F461111
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 539 | 330 | 532 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300005440|Ga0070705_100642419|Ga0070705_1006424191 |
| Length | 181 |
| Sequence | MVERGLGVKVAADGDWDYSAGFPTGMSSMSLRAKINDDLKAAMKAGDKRKVSALRLMNAAIKDKDINSRTDGHDSMLTADAGLIELFAKMVTQRQESLGMYEQGGRPELAQQEREEIEVIQSYMPKQLSEDEAKKAVAAVIAAVGATSVKDMGKVMAELKARYAGQMDMAKAGGIVKGVLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 2 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 3 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 4 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 5 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 6 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 7 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 8 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 147 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 149 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 151 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 154 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 156 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 157 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 168 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 169 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 184 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 198 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 199 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 200 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 266 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 267 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 268 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 269 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 270 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 271 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 272 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 301 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 311 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 312 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 313 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 314 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 315 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 316 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 317 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 318 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 319 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 320 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 322 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 323 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 325 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 326 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 327 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 330 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 0.37 |
| Isolates | 1.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.76 |
| Nodule | 0 |
| Rhizoplane | 5.19 |
| Rhizosphere | 77.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001343 | 3300001915 | Bacteria | 7134 |
| 2 | JGI24741J21665_1016365 | 3300001915 | Bacteria | 1211 |
| 3 | JGI24747J21853_1039958 | 3300001978 | Bacteria | 555 |
| 4 | JGI24740J21852_10044474 | 3300001979 | Bacteria | 1318 |
| 5 | JGI24740J21852_10047532 | 3300001979 | Bacteria | 1252 |
| 6 | JGI24740J21852_10052507 | 3300001979 | Bacteria | 1160 |
| 7 | JGI24737J22298_10029642 | 3300001990 | Bacteria | 1715 |
| 8 | JGI24737J22298_10181254 | 3300001990 | Bacteria | 622 |
| 9 | JGI25153J46596_10000006 | 3300003215 | Bacteria | 447760 |
| 10 | Ga0055525_1000051 | 3300003759 | Bacteria | 240942 |
| 11 | Ga0055542_1000020 | 3300003762 | Bacteria | 335745 |
| 12 | Ga0055529_1000016 | 3300003763 | Bacteria | 364775 |
| 13 | Ga0055530_10000978 | 3300003791 | Bacteria | 23058 |
| 14 | Ga0055531_10001645 | 3300003794 | Bacteria | 16155 |
| 15 | Ga0065165_1039706 | 3300005262 | Bacteria | 1408 |
| 16 | Ga0065704_10070209 | 3300005289 | Bacteria | 78459 |
| 17 | Ga0065704_10288184 | 3300005289 | Bacteria | 899 |
| 18 | Ga0070658_10001558 | 3300005327 | Bacteria | 19439 |
| 19 | Ga0070658_10514482 | 3300005327 | Bacteria | 1035 |
| 20 | Ga0070676_10537856 | 3300005328 | Bacteria | 835 |
| 21 | Ga0070676_11024555 | 3300005328 | Bacteria | 621 |
| 22 | Ga0070683_100105670 | 3300005329 | Bacteria | 2654 |
| 23 | Ga0070683_100361830 | 3300005329 | Bacteria | 1382 |
| 24 | Ga0070690_100452281 | 3300005330 | Bacteria | 952 |
| 25 | Ga0070680_100025291 | 3300005336 | Bacteria | 4744 |
| 26 | Ga0070680_100105728 | 3300005336 | Bacteria | 2340 |
| 27 | Ga0070680_101088607 | 3300005336 | Bacteria | 691 |
| 28 | Ga0070660_100616784 | 3300005339 | Bacteria | 908 |
| 29 | Ga0070691_10143677 | 3300005341 | Bacteria | 1218 |
| 30 | Ga0070661_100001207 | 3300005344 | Bacteria | 18191 |
| 31 | Ga0070661_100227527 | 3300005344 | Bacteria | 1432 |
| 32 | Ga0070661_100241612 | 3300005344 | Bacteria | 1391 |
| 33 | Ga0070661_100514733 | 3300005344 | Bacteria | 959 |
| 34 | Ga0070661_100624656 | 3300005344 | Bacteria | 873 |
| 35 | Ga0070668_100437766 | 3300005347 | Bacteria | 1122 |
| 36 | Ga0070668_100750172 | 3300005347 | Bacteria | 864 |
| 37 | Ga0070668_101477547 | 3300005347 | Bacteria | 621 |
| 38 | Ga0070669_101168684 | 3300005353 | Unclassified | 664 |
| 39 | Ga0070675_100083570 | 3300005354 | Bacteria | 2665 |
| 40 | Ga0070671_100167790 | 3300005355 | Bacteria | 1856 |
| 41 | Ga0070674_100003705 | 3300005356 | Bacteria | 8611 |
| 42 | Ga0070673_100105514 | 3300005364 | Bacteria | 2328 |
| 43 | Ga0070688_100268431 | 3300005365 | Bacteria | 1221 |
| 44 | Ga0070659_100010912 | 3300005366 | Bacteria | 6704 |
| 45 | Ga0070659_100037913 | 3300005366 | Bacteria | 3758 |
| 46 | Ga0070659_100135769 | 3300005366 | Bacteria | 2000 |
| 47 | Ga0070659_100852005 | 3300005366 | Bacteria | 794 |
| 48 | Ga0070701_10847703 | 3300005438 | Bacteria | 627 |
| 49 | Ga0070705_100642419 | 3300005440 | Bacteria | 826 |
| 50 | Ga0070694_101797019 | 3300005444 | Bacteria | 522 |
| 51 | Ga0070663_100015002 | 3300005455 | Bacteria | 4985 |
| 52 | Ga0070663_100131892 | 3300005455 | Bacteria | 1898 |
| 53 | Ga0070663_100529178 | 3300005455 | Bacteria | 982 |
| 54 | Ga0070678_100002746 | 3300005456 | Bacteria | 9719 |
| 55 | Ga0070678_100355077 | 3300005456 | Bacteria | 1261 |
| 56 | Ga0070662_100079444 | 3300005457 | Bacteria | 2439 |
| 57 | Ga0070662_100102735 | 3300005457 | Bacteria | 2166 |
| 58 | Ga0070662_100179222 | 3300005457 | Bacteria | 1669 |
| 59 | Ga0070681_10051662 | 3300005458 | Bacteria | 4100 |
| 60 | Ga0070681_10508080 | 3300005458 | Bacteria | 1118 |
| 61 | Ga0070681_10830435 | 3300005458 | Bacteria | 841 |
| 62 | Ga0068867_100164780 | 3300005459 | Bacteria | 1751 |
| 63 | Ga0070679_100116995 | 3300005530 | Bacteria | 2650 |
| 64 | Ga0070679_100311193 | 3300005530 | Bacteria | 1525 |
| 65 | Ga0070684_100245445 | 3300005535 | Bacteria | 1636 |
| 66 | Ga0068853_100277896 | 3300005539 | Bacteria | 1543 |
| 67 | Ga0068853_101154062 | 3300005539 | Bacteria | 747 |
| 68 | Ga0070695_100107393 | 3300005545 | Bacteria | 1889 |
| 69 | Ga0070695_101871363 | 3300005545 | Bacteria | 504 |
| 70 | Ga0070693_100160888 | 3300005547 | Bacteria | 1430 |
| 71 | Ga0070665_100000086 | 3300005548 | Bacteria | 178229 |
| 72 | Ga0068855_100014403 | 3300005563 | Bacteria | 9520 |
| 73 | Ga0068855_100056391 | 3300005563 | Bacteria | 4610 |
