100337883 150
237 3300006186 Ga0075369_10168819 Ga0075369_101688192 150
238 3300006186 Ga0075369_10355187 Ga0075369_103551871 150
239 3300006195 Ga0075366_10440412 Ga0075366_104404122 150
240 3300006353 Ga0075370_10064180 Ga0075370_100641802 150
241 3300006358 Ga0068871_100120143 Ga0068871_1001201432 150
242 3300006844 Ga0075428_100157408 Ga0075428_1001574084 150
243 3300009093 Ga0105240_10877559 Ga0105240_108775591 150
244 3300009098 Ga0105245_10001264 Ga0105245_1000126417 150
245 3300009148 Ga0105243_10000876 Ga0105243_100008767 150
246 3300009148 Ga0105243_10090243 Ga0105243_100902432 150
247 3300009174 Ga0105241_10005567 Ga0105241_100055672 150
248 3300009174 Ga0105241_11039065 Ga0105241_110390651 150
249 3300009176 Ga0105242_10315579 Ga0105242_103155791 150
250 3300009177 Ga0105248_10032166 Ga0105248_100321664 150
251 3300009545 Ga0105237_10572783 Ga0105237_105727832 150
252 3300009545 Ga0105237_11171168 Ga0105237_111711681 150
253 3300009545 Ga0105237_11393989 Ga0105237_113939892 150
254 3300009551 Ga0105238_10078871 Ga0105238_100788712 150
255 3300009551 Ga0105238_10759244 Ga0105238_107592442 150
256 3300009553 Ga0105249_10186603 Ga0105249_101866032 150
257 3300009553 Ga0105249_10254844 Ga0105249_102548443 150
258 3300010375 Ga0105239_10281371 Ga0105239_102813712 150
259 3300010375 Ga0105239_10580702 Ga0105239_105807022 150
260 3300010375 Ga0105239_11409832 Ga0105239_114098322 150
261 3300010375 Ga0105239_11573566 Ga0105239_115735662 150
262 3300010375 Ga0105239_12362118 Ga0105239_123621181 150
263 3300011119 Ga0105246_10087502 Ga0105246_100875022 150
264 3300011119 Ga0105246_11019284 Ga0105246_110192841 150
265 3300012513 Ga0157326_1005102 Ga0157326_10051021 150
266 3300013100 Ga0157373_10039441 Ga0157373_100394413 150
267 3300013100 Ga0157373_10139492 Ga0157373_101394921 150
268 3300013100 Ga0157373_10429590 Ga0157373_104295902 150
269 3300013102 Ga0157371_10000030 Ga0157371_10000030224 150
270 3300013102 Ga0157371_10002409 Ga0157371_100024093 150
271 3300013104 Ga0157370_10019186 Ga0157370_100191866 150
272 3300013104 Ga0157370_10229647 Ga0157370_102296471 150
273 3300013105 Ga0157369_11226738 Ga0157369_112267381 150
274 3300013296 Ga0157374_10452704 Ga0157374_104527041 150
275 3300013296 Ga0157374_11915949 Ga0157374_119159491 150
276 3300013297 Ga0157378_10097664 Ga0157378_100976643 150
277 3300013306 Ga0163162_10007973 Ga0163162_100079733 150
278 3300013306 Ga0163162_11932419 Ga0163162_119324191 150
279 3300013307 Ga0157372_10559031 Ga0157372_105590313 150
280 3300013307 Ga0157372_10583815 Ga0157372_105838152 150
281 3300013307 Ga0157372_10893478 Ga0157372_108934782 150
282 3300013307 Ga0157372_11171676 Ga0157372_111716761 150
283 3300013307 Ga0157372_11475709 Ga0157372_114757091 150
284 3300013308 Ga0157375_10594570 Ga0157375_105945702 150
285 3300014969 Ga0157376_10133664 Ga0157376_101336641 150
286 3300014969 Ga0157376_11117040 Ga0157376_111170401 150
287 3300017792 Ga0163161_10040465 Ga0163161_100404656 150
288 3300021384 Ga0213876_10111727 Ga0213876_101117272 150
289 3300025230 Ga0209563_100019 Ga0209563_100019463 150
290 3300025254 Ga0209148_1000017 Ga0209148_1000017559 150
291 3300025261 Ga0209233_1000154 Ga0209233_100015481 150
292 3300025261 Ga0209233_1006001 Ga0209233_10060012 150
293 3300025272 Ga0209455_1000005 Ga0209455_1000005559 150