| 74 | Ga0068855_100153248 | 3300005563 | Bacteria | 2619 |
| 75 | Ga0068855_102113559 | 3300005563 | Bacteria | 567 |
| 76 | Ga0070664_100127003 | 3300005564 | Bacteria | 2238 |
| 77 | Ga0070664_101227536 | 3300005564 | Bacteria | 707 |
| 78 | Ga0068857_100113850 | 3300005577 | Bacteria | 2432 |
| 79 | Ga0068857_100262150 | 3300005577 | Bacteria | 1586 |
| 80 | Ga0068857_100330325 | 3300005577 | Bacteria | 1409 |
| 81 | Ga0068857_100516176 | 3300005577 | Bacteria | 1123 |
| 82 | Ga0068857_100703105 | 3300005577 | Bacteria | 960 |
| 83 | Ga0068857_101457618 | 3300005577 | Bacteria | 666 |
| 84 | Ga0068854_100007023 | 3300005578 | Bacteria | 7184 |
| 85 | Ga0068854_100263108 | 3300005578 | Bacteria | 1382 |
| 86 | Ga0068854_100762176 | 3300005578 | Bacteria | 840 |
| 87 | Ga0068854_100912930 | 3300005578 | Bacteria | 772 |
| 88 | Ga0068856_100039275 | 3300005614 | Bacteria | 4646 |
| 89 | Ga0068856_100044943 | 3300005614 | Bacteria | 4347 |
| 90 | Ga0068852_100294333 | 3300005616 | Bacteria | 1569 |
| 91 | Ga0068852_100414429 | 3300005616 | Bacteria | 1328 |
| 92 | Ga0068852_100956688 | 3300005616 | Bacteria | 874 |
| 93 | Ga0068852_101261386 | 3300005616 | Bacteria | 760 |
| 94 | Ga0068864_100004572 | 3300005618 | Bacteria | 11360 |
| 95 | Ga0068866_11080001 | 3300005718 | Bacteria | 574 |
| 96 | Ga0068858_100003942 | 3300005842 | Bacteria | 14653 |
| 97 | Ga0068858_100004671 | 3300005842 | Bacteria | 13425 |
| 98 | Ga0081540_1058576 | 3300005983 | Bacteria | 1854 |
| 99 | Ga0075364_10000558 | 3300006051 | Bacteria | 19112 |
| 100 | Ga0075364_10144158 | 3300006051 | Bacteria | 1603 |
| 101 | Ga0075362_10033788 | 3300006177 | Bacteria | 2226 |
| 102 | Ga0075369_10168819 | 3300006186 | Bacteria | 1004 |
| 103 | Ga0075369_10355187 | 3300006186 | Bacteria | 688 |
| 104 | Ga0075366_10440412 | 3300006195 | Bacteria | 804 |
| 105 | Ga0075370_10064180 | 3300006353 | Bacteria | 2094 |
| 106 | Ga0068871_100120143 | 3300006358 | Bacteria | 2219 |
| 107 | Ga0075428_100157408 | 3300006844 | Bacteria | 2467 |
| 108 | Ga0075436_100887794 | 3300006914 | Bacteria | 666 |
| 109 | Ga0105240_10877559 | 3300009093 | Bacteria | 966 |
| 110 | Ga0111539_10043887 | 3300009094 | Bacteria | 5358 |
| 111 | Ga0105245_10001264 | 3300009098 | Bacteria | 22840 |
| 112 | Ga0114129_10097405 | 3300009147 | Bacteria | 4073 |
| 113 | Ga0105243_10000876 | 3300009148 | Bacteria | 28409 |
| 114 | Ga0105243_10090243 | 3300009148 | Bacteria | 2521 |
| 115 | Ga0105243_10378055 | 3300009148 | Bacteria | 1309 |
| 116 | Ga0105241_10005567 | 3300009174 | Bacteria | 9302 |
| 117 | Ga0105241_11039065 | 3300009174 | Bacteria | 768 |
| 118 | Ga0105242_10315579 | 3300009176 | Bacteria | 1432 |
| 119 | Ga0105242_12462550 | 3300009176 | Bacteria | 568 |
| 120 | Ga0105248_10032166 | 3300009177 | Bacteria | 5863 |
| 121 | Ga0105237_10572783 | 3300009545 | Bacteria | 1136 |
| 122 | Ga0105237_11171168 | 3300009545 | Bacteria | 775 |
| 123 | Ga0105237_11393989 | 3300009545 | Bacteria | 707 |
| 124 | Ga0105238_10078871 | 3300009551 | Bacteria | 3283 |
| 125 | Ga0105238_10759244 | 3300009551 | Bacteria | 984 |
| 126 | Ga0105249_10129555 | 3300009553 | Bacteria | 2407 |
| 127 | Ga0105249_10186603 | 3300009553 | Bacteria | 2021 |
| 128 | Ga0105249_10254844 | 3300009553 | Bacteria | 1741 |
| 129 | Ga0105239_10281371 | 3300010375 | Bacteria | 1873 |
| 130 | Ga0105239_10552011 | 3300010375 | Bacteria | 1312 |
| 131 | Ga0105239_10580702 | 3300010375 | Bacteria | 1278 |
| 132 | Ga0105239_11409832 | 3300010375 | Bacteria | 804 |
| 133 | Ga0105239_11573566 | 3300010375 | Bacteria | 760 |
| 134 | Ga0105239_12362118 | 3300010375 | Bacteria | 619 |
| 135 | Ga0105246_10087502 | 3300011119 | Bacteria | 2236 |
| 136 | Ga0105246_11019284 | 3300011119 | Bacteria | 751 |
| 137 | Ga0105246_11432129 | 3300011119 | Bacteria | 646 |
| 138 | Ga0157326_1005102 | 3300012513 | Bacteria | 1383 |
| 139 | Ga0157373_10039441 | 3300013100 | Bacteria | 3381 |
| 140 | Ga0157373_10139492 | 3300013100 | Bacteria | 1705 |
| 141 | Ga0157373_10429590 | 3300013100 | Bacteria | 949 |
| 142 | Ga0157371_10000030 | 3300013102 | Bacteria | 241585 |
| 143 | Ga0157371_10002409 | 3300013102 | Bacteria | 17899 |
| 144 | Ga0157370_10019186 | 3300013104 | Bacteria | 6873 |
| 145 | Ga0157370_10229647 | 3300013104 | Bacteria | 1718 |
| 146 | Ga0157369_11226738 | 3300013105 | Bacteria | 765 |
| 147 | Ga0157374_10452704 | 3300013296 | Bacteria | 1285 |
| 148 | Ga0157374_11915949 | 3300013296 | Bacteria | 619 |
| 149 | Ga0157378_10097664 | 3300013297 | Bacteria | 2677 |
| 150 | Ga0163162_10007973 | 3300013306 | Bacteria | 10326 |
| 151 | Ga0163162_11932419 | 3300013306 | Bacteria | 676 |
| 152 | Ga0157372_10559031 | 3300013307 | Bacteria | 1334 |
| 153 | Ga0157372_10583815 | 3300013307 | Bacteria | 1302 |
| 154 | Ga0157372_10893478 | 3300013307 | Bacteria | 1031 |
| 155 | Ga0157372_11171676 | 3300013307 | Bacteria | 888 |
| 156 | Ga0157372_11475709 | 3300013307 | Bacteria | 783 |
| 157 | Ga0157375_10594570 | 3300013308 | Bacteria | 1266 |
| 158 | Ga0182008_10983098 | 3300014497 | Bacteria | 502 |
| 159 | Ga0157376_10133664 | 3300014969 | Bacteria | 2217 |
| 160 | Ga0157376_11117040 | 3300014969 | Bacteria | 814 |
| 161 | Ga0163161_10040465 | 3300017792 | Bacteria | 3348 |
| 162 | Ga0213876_10111727 | 3300021384 | Bacteria | 1450 |
| 163 | Ga0209563_100019 | 3300025230 | Bacteria | 697828 |
| 164 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 165 | Ga0209233_1000154 | 3300025261 | Bacteria | 169616 |
| 166 | Ga0209233_1006001 | 3300025261 | Bacteria | 3962 |
| 167 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 168 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 169 | Ga0209050_1000026 | 3300025298 | Bacteria | 499134 |
| 170 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 171 | Ga0207697_10051021 | 3300025315 | Bacteria | 1709 |
| 172 | Ga0207688_10098205 | 3300025901 | Bacteria | 1688 |
| 173 | Ga0207647_10028951 | 3300025904 | Bacteria | 3591 |
| 174 | Ga0207685_10367945 | 3300025905 | Bacteria | 729 |
| 175 | Ga0207699_10101340 | 3300025906 | Bacteria | 1828 |
| 176 | Ga0207645_10063405 | 3300025907 | Bacteria | 2361 |
| 177 | Ga0207645_10226838 | 3300025907 | Bacteria | 1232 |
| 178 | Ga0207705_10000531 | 3300025909 | Bacteria | 32288 |
| 179 | Ga0207654_10000190 | 3300025911 | Bacteria | 37976 |
| 180 | Ga0207707_10025034 | 3300025912 | Bacteria | 5222 |
| 181 | Ga0207707_10052670 | 3300025912 | Bacteria | 3542 |
| 182 | Ga0207695_10042726 | 3300025913 | Bacteria | 4837 |
| 183 | Ga0207695_10271977 | 3300025913 | Bacteria | 1590 |
| 184 | Ga0207671_10003175 | 3300025914 | Bacteria | 16591 |
| 185 | Ga0207671_10966219 | 3300025914 | Bacteria | 672 |
| 186 | Ga0207657_10071975 | 3300025919 | Bacteria | 2926 |
| 187 | Ga0207657_10264374 | 3300025919 | Bacteria | 1368 |
| 188 | Ga0207657_10427421 | 3300025919 | Bacteria | 1041 |
| 189 | Ga0207649_10011496 | 3300025920 | Bacteria | 4882 |
| 190 | Ga0207649_10199092 | 3300025920 | Bacteria | 1414 |
| 191 | Ga0207649_10395839 | 3300025920 | Bacteria | 1033 |
| 192 | Ga0207649_10453742 | 3300025920 | Bacteria | 968 |
| 193 | Ga0207652_10048264 | 3300025921 | Bacteria | 3639 |
| 194 | Ga0207694_10081519 | 3300025924 | Bacteria | 2542 |
| 195 | Ga0207694_10094568 | 3300025924 | Bacteria | 2361 |
| 196 | Ga0207694_10097248 | 3300025924 | Bacteria | 2329 |
| 197 | Ga0207694_10466872 | 3300025924 | Bacteria | 1055 |
| 198 | Ga0207694_10704448 | 3300025924 | Bacteria | 852 |
| 199 | Ga0207659_10013104 | 3300025926 | Bacteria | 5301 |
| 200 | Ga0207687_10003410 | 3300025927 | Bacteria | 10718 |
| 201 | Ga0207690_10001685 | 3300025932 | Bacteria | 13618 |
| 202 | Ga0207690_10285531 | 3300025932 | Bacteria | 1286 |
| 203 | Ga0207706_10001012 | 3300025933 | Bacteria | 28668 |
| 204 | Ga0207706_10052514 | 3300025933 | Bacteria | 3599 |
| 205 | Ga0207686_10730249 | 3300025934 | Bacteria | 789 |
| 206 | Ga0207709_10000031 | 3300025935 | Bacteria | 329046 |
| 207 | Ga0207709_10220463 | 3300025935 | Bacteria | 1368 |
| 208 | Ga0207669_10000077 | 3300025937 | Bacteria | 49918 |
| 209 | Ga0207669_10029565 | 3300025937 | Bacteria | 3032 |
| 210 | Ga0207711_10017656 | 3300025941 | Bacteria | 5926 |
| 211 | Ga0207689_10191169 | 3300025942 | Bacteria | 1689 |
| 212 | Ga0207689_11728374 | 3300025942 | Bacteria | 518 |
| 213 | Ga0207661_10239584 | 3300025944 | Bacteria | 1609 |
| 214 | Ga0207661_10318223 | 3300025944 | Bacteria | 1398 |
| 215 | Ga0207679_10180840 | 3300025945 | Bacteria | 1744 |
| 216 | Ga0207667_10000004 | 3300025949 | Bacteria | 737718 |
| 217 | Ga0207667_10121091 | 3300025949 | Bacteria | 2696 |
| 218 | Ga0207651_10030156 | 3300025960 | Bacteria | 3449 |
| 219 | Ga0207712_10079964 | 3300025961 | Bacteria | 2376 |
| 220 | Ga0207668_10221701 | 3300025972 | Bacteria | 1519 |
| 221 | Ga0207640_10029437 | 3300025981 | Bacteria | 3371 |
| 222 | Ga0207640_10416612 | 3300025981 | Bacteria | 1098 |
| 223 | Ga0207658_10071753 | 3300025986 | Bacteria | 2623 |
| 224 | Ga0207677_11010558 | 3300026023 | Bacteria | 754 |
| 225 | Ga0207677_11201815 | 3300026023 | Bacteria | 694 |
| 226 | Ga0207703_10001326 | 3300026035 | Bacteria | 22701 |
| 227 | Ga0207703_10002565 | 3300026035 | Bacteria | 15695 |
| 228 | Ga0207703_11384412 | 3300026035 | Bacteria | 677 |
| 229 | Ga0207639_10037912 | 3300026041 | Bacteria | 3583 |
| 230 | Ga0207639_10097153 | 3300026041 | Bacteria | 2371 |
| 231 | Ga0207678_10171549 | 3300026067 | Bacteria | 1852 |
| 232 | Ga0207678_10311323 | 3300026067 | Bacteria | 1354 |
| 233 | Ga0207678_10758873 | 3300026067 | Bacteria | 855 |
| 234 | Ga0207702_10000642 | 3300026078 | Bacteria | 38293 |
| 235 | Ga0207648_10040752 | 3300026089 | Bacteria | 4080 |
| 236 | Ga0207648_10404454 | 3300026089 | Bacteria | 1237 |
| 237 | Ga0207676_10007867 | 3300026095 | Bacteria | 7580 |
| 238 | Ga0207674_10087556 | 3300026116 | Bacteria | 3108 |
| 239 | Ga0207674_10307914 | 3300026116 | Bacteria | 1533 |
| 240 | Ga0207674_10394029 | 3300026116 | Bacteria | 1338 |
| 241 | Ga0207674_10400558 | 3300026116 | Bacteria | 1326 |
| 242 | Ga0207698_10105894 | 3300026142 | Bacteria | 2344 |
| 243 | Ga0207698_10749307 | 3300026142 | Bacteria | 975 |
| 244 | Ga0207698_10999615 | 3300026142 | Bacteria | 847 |
| 245 | Ga0207698_11011503 | 3300026142 | Bacteria | 842 |
| 246 | Ga0210002_1032920 | 3300027617 | Bacteria | 866 |
| 247 | Ga0209971_1154517 | 3300027682 | Bacteria | 566 |
| 248 | Ga0209998_10011875 | 3300027717 | Bacteria | 1808 |
| 249 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 250 | Ga0307517_10035306 | 3300028786 | Bacteria | 5665 |
| 251 | Ga0265338_11035185 | 3300028800 | Bacteria | 555 |
| 252 | Ga0316182_1308535 | 3300030745 | Bacteria | 568 |
| 253 | Ga0265327_10123173 | 3300031251 | Bacteria | 1226 |
| 254 | Ga0307513_10235409 | 3300031456 | Bacteria | 1641 |
| 255 | Ga0307513_10371019 | 3300031456 | Bacteria | 1173 |
| 256 | Ga0307513_10480595 | 3300031456 | Bacteria | 962 |
| 257 | Ga0307509_10623807 | 3300031507 | Bacteria | 749 |
| 258 | Ga0307408_100076682 | 3300031548 | Bacteria | 2487 |
| 259 | Ga0316579_10006704 | 3300031691 | Bacteria | 4713 |
| 260 | Ga0316579_10417458 | 3300031691 | Bacteria | 649 |
| 261 | Ga0265314_10008944 | 3300031711 | Bacteria | 8529 |
| 262 | Ga0316576_10435361 | 3300031727 | Bacteria | 969 |
| 263 | Ga0316576_10650699 | 3300031727 | Bacteria | 766 |
| 264 | Ga0316576_10681855 | 3300031727 | Bacteria | 746 |
| 265 | Ga0316578_10023162 | 3300031728 | Bacteria | 3473 |
| 266 | Ga0316578_10188511 | 3300031728 | Bacteria | 1242 |
| 267 | Ga0307516_10536883 | 3300031730 | Bacteria | 823 |
| 268 | Ga0307405_10316380 | 3300031731 | Bacteria | 1190 |
| 269 | Ga0307405_10759391 | 3300031731 | Bacteria | 809 |
| 270 | Ga0307405_10798462 | 3300031731 | Bacteria | 790 |
| 271 | Ga0316577_10179788 | 3300031733 | Bacteria | 1194 |
| 272 | Ga0307413_10186022 | 3300031824 | Bacteria | 1486 |
| 273 | Ga0307413_10599412 | 3300031824 | Bacteria | 901 |
| 274 | Ga0307410_10346822 | 3300031852 | Bacteria | 1185 |
| 275 | Ga0307410_10991444 | 3300031852 | Bacteria | 724 |
| 276 | Ga0307412_10023153 | 3300031911 | Bacteria | 3818 |
| 277 | Ga0307412_10076349 | 3300031911 | Bacteria | 2301 |
| 278 | Ga0307412_10513923 | 3300031911 | Bacteria | 999 |
| 279 | Ga0307416_100311290 | 3300032002 | Bacteria | 1571 |
| 280 | Ga0307416_100661116 | 3300032002 | Bacteria | 1131 |
| 281 | Ga0307414_11019294 | 3300032004 | Bacteria | 762 |
| 282 | Ga0307411_10540412 | 3300032005 | Bacteria | 992 |
| 283 | Ga0307415_100167809 | 3300032126 | Bacteria | 1709 |
| 284 | Ga0307415_100238801 | 3300032126 | Bacteria | 1468 |
| 285 | Ga0307415_101740959 | 3300032126 | Bacteria | 602 |
| 286 | Ga0316583_10018558 | 3300032133 | Bacteria | 2497 |
| 287 | Ga0316585_10272369 | 3300032137 | Bacteria | 561 |
| 288 | Ga0316580_10030556 | 3300032139 | Bacteria | 1668 |
| 289 | Ga0307510_10195604 | 3300033180 | Bacteria | 1564 |
| 290 | Ga0373926_0028754 | 3300035083 | Bacteria | 1952 |
| 291 | Ga0373932_0122345 | 3300035112 | Bacteria | 869 |
| 292 | Ga0373943_0049186 | 3300035170 | Bacteria | 2068 |
| 293 | Ga0373946_0184367 | 3300035171 | Bacteria | 992 |
| 294 | Ga0373961_0164171 | 3300035241 | Bacteria | 765 |
| 295 | Ga0316574_0701526 | 3300035398 | Bacteria | 620 |
| 296 | Ga0373924_0514666 | 3300035410 | Bacteria | 538 |
| 297 | Ga0373931_0017764 | 3300035691 | Bacteria | 3524 |
| 298 | Ga0373935_0227642 | 3300035692 | Bacteria | 1297 |
| 299 | Ga0373935_0770095 | 3300035692 | Bacteria | 710 |
| 300 | Ga0373927_0012254 | 3300035695 | Bacteria | 5705 |
| 301 | Ga0373933_0306367 | 3300035724 | Bacteria | 1029 |
| 302 | Ga0373947_0013628 | 3300035725 | Bacteria | 4656 |
| 303 | Ga0316582_0858058 | 3300036647 | Bacteria | 621 |
| 304 | Ga0316584_0036331 | 3300036712 | Bacteria | 3655 |
| 305 | Ga0373925_0054302 | 3300037068 | Bacteria | 2996 |
| 306 | Ga0373925_0096599 | 3300037068 | Unclassified | 2265 |
| 307 | Ga0395899_0316674 | 3300037312 | Bacteria | 1052 |
| 308 | Ga0395905_0081929 | 3300037471 | Bacteria | 3024 |
| 309 | Ga0395905_0082380 | 3300037471 | Bacteria | 3015 |
| 310 | Ga0395905_0271644 | 3300037471 | Bacteria | 1581 |
| 311 | Ga0395905_0365844 | 3300037471 | Bacteria | 1335 |
| 312 | Ga0316581_0053247 | 3300037588 | Bacteria | 1240 |
| 313 | Ga0395901_0078158 | 3300038443 | Bacteria | 3455 |
| 314 | Ga0395901_0133979 | 3300038443 | Bacteria | 2604 |
| 315 | Ga0395901_1404846 | 3300038443 | Bacteria | 656 |
| 316 | Ga0400483_118183 | 3300039062 | Bacteria | 7064 |
| 317 | Ga0436365_0451774 | 3300039437 | Bacteria | 987 |
| 318 | Ga0436365_1683674 | 3300039437 | Bacteria | 1837 |
| 319 | Ga0436363_1555732 | 3300039450 | Bacteria | 776 |
| 320 | Ga0436362_1224760 | 3300039453 | Bacteria | 1040 |
| 321 | Ga0451791_0405096 | 3300041451 | Bacteria | 1034 |
| 322 | Ga0451793_0536722 | 3300041452 | Bacteria | 739 |
| 323 | Ga0451797_0626230 | 3300041453 | Bacteria | 856 |