294 3300025297 Ga0209758_1000001 Ga0209758_10000011614 150
295 3300025298 Ga0209050_1000026 Ga0209050_1000026263 150
296 3300025304 Ga0209257_1000009 Ga0209257_1000009263 150
297 3300025315 Ga0207697_10051021 Ga0207697_100510211 150
298 3300025901 Ga0207688_10098205 Ga0207688_100982052 150
299 3300025904 Ga0207647_10028951 Ga0207647_100289514 150
300 3300025907 Ga0207645_10226838 Ga0207645_102268381 150
301 3300025909 Ga0207705_10000531 Ga0207705_100005317 150
302 3300025911 Ga0207654_10000190 Ga0207654_100001909 150
303 3300025912 Ga0207707_10025034 Ga0207707_100250342 150
304 3300025912 Ga0207707_10052670 Ga0207707_100526703 150
305 3300025913 Ga0207695_10042726 Ga0207695_100427268 150
306 3300025913 Ga0207695_10271977 Ga0207695_102719772 150
307 3300025914 Ga0207671_10003175 Ga0207671_100031751 150
308 3300025914 Ga0207671_10966219 Ga0207671_109662191 150
309 3300025919 Ga0207657_10071975 Ga0207657_100719751 150
310 3300025919 Ga0207657_10264374 Ga0207657_102643741 150
311 3300025919 Ga0207657_10427421 Ga0207657_104274212 150
312 3300025920 Ga0207649_10011496 Ga0207649_100114966 150
313 3300025920 Ga0207649_10199092 Ga0207649_101990922 150
314 3300025920 Ga0207649_10395839 Ga0207649_103958392 150
315 3300025921 Ga0207652_10048264 Ga0207652_100482643 150
316 3300025924 Ga0207694_10081519 Ga0207694_100815193 150
317 3300025924 Ga0207694_10094568 Ga0207694_100945686 150
318 3300025924 Ga0207694_10097248 Ga0207694_100972482 150
319 3300025924 Ga0207694_10466872 Ga0207694_104668722 150
320 3300025924 Ga0207694_10704448 Ga0207694_107044482 150
321 3300025926 Ga0207659_10013104 Ga0207659_100131042 150
322 3300025927 Ga0207687_10003410 Ga0207687_100034104 150
323 3300025932 Ga0207690_10001685 Ga0207690_1000168510 150
324 3300025932 Ga0207690_10285531 Ga0207690_102855311 150
325 3300025933 Ga0207706_10001012 Ga0207706_100010124 150
326 3300025933 Ga0207706_10052514 Ga0207706_100525143 150
327 3300025935 Ga0207709_10000031 Ga0207709_1000003184 150
328 3300025935 Ga0207709_10220463 Ga0207709_102204632 150
329 3300025937 Ga0207669_10000077 Ga0207669_1000007737 150
330 3300025937 Ga0207669_10029565 Ga0207669_100295652 150
331 3300025941 Ga0207711_10017656 Ga0207711_100176564 150
332 3300025942 Ga0207689_10191169 Ga0207689_101911692 150
333 3300025944 Ga0207661_10239584 Ga0207661_102395843 150
334 3300025944 Ga0207661_10318223 Ga0207661_103182232 150
335 3300025945 Ga0207679_10180840 Ga0207679_101808402 150
336 3300025949 Ga0207667_10000004 Ga0207667_10000004368 150
337 3300025949 Ga0207667_10121091 Ga0207667_101210911 150
338 3300025960 Ga0207651_10030156 Ga0207651_100301566 150
339 3300025981 Ga0207640_10029437 Ga0207640_100294374 150
340 3300025981 Ga0207640_10416612 Ga0207640_104166122 150
341 3300025986 Ga0207658_10071753 Ga0207658_100717532 150
342 3300026023 Ga0207677_11010558 Ga0207677_110105581 150
343 3300026035 Ga0207703_10001326 Ga0207703_1000132620 150
344 3300026035 Ga0207703_10002565 Ga0207703_100025658 150
345 3300026041 Ga0207639_10037912 Ga0207639_100379126 150
346 3300026041 Ga0207639_10097153 Ga0207639_100971533 150
347 3300026067 Ga0207678_10171549 Ga0207678_101715492 150
348 3300026067 Ga0207678_10311323 Ga0207678_103113232 150
349 3300026067 Ga0207678_10758873 Ga0207678_107588731 150
350 3300026078 Ga0207702_10000642 Ga0207702_1000064212 150