| 324 | Ga0451845_0355435 | 3300041501 | Bacteria | 677 |
| 325 | Ga0451855_0355703 | 3300041511 | Bacteria | 669 |
| 326 | Ga0451853_1144479 | 3300041512 | Bacteria | 674 |
| 327 | Ga0439448_0076338 | 3300042005 | Bacteria | 1121 |
| 328 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 329 | Ga0495627_001497 | 3300046453 | Bacteria | 13504 |
| 330 | Ga0495603_0002724 | 3300046455 | Bacteria | 10418 |
| 331 | Ga0495629_0000907 | 3300046459 | Bacteria | 23785 |
| 332 | Ga0495638_0007575 | 3300046460 | Bacteria | 7766 |
| 333 | Ga0495650_0000340 | 3300046471 | Bacteria | 83278 |
| 334 | Ga0495580_0013222 | 3300046472 | Bacteria | 6309 |
| 335 | Ga0495582_0018038 | 3300046473 | Bacteria | 3859 |
| 336 | Ga0495639_0004636 | 3300046475 | Bacteria | 5901 |
| 337 | Ga0495584_0015856 | 3300046491 | Bacteria | 3844 |
| 338 | Ga0495584_0630224 | 3300046491 | Bacteria | 547 |
| 339 | Ga0495594_0001129 | 3300046499 | Bacteria | 13930 |
| 340 | Ga0495596_0052404 | 3300046500 | Bacteria | 1597 |
| 341 | Ga0495583_0019131 | 3300046506 | Bacteria | 3583 |
| 342 | Ga0495583_0019651 | 3300046506 | Bacteria | 3520 |
| 343 | Ga0495583_0034397 | 3300046506 | Bacteria | 2427 |
| 344 | Ga0495583_0148538 | 3300046506 | Bacteria | 972 |
| 345 | Ga0495606_0000824 | 3300046507 | Bacteria | 47072 |
| 346 | Ga0495630_0211328 | 3300046517 | Bacteria | 1481 |
| 347 | Ga0495631_0208054 | 3300046518 | Bacteria | 836 |
| 348 | Ga0495632_0083915 | 3300046519 | Bacteria | 1517 |
| 349 | Ga0495637_0014507 | 3300046520 | Bacteria | 3718 |
| 350 | Ga0495643_0008432 | 3300046522 | Bacteria | 6522 |
| 351 | Ga0495643_0012592 | 3300046522 | Bacteria | 5096 |
| 352 | Ga0495643_0013731 | 3300046522 | Bacteria | 4837 |
| 353 | Ga0495643_0051552 | 3300046522 | Bacteria | 2213 |
| 354 | Ga0495643_0382958 | 3300046522 | Bacteria | 623 |
| 355 | Ga0495643_0384346 | 3300046522 | Bacteria | 622 |
| 356 | Ga0495643_0434514 | 3300046522 | Bacteria | 574 |
| 357 | Ga0495644_0073745 | 3300046523 | Bacteria | 1284 |
| 358 | Ga0495648_0000303 | 3300046524 | Bacteria | 54717 |
| 359 | Ga0495663_0014875 | 3300046525 | Bacteria | 2186 |
| 360 | Ga0495666_0144415 | 3300046526 | Bacteria | 1108 |
| 361 | Ga0495642_0106863 | 3300046528 | Bacteria | 1194 |
| 362 | Ga0495609_0014516 | 3300046538 | Bacteria | 3701 |
| 363 | Ga0495622_0018094 | 3300046557 | Bacteria | 3282 |
| 364 | Ga0495622_0032906 | 3300046557 | Bacteria | 2420 |
| 365 | Ga0495633_0007722 | 3300046558 | Bacteria | 6152 |
| 366 | Ga0495633_0043068 | 3300046558 | Bacteria | 2142 |
| 367 | Ga0495633_0091765 | 3300046558 | Bacteria | 1412 |
| 368 | Ga0495633_0103301 | 3300046558 | Bacteria | 1322 |
| 369 | Ga0495668_0000007 | 3300046616 | Bacteria | 552902 |
| 370 | Ga0495634_0047892 | 3300046642 | Bacteria | 2879 |
| 371 | Ga0495611_0150263 | 3300046648 | Bacteria | 1087 |
| 372 | Ga0495625_0001479 | 3300046660 | Bacteria | 28402 |
| 373 | Ga0495625_0009233 | 3300046660 | Bacteria | 8278 |
| 374 | Ga0495625_0013066 | 3300046660 | Bacteria | 6691 |
| 375 | Ga0495625_0025766 | 3300046660 | Bacteria | 4453 |
| 376 | Ga0495625_0144593 | 3300046660 | Bacteria | 1602 |
| 377 | Ga0495625_0214403 | 3300046660 | Bacteria | 1264 |
| 378 | Ga0495625_0284306 | 3300046660 | Bacteria | 1063 |
| 379 | Ga0495625_0789239 | 3300046660 | Bacteria | 553 |
| 380 | Ga0495661_0086288 | 3300046665 | Bacteria | 1797 |
| 381 | Ga0495588_0026414 | 3300046674 | Bacteria | 2898 |
| 382 | Ga0495669_0000507 | 3300046684 | Bacteria | 17678 |
| 383 | Ga0495669_0396514 | 3300046684 | Bacteria | 669 |
| 384 | Ga0495613_0006945 | 3300046689 | Bacteria | 8444 |
| 385 | Ga0495624_0102958 | 3300046690 | Bacteria | 1757 |
| 386 | Ga0495670_0049902 | 3300046691 | Bacteria | 2094 |
| 387 | Ga0495670_0052447 | 3300046691 | Bacteria | 2042 |
| 388 | Ga0495671_0080673 | 3300046692 | Bacteria | 1594 |
| 389 | Ga0495671_0424616 | 3300046692 | Bacteria | 636 |
| 390 | Ga0495600_0013303 | 3300046809 | Bacteria | 5167 |
| 391 | Ga0495660_0157130 | 3300046810 | Bacteria | 1118 |
| 392 | Ga0495581_0017676 | 3300047315 | Bacteria | 4143 |
| 393 | Ga0495676_0448560 | 3300047321 | Bacteria | 851 |
| 394 | Ga0495680_0418595 | 3300047322 | Bacteria | 922 |
| 395 | Ga0495683_0030887 | 3300047323 | Bacteria | 2731 |
| 396 | Ga0495683_0204867 | 3300047323 | Bacteria | 887 |
| 397 | Ga0495687_004439 | 3300047443 | Bacteria | 9474 |
| 398 | Ga0495687_013793 | 3300047443 | Bacteria | 4194 |
| 399 | Ga0495677_0006691 | 3300047445 | Bacteria | 4339 |
| 400 | Ga0495681_0000011 | 3300047470 | Bacteria | 201843 |
| 401 | Ga0495681_0150222 | 3300047470 | Bacteria | 978 |
| 402 | Ga0495684_0544525 | 3300047471 | Bacteria | 791 |
| 403 | Ga0495686_0052596 | 3300047472 | Bacteria | 2553 |
| 404 | Ga0495593_0004291 | 3300047673 | Bacteria | 8477 |
| 405 | Ga0495614_0015186 | 3300048089 | Bacteria | 3359 |
| 406 | Ga0496101_0459223 | 3300048904 | Bacteria | 1005 |
| 407 | Ga0496102_0011729 | 3300048905 | Bacteria | 7563 |
| 408 | Ga0496102_0177808 | 3300048905 | Bacteria | 2004 |
| 409 | Ga0496102_0779161 | 3300048905 | Bacteria | 879 |
| 410 | Ga0496102_1407386 | 3300048905 | Bacteria | 616 |
| 411 | Ga0496102_1609536 | 3300048905 | Bacteria | 568 |
| 412 | Ga0496103_0000836 | 3300048906 | Bacteria | 22508 |
| 413 | Ga0496103_0121314 | 3300048906 | Bacteria | 1665 |
| 414 | Ga0496104_0033295 | 3300048907 | Bacteria | 4800 |
| 415 | Ga0496104_0831456 | 3300048907 | Bacteria | 829 |
| 416 | Ga0496105_0052177 | 3300048908 | Bacteria | 3376 |
| 417 | Ga0496105_0196454 | 3300048908 | Bacteria | 1648 |
| 418 | Ga0496105_0343701 | 3300048908 | Bacteria | 1193 |
| 419 | Ga0496106_0288845 | 3300048909 | Bacteria | 1315 |
| 420 | Ga0496107_0141097 | 3300048910 | Bacteria | 1781 |
| 421 | Ga0496107_0754666 | 3300048910 | Bacteria | 714 |
| 422 | Ga0496110_0501370 | 3300048913 | Bacteria | 1105 |
| 423 | Ga0496111_0007641 | 3300048914 | Bacteria | 7105 |
| 424 | Ga0496112_0011677 | 3300048915 | Bacteria | 8035 |
| 425 | Ga0496113_0163203 | 3300048916 | Bacteria | 1762 |
| 426 | Ga0496113_1172694 | 3300048916 | Bacteria | 601 |
| 427 | Ga0496114_0137219 | 3300048917 | Bacteria | 2115 |
| 428 | Ga0496114_0195286 | 3300048917 | Bacteria | 1771 |
| 429 | Ga0496115_0000597 | 3300048918 | Bacteria | 27647 |
| 430 | Ga0496115_0002445 | 3300048918 | Bacteria | 13344 |
| 431 | Ga0496116_0017799 | 3300048919 | Bacteria | 5501 |
| 432 | Ga0496117_0000182 | 3300048920 | Bacteria | 128076 |
| 433 | Ga0496117_0179801 | 3300048920 | Bacteria | 1217 |
| 434 | Ga0496118_0000125 | 3300048921 | Bacteria | 136422 |
| 435 | Ga0496118_0073182 | 3300048921 | Bacteria | 2456 |
| 436 | Ga0496119_0010214 | 3300048922 | Bacteria | 7921 |
| 437 | Ga0496120_0033907 | 3300048923 | Bacteria | 3063 |
| 438 | Ga0496121_0000367 | 3300048924 | Bacteria | 92745 |
| 439 | Ga0496121_0007290 | 3300048924 | Bacteria | 13381 |
| 440 | Ga0496121_0034537 | 3300048924 | Bacteria | 4551 |
| 441 | Ga0496121_0129749 | 3300048924 | Bacteria | 1889 |
| 442 | Ga0496122_0023643 | 3300048925 | Bacteria | 5406 |
| 443 | Ga0496122_0036059 | 3300048925 | Bacteria | 4009 |
| 444 | Ga0496123_0024694 | 3300048926 | Bacteria | 4559 |
| 445 | Ga0496123_0041016 | 3300048926 | Bacteria | 3215 |
| 446 | Ga0496124_0000082 | 3300048927 | Bacteria | 208248 |
| 447 | Ga0496125_0002269 | 3300048928 | Bacteria | 25512 |
| 448 | Ga0496126_0000221 | 3300048929 | Bacteria | 124193 |
| 449 | Ga0496126_0633262 | 3300048929 | Bacteria | 839 |