351 3300026089 Ga0207648_10040752 Ga0207648_100407522 150
352 3300026089 Ga0207648_10404454 Ga0207648_104044542 150
353 3300026095 Ga0207676_10007867 Ga0207676_100078674 150
354 3300026116 Ga0207674_10087556 Ga0207674_100875563 150
355 3300026116 Ga0207674_10307914 Ga0207674_103079142 150
356 3300026116 Ga0207674_10394029 Ga0207674_103940292 150
357 3300026116 Ga0207674_10400558 Ga0207674_104005582 150
358 3300026142 Ga0207698_10105894 Ga0207698_101058942 150
359 3300026142 Ga0207698_10749307 Ga0207698_107493071 150
360 3300026142 Ga0207698_10999615 Ga0207698_109996152 150
361 3300026142 Ga0207698_11011503 Ga0207698_110115032 150
362 3300028379 Ga0268266_10000002 Ga0268266_100000022553 150
363 3300028786 Ga0307517_10035306 Ga0307517_100353062 150
364 3300028800 Ga0265338_11035185 Ga0265338_110351851 150
365 3300030745 Ga0316182_1308535 Ga0316182_13085351 150
366 3300031251 Ga0265327_10123173 Ga0265327_101231732 150
367 3300031456 Ga0307513_10235409 Ga0307513_102354092 150
368 3300031456 Ga0307513_10371019 Ga0307513_103710191 150
369 3300031456 Ga0307513_10480595 Ga0307513_104805952 150
370 3300031507 Ga0307509_10623807 Ga0307509_106238071 150
371 3300031548 Ga0307408_100076682 Ga0307408_1000766822 150
372 3300031711 Ga0265314_10008944 Ga0265314_100089443 150
373 3300031727 Ga0316576_10681855 Ga0316576_106818551 150
374 3300031730 Ga0307516_10536883 Ga0307516_105368831 150
375 3300031731 Ga0307405_10316380 Ga0307405_103163801 150
376 3300031731 Ga0307405_10759391 Ga0307405_107593911 150
377 3300031731 Ga0307405_10798462 Ga0307405_107984622 150
378 3300031824 Ga0307413_10186022 Ga0307413_101860222 150
379 3300031824 Ga0307413_10599412 Ga0307413_105994121 150
380 3300031852 Ga0307410_10346822 Ga0307410_103468222 150
381 3300031852 Ga0307410_10991444 Ga0307410_109914441 150
382 3300031911 Ga0307412_10023153 Ga0307412_100231532 150
383 3300031911 Ga0307412_10076349 Ga0307412_100763492 150
384 3300031911 Ga0307412_10513923 Ga0307412_105139232 150
385 3300032002 Ga0307416_100311290 Ga0307416_1003112902 150
386 3300032002 Ga0307416_100661116 Ga0307416_1006611162 150
387 3300032004 Ga0307414_11019294 Ga0307414_110192941 150
388 3300032005 Ga0307411_10540412 Ga0307411_105404122 150
389 3300032126 Ga0307415_100167809 Ga0307415_1001678092 150
390 3300032126 Ga0307415_100238801 Ga0307415_1002388012 150
391 3300032126 Ga0307415_101740959 Ga0307415_1017409591 150
392 3300033180 Ga0307510_10195604 Ga0307510_101956042 150
393 3300035692 Ga0373935_0770095 Ga0373935_0770095_241_693 150
394 3300037068 Ga0373925_0096599 Ga0373925_0096599_58_519 150
395 3300037312 Ga0395899_0316674 Ga0395899_0316674_551_1003 150
396 3300037471 Ga0395905_0081929 Ga0395905_0081929_2451_2903 150
397 3300037471 Ga0395905_0082380 Ga0395905_0082380_2503_2955 150
398 3300037471 Ga0395905_0271644 Ga0395905_0271644_429_881 150
399 3300037471 Ga0395905_0365844 Ga0395905_0365844_652_1107 150
400 3300038443 Ga0395901_0078158 Ga0395901_0078158_2075_2527 150
401 3300038443 Ga0395901_0133979 Ga0395901_0133979_2115_2567 150
402 3300038443 Ga0395901_1404846 Ga0395901_1404846_91_543 150
403 3300039062 Ga0400483_118183 Ga0400483_118183_701_1165 150
404 3300039437 Ga0436365_0451774 Ga0436365_0451774_384_845 150
405 3300039437 Ga0436365_1683674 Ga0436365_1683674_548_1000 150
406 3300039450 Ga0436363_1555732 Ga0436363_1555732_61_513 150
407 3300039453 Ga0436362_1224760 Ga0436362_1224760_492_944 150
408 3300041451 Ga0451791_0405096 Ga0451791_0405096_81_542 150
409 3300041452 Ga0451793_0536722 Ga0451793_0536722_242_703 150
410 3300041453 Ga0451797_0626230 Ga0451797_0626230_37_498 150
411 3300041501 Ga0451845_0355435 Ga0451845_0355435_108_560 150
412 3300041511 Ga0451855_0355703 Ga0451855_0355703_166_618 150
413 3300041512 Ga0451853_1144479 Ga0451853_1144479_14_466 150
414 3300042005 Ga0439448_0076338 Ga0439448_0076338_617_1069 150
415 3300046453 Ga0495627_001497 Ga0495627_001497_9214_9666 150
416 3300046460 Ga0495638_0007575 Ga0495638_0007575_5489_5941 150
417 3300046471 Ga0495650_0000340 Ga0495650_0000340_22534_22986 150
418 3300046500 Ga0495596_0052404 Ga0495596_0052404_1114_1566 150
419 3300046506 Ga0495583_0019131 Ga0495583_0019131_2592_3044 150
420 3300046506 Ga0495583_0019651 Ga0495583_0019651_2966_3418 150
421 3300046506 Ga0495583_0034397 Ga0495583_0034397_1844_2296 150
422 3300046506 Ga0495583_0148538 Ga0495583_0148538_132_584 150
423 3300046507 Ga0495606_0000824 Ga0495606_0000824_7239_7691 150
424 3300046518 Ga0495631_0208054 Ga0495631_0208054_109_561 150
425 3300046519 Ga0495632_0083915 Ga0495632_0083915_792_1244 150
426 3300046520 Ga0495637_0014507 Ga0495637_0014507_728_1180 150
427 3300046522 Ga0495643_0008432 Ga0495643_0008432_2221_2673 150
428 3300046522 Ga0495643_0012592 Ga0495643_0012592_3282_3734 150
429 3300046522 Ga0495643_0013731 Ga0495643_0013731_3539_3991 150
430 3300046522 Ga0495643_0051552 Ga0495643_0051552_1303_1755 150
431 3300046522 Ga0495643_0382958 Ga0495643_0382958_35_487 150
432 3300046522 Ga0495643_0384346 Ga0495643_0384346_70_522 150
433 3300046522 Ga0495643_0434514 Ga0495643_0434514_42_494 150
434 3300046524 Ga0495648_0000303 Ga0495648_0000303_48458_48919 150
435 3300046525 Ga0495663_0014875 Ga0495663_0014875_42_494 150
436 3300046526 Ga0495666_0144415 Ga0495666_0144415_64_516 150
437 3300046528 Ga0495642_0106863 Ga0495642_0106863_374_826 150
438 3300046538 Ga0495609_0014516 Ga0495609_0014516_2589_3041 150
439 3300046557 Ga0495622_0032906 Ga0495622_0032906_929_1381 150
440 3300046558 Ga0495633_0007722 Ga0495633_0007722_153_605 150
441 3300046558 Ga0495633_0103301 Ga0495633_0103301_75_536 150
442 3300046616 Ga0495668_0000007 Ga0495668_0000007_204085_204537 150
443 3300046648 Ga0495611_0150263 Ga0495611_0150263_223_675 150
444 3300046660 Ga0495625_0001479 Ga0495625_0001479_25614_26066 150
445 3300046660 Ga0495625_0009233 Ga0495625_0009233_3598_4050 150
446 3300046660 Ga0495625_0013066 Ga0495625_0013066_2615_3067 150
447 3300046660 Ga0495625_0025766 Ga0495625_0025766_126_578 150
448 3300046660 Ga0495625_0144593 Ga0495625_0144593_627_1088 150
449 3300046660 Ga0495625_0214403 Ga0495625_0214403_364_816 150
450 3300046660 Ga0495625_0284306 Ga0495625_0284306_531_983 150
451 3300046660 Ga0495625_0789239 Ga0495625_0789239_80_532 150
452 3300046665 Ga0495661_0086288 Ga0495661_0086288_1331_1783 150
453 3300046684 Ga0495669_0000507 Ga0495669_0000507_16835_17287 150
454 3300046691 Ga0495670_0049902 Ga0495670_0049902_475_927 150
455 3300046691 Ga0495670_0052447 Ga0495670_0052447_1487_1939 150
456 3300046692 Ga0495671_0080673 Ga0495671_0080673_971_1423 150
457 3300046692 Ga0495671_0424616 Ga0495671_0424616_168_620 150
458 3300046809 Ga0495600_0013303 Ga0495600_0013303_1947_2399 150