| 450 | Ga0495678_226482 | 3300049459 | Bacteria | 565 |
| 451 | Ga0501031_0475813 | 3300049568 | Bacteria | 806 |
| 452 | Ga0501036_0300804 | 3300049572 | Bacteria | 1342 |
| 453 | Ga0501036_0698343 | 3300049572 | Bacteria | 838 |
| 454 | Ga0501037_0130539 | 3300049573 | Bacteria | 1802 |
| 455 | Ga0501037_0419393 | 3300049573 | Bacteria | 916 |
| 456 | Ga0501038_0024065 | 3300049574 | Bacteria | 5435 |
| 457 | Ga0501038_0162203 | 3300049574 | Bacteria | 1816 |
| 458 | Ga0501038_0272083 | 3300049574 | Bacteria | 1335 |
| 459 | Ga0501039_0121841 | 3300049575 | Bacteria | 2044 |
| 460 | Ga0501039_0590748 | 3300049575 | Bacteria | 870 |
| 461 | Ga0501040_0053816 | 3300049576 | Bacteria | 2758 |
| 462 | Ga0501041_0163729 | 3300049577 | Bacteria | 1391 |
| 463 | Ga0501042_0090173 | 3300049578 | Bacteria | 2200 |
| 464 | Ga0501042_0140537 | 3300049578 | Bacteria | 1741 |
| 465 | Ga0501042_0281248 | 3300049578 | Bacteria | 1202 |
| 466 | Ga0501046_0171634 | 3300049580 | Bacteria | 1627 |
| 467 | Ga0501046_0356179 | 3300049580 | Bacteria | 1062 |
| 468 | Ga0501046_0886504 | 3300049580 | Bacteria | 623 |
| 469 | Ga0501068_0082693 | 3300049584 | Bacteria | 1973 |
| 470 | Ga0501070_0582583 | 3300049586 | Bacteria | 893 |
| 471 | Ga0501071_0014849 | 3300049587 | Bacteria | 5335 |
| 472 | Ga0501072_0207638 | 3300049588 | Bacteria | 1561 |
| 473 | Ga0501073_0913935 | 3300049589 | Bacteria | 604 |
| 474 | Ga0501074_0561793 | 3300049590 | Bacteria | 808 |
| 475 | Ga0501074_1062612 | 3300049590 | Bacteria | 569 |
| 476 | Ga0501075_0084906 | 3300049591 | Bacteria | 2398 |
| 477 | Ga0501076_0099355 | 3300049592 | Bacteria | 2344 |
| 478 | Ga0501076_0107757 | 3300049592 | Bacteria | 2250 |
| 479 | Ga0501077_0321028 | 3300049593 | Bacteria | 987 |
| 480 | Ga0501079_0074851 | 3300049741 | Bacteria | 2618 |
| 481 | Ga0501080_0510921 | 3300049742 | Bacteria | 1073 |
| 482 | Ga0501081_0058001 | 3300049743 | Bacteria | 2678 |
| 483 | Ga0501081_0136410 | 3300049743 | Bacteria | 1756 |
| 484 | Ga0501081_0688437 | 3300049743 | Bacteria | 767 |
| 485 | Ga0501081_1150548 | 3300049743 | Bacteria | 587 |
| 486 | Ga0501044_0327664 | 3300049823 | Bacteria | 1455 |
| 487 | Ga0501045_0304397 | 3300049824 | Bacteria | 1186 |
| 488 | Ga0501045_0782595 | 3300049824 | Bacteria | 703 |
| 489 | nmdc:mga03683_7580_c1 | 3300050489 | Bacteria | 3774 |
| 490 | nmdc:mga00v17_302228_c1 | 3300050491 | Bacteria | 1039 |
| 491 | nmdc:mga00v17_5943_c1 | 3300050491 | Bacteria | 6454 |
| 492 | nmdc:mga0k408_214869_c1 | 3300050493 | Bacteria | 1148 |
| 493 | nmdc:mga0k408_53081_c1 | 3300050493 | Bacteria | 2349 |
| 494 | nmdc:mga07m45_41377_c1 | 3300050496 | Bacteria | 2580 |
| 495 | nmdc:mga08y16_142307_c1 | 3300050511 | Bacteria | 1523 |
| 496 | nmdc:mga08y16_821233_c1 | 3300050511 | Bacteria | 921 |
| 497 | nmdc:mga0a205_699074_c1 | 3300050515 | Bacteria | 864 |
| 498 | nmdc:mga0sz30_18727_c2 | 3300050516 | Bacteria | 886 |
| 499 | Ga0495612_0128142 | 3300053078 | Bacteria | 1095 |
| 500 | Ga0500610_0000140 | 3300053079 | Bacteria | 21620 |
| 501 | Ga0495619_0004011 | 3300053085 | Bacteria | 9435 |
| 502 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 503 | Ga0500643_009771 | 3300053087 | Bacteria | 3637 |
| 504 | Ga0500643_009963 | 3300053087 | Bacteria | 3581 |
| 505 | Ga0500643_059905 | 3300053087 | Bacteria | 1070 |
| 506 | Ga0500647_0253708 | 3300053091 | Bacteria | 772 |
| 507 | Ga0500651_0497353 | 3300053093 | Bacteria | 673 |
| 508 | Ga0500641_0040456 | 3300053096 | Bacteria | 1883 |
| 509 | Ga0500555_002842 | 3300053103 | Bacteria | 4971 |
| 510 | Ga0500562_011833 | 3300053108 | Bacteria | 2217 |
| 511 | Ga0500562_070644 | 3300053108 | Bacteria | 942 |
| 512 | Ga0500595_010172 | 3300053119 | Bacteria | 3750 |
| 513 | Ga0500642_0000804 | 3300053130 | Bacteria | 9202 |
| 514 | Ga0500559_0103072 | 3300053136 | Bacteria | 1316 |
| 515 | Ga0500559_0183075 | 3300053136 | Bacteria | 987 |
| 516 | Ga0500559_0322299 | 3300053136 | Bacteria | 724 |
| 517 | Ga0500573_0239100 | 3300053140 | Bacteria | 943 |
| 518 | Ga0500616_0007018 | 3300053153 | Bacteria | 7233 |
| 519 | Ga0500616_0081604 | 3300053153 | Bacteria | 1624 |
| 520 | Ga0500616_0133312 | 3300053153 | Bacteria | 1171 |
| 521 | Ga0500619_176045 | 3300053154 | Bacteria | 723 |
| 522 | Ga0500624_000666 | 3300053157 | Bacteria | 8884 |
| 523 | Ga0500636_0033551 | 3300053177 | Bacteria | 3038 |
| 524 | Ga0500636_0088068 | 3300053177 | Bacteria | 1781 |
| 525 | Ga0500645_000080 | 3300053730 | Bacteria | 76756 |
| 526 | Ga0500645_142269 | 3300053730 | Bacteria | 663 |
| 527 | Ga0500596_004831 | 3300053735 | Bacteria | 2435 |
| 528 | Ga0500661_026348 | 3300055283 | Bacteria | 1027 |
| 529 | Ga0500661_085737 | 3300055283 | Bacteria | 587 |
| 530 | Ga0587101_048128 | 3300059623 | Bacteria | 726 |
| 531 | Ga0587111_0089978 | 3300060346 | Bacteria | 748 |
| 532 | Ga0530510_0020509 | 3300061734 | Bacteria | 4699 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0000007 | Ga0451576_0000007_117923_118378 | 128 |
| 2 | 3300046491 | Ga0495584_0630224 | Ga0495584_0630224_65_514 | 131 |
| 3 | 3300005328 | Ga0070676_10537856 | Ga0070676_105378561 | 133 |
| 4 | 3300005341 | Ga0070691_10143677 | Ga0070691_101436772 | 133 |
| 5 | 3300005344 | Ga0070661_100514733 | Ga0070661_1005147332 | 133 |
| 6 | 3300005347 | Ga0070668_100437766 | Ga0070668_1004377662 | 133 |
| 7 | 3300005365 | Ga0070688_100268431 | Ga0070688_1002684312 | 133 |
| 8 | 3300005438 | Ga0070701_10847703 | Ga0070701_108477031 | 133 |
| 9 | 3300005547 | Ga0070693_100160888 | Ga0070693_1001608882 | 133 |
| 10 | 3300009147 | Ga0114129_10097405 | Ga0114129_100974052 | 133 |
| 11 | 3300009553 | Ga0105249_10129555 | Ga0105249_101295552 | 133 |
| 12 | 3300025907 | Ga0207645_10063405 | Ga0207645_100634053 | 134 |
| 13 | 3300025920 | Ga0207649_10453742 | Ga0207649_104537421 | 134 |
| 14 | 3300025942 | Ga0207689_11728374 | Ga0207689_117283741 | 134 |
| 15 | 3300025961 | Ga0207712_10079964 | Ga0207712_100799642 | 134 |
| 16 | 3300025972 | Ga0207668_10221701 | Ga0207668_102217012 | 134 |
| 17 | 3300031691 | Ga0316579_10006704 | Ga0316579_100067041 | 134 |
| 18 | 3300031727 | Ga0316576_10435361 | Ga0316576_104353611 | 134 |
| 19 | 3300031727 | Ga0316576_10650699 | Ga0316576_106506991 | 134 |
| 20 | 3300031728 | Ga0316578_10023162 | Ga0316578_100231621 | 134 |
| 21 | 3300031728 | Ga0316578_10188511 | Ga0316578_101885112 | 134 |
| 22 | 3300031733 | Ga0316577_10179788 | Ga0316577_101797882 | 134 |
| 23 | 3300032133 | Ga0316583_10018558 | Ga0316583_100185582 | 134 |
| 24 | 3300032137 | Ga0316585_10272369 | Ga0316585_102723691 | 134 |
| 25 | 3300032139 | Ga0316580_10030556 | Ga0316580_100305561 | 134 |
| 26 | 3300035398 | Ga0316574_0701526 | Ga0316574_0701526_80_529 | 134 |
| 27 | 3300036647 | Ga0316582_0858058 | Ga0316582_0858058_161_610 | 134 |
| 28 | 3300036712 | Ga0316584_0036331 | Ga0316584_0036331_674_1123 | 134 |
| 29 | 3300037588 | Ga0316581_0053247 | Ga0316581_0053247_724_1173 | 134 |
| 30 | 3300010375 | Ga0105239_10552011 | Ga0105239_105520112 | 135 |
| 31 | 3300026035 | Ga0207703_11384412 | Ga0207703_113844121 | 135 |
| 32 | 3300035112 | Ga0373932_0122345 | Ga0373932_0122345_107_556 | 135 |
| 33 | 3300035691 | Ga0373931_0017764 | Ga0373931_0017764_2315_2764 | 135 |
| 34 | 3300048905 | Ga0496102_0779161 | Ga0496102_0779161_417_866 | 135 |
| 35 | 3300049588 | Ga0501072_0207638 | Ga0501072_0207638_230_679 | 135 |
| 36 | 3300049592 | Ga0501076_0107757 | Ga0501076_0107757_190_639 | 135 |