459 3300046810 Ga0495660_0157130 Ga0495660_0157130_166_618 150
460 3300047323 Ga0495683_0030887 Ga0495683_0030887_1710_2162 150
461 3300047323 Ga0495683_0204867 Ga0495683_0204867_304_756 150
462 3300047443 Ga0495687_004439 Ga0495687_004439_3621_4073 150
463 3300047443 Ga0495687_013793 Ga0495687_013793_3540_3992 150
464 3300047445 Ga0495677_0006691 Ga0495677_0006691_3229_3681 150
465 3300047470 Ga0495681_0000011 Ga0495681_0000011_192161_192613 150
466 3300047470 Ga0495681_0150222 Ga0495681_0150222_290_742 150
467 3300047472 Ga0495686_0052596 Ga0495686_0052596_915_1367 150
468 3300048905 Ga0496102_0011729 Ga0496102_0011729_4101_4553 150
469 3300048905 Ga0496102_1609536 Ga0496102_1609536_27_485 150
470 3300048906 Ga0496103_0000836 Ga0496103_0000836_2717_3169 150
471 3300048907 Ga0496104_0033295 Ga0496104_0033295_1377_1829 150
472 3300048908 Ga0496105_0052177 Ga0496105_0052177_2814_3266 150
473 3300048908 Ga0496105_0343701 Ga0496105_0343701_447_899 150
474 3300048910 Ga0496107_0141097 Ga0496107_0141097_626_1078 150
475 3300048913 Ga0496110_0501370 Ga0496110_0501370_640_1092 150
476 3300048914 Ga0496111_0007641 Ga0496111_0007641_905_1357 150
477 3300048916 Ga0496113_1172694 Ga0496113_1172694_20_487 150
478 3300048917 Ga0496114_0137219 Ga0496114_0137219_92_544 150
479 3300048917 Ga0496114_0195286 Ga0496114_0195286_196_648 150
480 3300048918 Ga0496115_0000597 Ga0496115_0000597_1906_2358 150
481 3300048918 Ga0496115_0002445 Ga0496115_0002445_10070_10522 150
482 3300048919 Ga0496116_0017799 Ga0496116_0017799_2966_3418 150
483 3300048920 Ga0496117_0000182 Ga0496117_0000182_61574_62026 150
484 3300048920 Ga0496117_0179801 Ga0496117_0179801_17_469 150
485 3300048921 Ga0496118_0000125 Ga0496118_0000125_66011_66463 150
486 3300048921 Ga0496118_0073182 Ga0496118_0073182_909_1361 150
487 3300048922 Ga0496119_0010214 Ga0496119_0010214_5315_5767 150
488 3300048923 Ga0496120_0033907 Ga0496120_0033907_1055_1507 150
489 3300048924 Ga0496121_0000367 Ga0496121_0000367_89917_90369 150
490 3300048924 Ga0496121_0007290 Ga0496121_0007290_2951_3403 150
491 3300048924 Ga0496121_0034537 Ga0496121_0034537_2082_2534 150
492 3300048924 Ga0496121_0129749 Ga0496121_0129749_80_532 150
493 3300048925 Ga0496122_0023643 Ga0496122_0023643_2200_2664 150
494 3300048925 Ga0496122_0036059 Ga0496122_0036059_2666_3118 150
495 3300048926 Ga0496123_0024694 Ga0496123_0024694_358_819 150
496 3300048926 Ga0496123_0041016 Ga0496123_0041016_1189_1641 150
497 3300048927 Ga0496124_0000082 Ga0496124_0000082_69945_70397 150
498 3300048928 Ga0496125_0002269 Ga0496125_0002269_5233_5694 150
499 3300048929 Ga0496126_0000221 Ga0496126_0000221_57735_58187 150
500 3300048929 Ga0496126_0633262 Ga0496126_0633262_79_531 150
501 3300049459 Ga0495678_226482 Ga0495678_226482_11_463 150
502 3300049573 Ga0501037_0130539 Ga0501037_0130539_1110_1634 150
503 3300049574 Ga0501038_0024065 Ga0501038_0024065_4156_4617 150
504 3300049580 Ga0501046_0356179 Ga0501046_0356179_422_874 150
505 3300049586 Ga0501070_0582583 Ga0501070_0582583_395_847 150
506 3300049823 Ga0501044_0327664 Ga0501044_0327664_914_1366 150
507 3300050489 nmdc:mga03683_7580_c1 nmdc:mga03683_7580_c1_1337_1789 150
508 3300050491 nmdc:mga00v17_302228_c1 nmdc:mga00v17_302228_c1_338_790 150
509 3300050491 nmdc:mga00v17_5943_c1 nmdc:mga00v17_5943_c1_3369_3821 150
510 3300050493 nmdc:mga0k408_53081_c1 nmdc:mga0k408_53081_c1_1374_1826 150
511 3300050496 nmdc:mga07m45_41377_c1 nmdc:mga07m45_41377_c1_447_899 150
512 3300050516 nmdc:mga0sz30_18727_c2 nmdc:mga0sz30_18727_c2_242_694 150
513 3300053079 Ga0500610_0000140 Ga0500610_0000140_14896_15348 150
514 3300053087 Ga0500643_000001 Ga0500643_000001_1332111_1332563 150
515 3300053087 Ga0500643_009771 Ga0500643_009771_2746_3198 150
516 3300053087 Ga0500643_059905 Ga0500643_059905_243_695 150
517 3300053091 Ga0500647_0253708 Ga0500647_0253708_150_602 150
518 3300053093 Ga0500651_0497353 Ga0500651_0497353_75_527 150
519 3300053096 Ga0500641_0040456 Ga0500641_0040456_466_918 150
520 3300053103 Ga0500555_002842 Ga0500555_002842_379_840 150
521 3300053108 Ga0500562_011833 Ga0500562_011833_1061_1513 150
522 3300053108 Ga0500562_070644 Ga0500562_070644_442_894 150
523 3300053119 Ga0500595_010172 Ga0500595_010172_267_719 150
524 3300053130 Ga0500642_0000804 Ga0500642_0000804_5860_6312 150
525 3300053136 Ga0500559_0103072 Ga0500559_0103072_308_760 150
526 3300053136 Ga0500559_0183075 Ga0500559_0183075_290_742 150
527 3300053136 Ga0500559_0322299 Ga0500559_0322299_62_514 150
528 3300053153 Ga0500616_0007018 Ga0500616_0007018_2154_2606 150
529 3300053153 Ga0500616_0081604 Ga0500616_0081604_582_1034 150
530 3300053153 Ga0500616_0133312 Ga0500616_0133312_481_933 150
531 3300053154 Ga0500619_176045 Ga0500619_176045_206_658 150
532 3300053177 Ga0500636_0088068 Ga0500636_0088068_364_816 150
533 3300053730 Ga0500645_000080 Ga0500645_000080_29174_29635 150
534 3300053730 Ga0500645_142269 Ga0500645_142269_116_568 150
535 3300053735 Ga0500596_004831 Ga0500596_004831_272_724 150
536 3300055283 Ga0500661_026348 Ga0500661_026348_491_943 150
537 3300055283 Ga0500661_085737 Ga0500661_085737_45_497 150
538 3300059623 Ga0587101_048128 Ga0587101_048128_181_645 150
539 3300060346 Ga0587111_0089978 Ga0587111_0089978_120_584 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

32

180

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.774 4 150
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7515 4 150
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.5093 2 92
4uer-assembly1.cif.gz_a 40s-eif1-eif1a-eif3-eif3j translation initiation complex from lachancea kluyveri 0.4453 6 109
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.4359 2 92
ID Description Score Start End Superfamily
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9274 1 93 1.10.1510.10
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9174 1 93 1.10.1510.10
af_Q12032_29_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.917 4 93 1.10.1510.10
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9117 94 150 1.10.10.410
af_Q12032_29_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.8977 4 93 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A653J3S8-F1-model_v4 GatB protein 0.9771 1 150 GO:0016884
AF-A0A3D1U4K6-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9377 2 150 GO:0016740
GO:0016884
AF-A0A6J4BTS0-F1-model_v4 Aspartyl-tRNA amidotransferase 0.9307 1 150 GO:0016740
GO:0016884
AF-A0A502FIE2-F1-model_v4 GatB/YqeY domain-containing protein 0.9287 1 150 GO:0016884
AF-A0A7C1DUB5-F1-model_v4 GatB/YqeY domain-containing protein 0.9282 1 150 GO:0016884

Feature Viewer

pLDDT pTM Quality
95.06 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map