| 37 | 3300005545 | Ga0070695_100107393 | Ga0070695_1001073932 | 136 |
| 38 | 3300005718 | Ga0068866_11080001 | Ga0068866_110800012 | 136 |
| 39 | 3300009176 | Ga0105242_12462550 | Ga0105242_124625501 | 136 |
| 40 | 3300025934 | Ga0207686_10730249 | Ga0207686_107302491 | 136 |
| 41 | 3300046684 | Ga0495669_0396514 | Ga0495669_0396514_66_515 | 136 |
| 42 | 3300048910 | Ga0496107_0754666 | Ga0496107_0754666_252_701 | 136 |
| 43 | 3300050511 | nmdc:mga08y16_821233_c1 | nmdc:mga08y16_821233_c1_44_493 | 137 |
| 44 | 3300009148 | Ga0105243_10378055 | Ga0105243_103780552 | 138 |
| 45 | 3300011119 | Ga0105246_11432129 | Ga0105246_114321291 | 138 |
| 46 | 3300046558 | Ga0495633_0043068 | Ga0495633_0043068_379_831 | 139 |
| 47 | 3300053087 | Ga0500643_009963 | Ga0500643_009963_2475_2927 | 139 |
| 48 | 3300053140 | Ga0500573_0239100 | Ga0500573_0239100_55_507 | 139 |
| 49 | 3300053157 | Ga0500624_000666 | Ga0500624_000666_7054_7506 | 139 |
| 50 | 3300053177 | Ga0500636_0033551 | Ga0500636_0033551_563_1015 | 139 |
| 51 | 3300026023 | Ga0207677_11201815 | Ga0207677_112018152 | 140 |
| 52 | 3300053078 | Ga0495612_0128142 | Ga0495612_0128142_116_565 | 142 |
| 53 | 3300048907 | Ga0496104_0831456 | Ga0496104_0831456_228_746 | 144 |
| 54 | 3300050493 | nmdc:mga0k408_214869_c1 | nmdc:mga0k408_214869_c1_26_466 | 146 |
| 55 | iso_pu_bacteria | 2751185897 | 2753764448 | 146 |
| 56 | iso_pu_bacteria | 2879163058 | 2879165714 | 146 |
| 57 | iso_pu_bacteria | 2882806704 | 2882807873 | 146 |
| 58 | iso_pu_bacteria | 2928526807 | 2928527570 | 146 |
| 59 | iso_pu_bacteria | 3000865235 | 3000865972 | 146 |
| 60 | iso_pu_bacteria | 2511231221 | 2512032812 | 147 |
| 61 | iso_pu_bacteria | 8054002106 | 8054006304 | 147 |
| 62 | 3300005289 | Ga0065704_10288184 | Ga0065704_102881841 | 149 |
| 63 | 3300005563 | Ga0068855_100014403 | Ga0068855_1000144034 | 149 |
| 64 | 3300006914 | Ga0075436_100887794 | Ga0075436_1008877942 | 149 |
| 65 | 3300009094 | Ga0111539_10043887 | Ga0111539_100438872 | 149 |
| 66 | 3300014497 | Ga0182008_10983098 | Ga0182008_109830981 | 149 |
| 67 | 3300025905 | Ga0207685_10367945 | Ga0207685_103679451 | 149 |
| 68 | 3300025906 | Ga0207699_10101340 | Ga0207699_101013402 | 149 |
| 69 | 3300027617 | Ga0210002_1032920 | Ga0210002_10329201 | 149 |
| 70 | 3300027682 | Ga0209971_1154517 | Ga0209971_11545171 | 149 |
| 71 | 3300027717 | Ga0209998_10011875 | Ga0209998_100118751 | 149 |
| 72 | 3300031691 | Ga0316579_10417458 | Ga0316579_104174581 | 149 |
| 73 | 3300035083 | Ga0373926_0028754 | Ga0373926_0028754_546_995 | 149 |
| 74 | 3300035170 | Ga0373943_0049186 | Ga0373943_0049186_1130_1579 | 149 |
| 75 | 3300035171 | Ga0373946_0184367 | Ga0373946_0184367_364_813 | 149 |
| 76 | 3300035241 | Ga0373961_0164171 | Ga0373961_0164171_289_738 | 149 |
| 77 | 3300035410 | Ga0373924_0514666 | Ga0373924_0514666_53_502 | 149 |
| 78 | 3300035692 | Ga0373935_0227642 | Ga0373935_0227642_669_1118 | 149 |
| 79 | 3300035695 | Ga0373927_0012254 | Ga0373927_0012254_1744_2193 | 149 |
| 80 | 3300035724 | Ga0373933_0306367 | Ga0373933_0306367_489_938 | 149 |
| 81 | 3300035725 | Ga0373947_0013628 | Ga0373947_0013628_2344_2793 | 149 |
| 82 | 3300037068 | Ga0373925_0054302 | Ga0373925_0054302_796_1245 | 149 |
| 83 | 3300046455 | Ga0495603_0002724 | Ga0495603_0002724_2590_3039 | 149 |
| 84 | 3300046459 | Ga0495629_0000907 | Ga0495629_0000907_2906_3355 | 149 |
| 85 | 3300046472 | Ga0495580_0013222 | Ga0495580_0013222_5707_6156 | 149 |
| 86 | 3300046473 | Ga0495582_0018038 | Ga0495582_0018038_918_1367 | 149 |
| 87 | 3300046475 | Ga0495639_0004636 | Ga0495639_0004636_2453_2902 | 149 |
| 88 | 3300046491 | Ga0495584_0015856 | Ga0495584_0015856_94_543 | 149 |
| 89 | 3300046499 | Ga0495594_0001129 | Ga0495594_0001129_2373_2822 | 149 |
| 90 | 3300046517 | Ga0495630_0211328 | Ga0495630_0211328_250_699 | 149 |
| 91 | 3300046523 | Ga0495644_0073745 | Ga0495644_0073745_753_1205 | 149 |
| 92 | 3300046557 | Ga0495622_0018094 | Ga0495622_0018094_325_774 | 149 |
| 93 | 3300046558 | Ga0495633_0091765 | Ga0495633_0091765_190_642 | 149 |
| 94 | 3300046642 | Ga0495634_0047892 | Ga0495634_0047892_2262_2711 | 149 |
| 95 | 3300046674 | Ga0495588_0026414 | Ga0495588_0026414_1581_2030 | 149 |
| 96 | 3300046689 | Ga0495613_0006945 | Ga0495613_0006945_5597_6046 | 149 |
| 97 | 3300046690 | Ga0495624_0102958 | Ga0495624_0102958_44_493 | 149 |
| 98 | 3300047315 | Ga0495581_0017676 | Ga0495581_0017676_2958_3407 | 149 |
| 99 | 3300047321 | Ga0495676_0448560 | Ga0495676_0448560_14_463 | 149 |
| 100 | 3300047322 | Ga0495680_0418595 | Ga0495680_0418595_113_562 | 149 |
| 101 | 3300047471 | Ga0495684_0544525 | Ga0495684_0544525_283_732 | 149 |
| 102 | 3300047673 | Ga0495593_0004291 | Ga0495593_0004291_5438_5887 | 149 |
| 103 | 3300048089 | Ga0495614_0015186 | Ga0495614_0015186_440_889 | 149 |
| 104 | 3300048904 | Ga0496101_0459223 | Ga0496101_0459223_19_471 | 149 |
| 105 | 3300048905 | Ga0496102_0177808 | Ga0496102_0177808_645_1094 | 149 |
| 106 | 3300048905 | Ga0496102_1407386 | Ga0496102_1407386_48_497 | 149 |
| 107 | 3300048906 | Ga0496103_0121314 | Ga0496103_0121314_1139_1591 | 149 |
| 108 | 3300048908 | Ga0496105_0196454 | Ga0496105_0196454_1093_1545 | 149 |
| 109 | 3300048909 | Ga0496106_0288845 | Ga0496106_0288845_18_470 | 149 |
| 110 | 3300048915 | Ga0496112_0011677 | Ga0496112_0011677_3638_4090 | 149 |
| 111 | 3300048916 | Ga0496113_0163203 | Ga0496113_0163203_143_634 | 149 |
| 112 | 3300049568 | Ga0501031_0475813 | Ga0501031_0475813_258_707 | 149 |
| 113 | 3300049572 | Ga0501036_0300804 | Ga0501036_0300804_565_1014 | 149 |
| 114 | 3300049572 | Ga0501036_0698343 | Ga0501036_0698343_356_805 | 149 |
| 115 | 3300049573 | Ga0501037_0419393 | Ga0501037_0419393_199_648 | 149 |
| 116 | 3300049574 | Ga0501038_0162203 | Ga0501038_0162203_880_1329 | 149 |
| 117 | 3300049574 | Ga0501038_0272083 | Ga0501038_0272083_469_918 | 149 |
| 118 | 3300049575 | Ga0501039_0121841 | Ga0501039_0121841_44_493 | 149 |
| 119 | 3300049575 | Ga0501039_0590748 | Ga0501039_0590748_112_561 | 149 |
| 120 | 3300049576 | Ga0501040_0053816 | Ga0501040_0053816_168_617 | 149 |
| 121 | 3300049577 | Ga0501041_0163729 | Ga0501041_0163729_598_1047 | 149 |
| 122 | 3300049578 | Ga0501042_0090173 | Ga0501042_0090173_1010_1459 | 149 |
| 123 | 3300049578 | Ga0501042_0140537 | Ga0501042_0140537_252_701 | 149 |
| 124 | 3300049578 | Ga0501042_0281248 | Ga0501042_0281248_66_515 | 149 |
| 125 | 3300049580 | Ga0501046_0171634 | Ga0501046_0171634_234_683 | 149 |
| 126 | 3300049580 | Ga0501046_0886504 | Ga0501046_0886504_38_487 | 149 |
| 127 | 3300049584 | Ga0501068_0082693 | Ga0501068_0082693_476_925 | 149 |
| 128 | 3300049587 | Ga0501071_0014849 | Ga0501071_0014849_1826_2275 | 149 |
| 129 | 3300049589 | Ga0501073_0913935 | Ga0501073_0913935_26_475 | 149 |
| 130 | 3300049590 | Ga0501074_0561793 | Ga0501074_0561793_279_728 | 149 |
| 131 | 3300049590 | Ga0501074_1062612 | Ga0501074_1062612_27_476 | 149 |
| 132 | 3300049591 | Ga0501075_0084906 | Ga0501075_0084906_1321_1770 | 149 |
| 133 | 3300049592 | Ga0501076_0099355 | Ga0501076_0099355_1751_2200 | 149 |
| 134 | 3300049593 | Ga0501077_0321028 | Ga0501077_0321028_381_830 | 149 |
| 135 | 3300049741 | Ga0501079_0074851 | Ga0501079_0074851_1011_1460 | 149 |
| 136 | 3300049742 | Ga0501080_0510921 | Ga0501080_0510921_531_980 | 149 |
| 137 | 3300049743 | Ga0501081_0058001 | Ga0501081_0058001_513_962 | 149 |
| 138 | 3300049743 | Ga0501081_0136410 | Ga0501081_0136410_277_726 | 149 |
| 139 | 3300049743 | Ga0501081_0688437 | Ga0501081_0688437_259_708 | 149 |
| 140 | 3300049743 | Ga0501081_1150548 | Ga0501081_1150548_126_575 | 149 |
| 141 | 3300049824 | Ga0501045_0304397 | Ga0501045_0304397_258_707 | 149 |
| 142 | 3300049824 | Ga0501045_0782595 | Ga0501045_0782595_172_621 | 149 |
| 143 | 3300050511 | nmdc:mga08y16_142307_c1 | nmdc:mga08y16_142307_c1_31_480 | 149 |
| 144 | 3300050515 | nmdc:mga0a205_699074_c1 | nmdc:mga0a205_699074_c1_237_686 | 149 |
| 145 | 3300053085 | Ga0495619_0004011 | Ga0495619_0004011_3113_3562 | 149 |
| 146 | 3300061734 | Ga0530510_0020509 | Ga0530510_0020509_1904_2353 | 149 |
| 147 | 3300001915 | JGI24741J21665_1001343 | JGI24741J21665_10013431 | 150 |
| 148 | 3300001915 | JGI24741J21665_1016365 | JGI24741J21665_10163652 | 150 |
| 149 | 3300001978 | JGI24747J21853_1039958 | JGI24747J21853_10399581 | 150 |
| 150 | 3300001979 | JGI24740J21852_10044474 | JGI24740J21852_100444742 | 150 |
| 151 | 3300001979 | JGI24740J21852_10047532 | JGI24740J21852_100475322 | 150 |
| 152 | 3300001979 | JGI24740J21852_10052507 | JGI24740J21852_100525072 | 150 |
| 153 | 3300001990 | JGI24737J22298_10029642 | JGI24737J22298_100296422 | 150 |
| 154 | 3300001990 | JGI24737J22298_10181254 | JGI24737J22298_101812541 | 150 |
| 155 | 3300003215 | JGI25153J46596_10000006 | JGI25153J46596_10000006211 | 150 |
| 156 | 3300003759 | Ga0055525_1000051 | Ga0055525_100005143 | 150 |
| 157 | 3300003762 | Ga0055542_1000020 | Ga0055542_1000020158 | 150 |
| 158 | 3300003763 | Ga0055529_1000016 | Ga0055529_1000016189 | 150 |
| 159 | 3300003791 | Ga0055530_10000978 | Ga0055530_1000097815 | 150 |
| 160 | 3300003794 | Ga0055531_10001645 | Ga0055531_1000164515 | 150 |
| 161 | 3300005262 | Ga0065165_1039706 | Ga0065165_10397062 | 150 |
| 162 | 3300005289 | Ga0065704_10070209 | Ga0065704_1007020948 | 150 |
| 163 | 3300005327 | Ga0070658_10001558 | Ga0070658_1000155817 | 150 |
| 164 | 3300005327 | Ga0070658_10514482 | Ga0070658_105144821 | 150 |
| 165 | 3300005328 | Ga0070676_11024555 | Ga0070676_110245551 | 150 |
| 166 | 3300005329 | Ga0070683_100105670 | Ga0070683_1001056703 | 150 |
| 167 | 3300005329 | Ga0070683_100361830 | Ga0070683_1003618302 | 150 |
| 168 | 3300005330 | Ga0070690_100452281 | Ga0070690_1004522811 | 150 |
| 169 | 3300005336 | Ga0070680_100025291 | Ga0070680_1000252914 | 150 |
| 170 | 3300005336 | Ga0070680_100105728 | Ga0070680_1001057282 | 150 |
| 171 | 3300005336 | Ga0070680_101088607 | Ga0070680_1010886071 | 150 |
| 172 | 3300005339 | Ga0070660_100616784 | Ga0070660_1006167841 | 150 |
| 173 | 3300005344 | Ga0070661_100001207 | Ga0070661_10000120711 | 150 |
| 174 | 3300005344 | Ga0070661_100227527 | Ga0070661_1002275272 | 150 |
| 175 | 3300005344 | Ga0070661_100241612 | Ga0070661_1002416122 | 150 |
| 176 | 3300005344 | Ga0070661_100624656 | Ga0070661_1006246561 | 150 |
| 177 | 3300005347 | Ga0070668_100750172 | Ga0070668_1007501722 | 150 |
| 178 | 3300005347 | Ga0070668_101477547 | Ga0070668_1014775471 | 150 |
| 179 | 3300005353 | Ga0070669_101168684 | Ga0070669_1011686841 | 150 |
| 180 | 3300005354 | Ga0070675_100083570 | Ga0070675_1000835702 | 150 |
| 181 | 3300005355 | Ga0070671_100167790 | Ga0070671_1001677902 | 150 |
| 182 | 3300005356 | Ga0070674_100003705 | Ga0070674_1000037056 | 150 |
| 183 | 3300005364 | Ga0070673_100105514 | Ga0070673_1001055143 | 150 |
| 184 | 3300005366 | Ga0070659_100010912 | Ga0070659_1000109124 | 150 |
| 185 | 3300005366 | Ga0070659_100037913 | Ga0070659_1000379134 | 150 |
| 186 | 3300005366 | Ga0070659_100135769 | Ga0070659_1001357693 | 150 |
| 187 | 3300005366 | Ga0070659_100852005 | Ga0070659_1008520051 | 150 |
| 188 | 3300005440 | Ga0070705_100642419 | Ga0070705_1006424191 | 150 |
| 189 | 3300005444 | Ga0070694_101797019 | Ga0070694_1017970191 | 150 |
| 190 | 3300005455 | Ga0070663_100015002 | Ga0070663_1000150025 | 150 |
| 191 | 3300005455 | Ga0070663_100131892 | Ga0070663_1001318921 | 150 |
| 192 | 3300005455 | Ga0070663_100529178 | Ga0070663_1005291782 | 150 |
| 193 | 3300005456 | Ga0070678_100002746 | Ga0070678_1000027465 | 150 |
| 194 | 3300005456 | Ga0070678_100355077 | Ga0070678_1003550772 | 150 |
| 195 | 3300005457 | Ga0070662_100079444 | Ga0070662_1000794442 | 150 |
| 196 | 3300005457 | Ga0070662_100102735 | Ga0070662_1001027351 | 150 |
| 197 | 3300005457 | Ga0070662_100179222 | Ga0070662_1001792222 | 150 |
| 198 | 3300005458 | Ga0070681_10051662 | Ga0070681_100516622 | 150 |
| 199 | 3300005458 | Ga0070681_10508080 | Ga0070681_105080802 | 150 |
| 200 | 3300005458 | Ga0070681_10830435 | Ga0070681_108304351 | 150 |
| 201 | 3300005459 | Ga0068867_100164780 | Ga0068867_1001647802 | 150 |
| 202 | 3300005530 | Ga0070679_100116995 | Ga0070679_1001169954 | 150 |
| 203 | 3300005530 | Ga0070679_100311193 | Ga0070679_1003111932 | 150 |
| 204 | 3300005535 | Ga0070684_100245445 | Ga0070684_1002454452 | 150 |
| 205 | 3300005539 | Ga0068853_100277896 | Ga0068853_1002778961 | 150 |
| 206 | 3300005539 | Ga0068853_101154062 | Ga0068853_1011540621 | 150 |
| 207 | 3300005545 | Ga0070695_101871363 | Ga0070695_1018713631 | 150 |
| 208 | 3300005548 | Ga0070665_100000086 | Ga0070665_1000000866 | 150 |
| 209 | 3300005563 | Ga0068855_100056391 | Ga0068855_1000563914 | 150 |
| 210 | 3300005563 | Ga0068855_100153248 | Ga0068855_1001532481 | 150 |
| 211 | 3300005563 | Ga0068855_102113559 | Ga0068855_1021135591 | 150 |
| 212 | 3300005564 | Ga0070664_100127003 | Ga0070664_1001270032 | 150 |
| 213 | 3300005564 | Ga0070664_101227536 | Ga0070664_1012275361 | 150 |
| 214 | 3300005577 | Ga0068857_100113850 | Ga0068857_1001138501 | 150 |
| 215 | 3300005577 | Ga0068857_100262150 | Ga0068857_1002621501 | 150 |
| 216 | 3300005577 | Ga0068857_100330325 | Ga0068857_1003303253 | 150 |
| 217 | 3300005577 | Ga0068857_100516176 | Ga0068857_1005161761 | 150 |
| 218 | 3300005577 | Ga0068857_100703105 | Ga0068857_1007031052 | 150 |
| 219 | 3300005577 | Ga0068857_101457618 | Ga0068857_1014576181 | 150 |
| 220 | 3300005578 | Ga0068854_100007023 | Ga0068854_1000070234 | 150 |
| 221 | 3300005578 | Ga0068854_100263108 | Ga0068854_1002631082 | 150 |
| 222 | 3300005578 | Ga0068854_100762176 | Ga0068854_1007621762 | 150 |
| 223 | 3300005578 | Ga0068854_100912930 | Ga0068854_1009129302 | 150 |
| 224 | 3300005614 | Ga0068856_100039275 | Ga0068856_1000392753 | 150 |
| 225 | 3300005614 | Ga0068856_100044943 | Ga0068856_1000449432 | 150 |
| 226 | 3300005616 | Ga0068852_100294333 | Ga0068852_1002943332 | 150 |
| 227 | 3300005616 | Ga0068852_100414429 | Ga0068852_1004144292 | 150 |
| 228 | 3300005616 | Ga0068852_100956688 | Ga0068852_1009566882 | 150 |
| 229 | 3300005616 | Ga0068852_101261386 | Ga0068852_1012613861 | 150 |
| 230 | 3300005618 | Ga0068864_100004572 | Ga0068864_1000045729 | 150 |
| 231 | 3300005842 | Ga0068858_100003942 | Ga0068858_1000039428 | 150 |
| 232 | 3300005842 | Ga0068858_100004671 | Ga0068858_10000467112 | 150 |
| 233 | 3300005983 | Ga0081540_1058576 | Ga0081540_10585762 | 150 |
| 234 | 3300006051 | Ga0075364_10000558 | Ga0075364_1000055813 | 150 |
| 235 | 3300006051 | Ga0075364_10144158 | Ga0075364_101441581 | 150 |
| 236 | 3300006177 | Ga0075362_10033788 | Ga0075362_100337883 | 150 |
| 237 | 3300006186 | Ga0075369_10168819 | Ga0075369_101688192 | 150 |
| 238 | 3300006186 | Ga0075369_10355187 | Ga0075369_103551871 | 150 |
| 239 | 3300006195 | Ga0075366_10440412 | Ga0075366_104404122 | 150 |
| 240 | 3300006353 | Ga0075370_10064180 | Ga0075370_100641802 | 150 |
| 241 | 3300006358 | Ga0068871_100120143 | Ga0068871_1001201432 | 150 |
| 242 | 3300006844 | Ga0075428_100157408 | Ga0075428_1001574084 | 150 |
| 243 | 3300009093 | Ga0105240_10877559 | Ga0105240_108775591 | 150 |
| 244 | 3300009098 | Ga0105245_10001264 | Ga0105245_1000126417 | 150 |
| 245 | 3300009148 | Ga0105243_10000876 | Ga0105243_100008767 | 150 |
| 246 | 3300009148 | Ga0105243_10090243 | Ga0105243_100902432 | 150 |
| 247 | 3300009174 | Ga0105241_10005567 | Ga0105241_100055672 | 150 |
| 248 | 3300009174 | Ga0105241_11039065 | Ga0105241_110390651 | 150 |
| 249 | 3300009176 | Ga0105242_10315579 | Ga0105242_103155791 | 150 |
| 250 | 3300009177 | Ga0105248_10032166 | Ga0105248_100321664 | 150 |
| 251 | 3300009545 | Ga0105237_10572783 | Ga0105237_105727832 | 150 |
| 252 | 3300009545 | Ga0105237_11171168 | Ga0105237_111711681 | 150 |
| 253 | 3300009545 | Ga0105237_11393989 | Ga0105237_113939892 | 150 |
| 254 | 3300009551 | Ga0105238_10078871 | Ga0105238_100788712 | 150 |
| 255 | 3300009551 | Ga0105238_10759244 | Ga0105238_107592442 | 150 |
| 256 | 3300009553 | Ga0105249_10186603 | Ga0105249_101866032 | 150 |
| 257 | 3300009553 | Ga0105249_10254844 | Ga0105249_102548443 | 150 |
| 258 | 3300010375 | Ga0105239_10281371 | Ga0105239_102813712 | 150 |
| 259 | 3300010375 | Ga0105239_10580702 | Ga0105239_105807022 | 150 |
| 260 | 3300010375 | Ga0105239_11409832 | Ga0105239_114098322 | 150 |
| 261 | 3300010375 | Ga0105239_11573566 | Ga0105239_115735662 | 150 |
| 262 | 3300010375 | Ga0105239_12362118 | Ga0105239_123621181 | 150 |
| 263 | 3300011119 | Ga0105246_10087502 | Ga0105246_100875022 | 150 |
| 264 | 3300011119 | Ga0105246_11019284 | Ga0105246_110192841 | 150 |
| 265 | 3300012513 | Ga0157326_1005102 | Ga0157326_10051021 | 150 |
| 266 | 3300013100 | Ga0157373_10039441 | Ga0157373_100394413 | 150 |
| 267 | 3300013100 | Ga0157373_10139492 | Ga0157373_101394921 | 150 |
| 268 | 3300013100 | Ga0157373_10429590 | Ga0157373_104295902 | 150 |
| 269 | 3300013102 | Ga0157371_10000030 | Ga0157371_10000030224 | 150 |
| 270 | 3300013102 | Ga0157371_10002409 | Ga0157371_100024093 | 150 |
| 271 | 3300013104 | Ga0157370_10019186 | Ga0157370_100191866 | 150 |
| 272 | 3300013104 | Ga0157370_10229647 | Ga0157370_102296471 | 150 |
| 273 | 3300013105 | Ga0157369_11226738 | Ga0157369_112267381 | 150 |
| 274 | 3300013296 | Ga0157374_10452704 | Ga0157374_104527041 | 150 |
| 275 | 3300013296 | Ga0157374_11915949 | Ga0157374_119159491 | 150 |
| 276 | 3300013297 | Ga0157378_10097664 | Ga0157378_100976643 | 150 |
| 277 | 3300013306 | Ga0163162_10007973 | Ga0163162_100079733 | 150 |
| 278 | 3300013306 | Ga0163162_11932419 | Ga0163162_119324191 | 150 |
| 279 | 3300013307 | Ga0157372_10559031 | Ga0157372_105590313 | 150 |
| 280 | 3300013307 | Ga0157372_10583815 | Ga0157372_105838152 | 150 |
| 281 | 3300013307 | Ga0157372_10893478 | Ga0157372_108934782 | 150 |
| 282 | 3300013307 | Ga0157372_11171676 | Ga0157372_111716761 | 150 |
| 283 | 3300013307 | Ga0157372_11475709 | Ga0157372_114757091 | 150 |
| 284 | 3300013308 | Ga0157375_10594570 | Ga0157375_105945702 | 150 |
| 285 | 3300014969 | Ga0157376_10133664 | Ga0157376_101336641 | 150 |
| 286 | 3300014969 | Ga0157376_11117040 | Ga0157376_111170401 | 150 |
| 287 | 3300017792 | Ga0163161_10040465 | Ga0163161_100404656 | 150 |
| 288 | 3300021384 | Ga0213876_10111727 | Ga0213876_101117272 | 150 |
| 289 | 3300025230 | Ga0209563_100019 | Ga0209563_100019463 | 150 |
| 290 | 3300025254 | Ga0209148_1000017 | Ga0209148_1000017559 | 150 |
| 291 | 3300025261 | Ga0209233_1000154 | Ga0209233_100015481 | 150 |
| 292 | 3300025261 | Ga0209233_1006001 | Ga0209233_10060012 | 150 |
| 293 | 3300025272 | Ga0209455_1000005 | Ga0209455_1000005559 | 150 |
| 294 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011614 | 150 |
| 295 | 3300025298 | Ga0209050_1000026 | Ga0209050_1000026263 | 150 |
| 296 | 3300025304 | Ga0209257_1000009 | Ga0209257_1000009263 | 150 |
| 297 | 3300025315 | Ga0207697_10051021 | Ga0207697_100510211 | 150 |
| 298 | 3300025901 | Ga0207688_10098205 | Ga0207688_100982052 | 150 |
| 299 | 3300025904 | Ga0207647_10028951 | Ga0207647_100289514 | 150 |
| 300 | 3300025907 | Ga0207645_10226838 | Ga0207645_102268381 | 150 |
| 301 | 3300025909 | Ga0207705_10000531 | Ga0207705_100005317 | 150 |
| 302 | 3300025911 | Ga0207654_10000190 | Ga0207654_100001909 | 150 |
| 303 | 3300025912 | Ga0207707_10025034 | Ga0207707_100250342 | 150 |
| 304 | 3300025912 | Ga0207707_10052670 | Ga0207707_100526703 | 150 |
| 305 | 3300025913 | Ga0207695_10042726 | Ga0207695_100427268 | 150 |
| 306 | 3300025913 | Ga0207695_10271977 | Ga0207695_102719772 | 150 |
| 307 | 3300025914 | Ga0207671_10003175 | Ga0207671_100031751 | 150 |
| 308 | 3300025914 | Ga0207671_10966219 | Ga0207671_109662191 | 150 |
| 309 | 3300025919 | Ga0207657_10071975 | Ga0207657_100719751 | 150 |
| 310 | 3300025919 | Ga0207657_10264374 | Ga0207657_102643741 | 150 |
| 311 | 3300025919 | Ga0207657_10427421 | Ga0207657_104274212 | 150 |
| 312 | 3300025920 | Ga0207649_10011496 | Ga0207649_100114966 | 150 |
| 313 | 3300025920 | Ga0207649_10199092 | Ga0207649_101990922 | 150 |
| 314 | 3300025920 | Ga0207649_10395839 | Ga0207649_103958392 | 150 |
| 315 | 3300025921 | Ga0207652_10048264 | Ga0207652_100482643 | 150 |
| 316 | 3300025924 | Ga0207694_10081519 | Ga0207694_100815193 | 150 |
| 317 | 3300025924 | Ga0207694_10094568 | Ga0207694_100945686 | 150 |
| 318 | 3300025924 | Ga0207694_10097248 | Ga0207694_100972482 | 150 |
| 319 | 3300025924 | Ga0207694_10466872 | Ga0207694_104668722 | 150 |
| 320 | 3300025924 | Ga0207694_10704448 | Ga0207694_107044482 | 150 |
| 321 | 3300025926 | Ga0207659_10013104 | Ga0207659_100131042 | 150 |
| 322 | 3300025927 | Ga0207687_10003410 | Ga0207687_100034104 | 150 |
| 323 | 3300025932 | Ga0207690_10001685 | Ga0207690_1000168510 | 150 |
| 324 | 3300025932 | Ga0207690_10285531 | Ga0207690_102855311 | 150 |
| 325 | 3300025933 | Ga0207706_10001012 | Ga0207706_100010124 | 150 |
| 326 | 3300025933 | Ga0207706_10052514 | Ga0207706_100525143 | 150 |
| 327 | 3300025935 | Ga0207709_10000031 | Ga0207709_1000003184 | 150 |
| 328 | 3300025935 | Ga0207709_10220463 | Ga0207709_102204632 | 150 |
| 329 | 3300025937 | Ga0207669_10000077 | Ga0207669_1000007737 | 150 |
| 330 | 3300025937 | Ga0207669_10029565 | Ga0207669_100295652 | 150 |
| 331 | 3300025941 | Ga0207711_10017656 | Ga0207711_100176564 | 150 |
| 332 | 3300025942 | Ga0207689_10191169 | Ga0207689_101911692 | 150 |
| 333 | 3300025944 | Ga0207661_10239584 | Ga0207661_102395843 | 150 |
| 334 | 3300025944 | Ga0207661_10318223 | Ga0207661_103182232 | 150 |
| 335 | 3300025945 | Ga0207679_10180840 | Ga0207679_101808402 | 150 |
| 336 | 3300025949 | Ga0207667_10000004 | Ga0207667_10000004368 | 150 |
| 337 | 3300025949 | Ga0207667_10121091 | Ga0207667_101210911 | 150 |
| 338 | 3300025960 | Ga0207651_10030156 | Ga0207651_100301566 | 150 |
| 339 | 3300025981 | Ga0207640_10029437 | Ga0207640_100294374 | 150 |
| 340 | 3300025981 | Ga0207640_10416612 | Ga0207640_104166122 | 150 |
| 341 | 3300025986 | Ga0207658_10071753 | Ga0207658_100717532 | 150 |
| 342 | 3300026023 | Ga0207677_11010558 | Ga0207677_110105581 | 150 |
| 343 | 3300026035 | Ga0207703_10001326 | Ga0207703_1000132620 | 150 |
| 344 | 3300026035 | Ga0207703_10002565 | Ga0207703_100025658 | 150 |
| 345 | 3300026041 | Ga0207639_10037912 | Ga0207639_100379126 | 150 |
| 346 | 3300026041 | Ga0207639_10097153 | Ga0207639_100971533 | 150 |
| 347 | 3300026067 | Ga0207678_10171549 | Ga0207678_101715492 | 150 |
| 348 | 3300026067 | Ga0207678_10311323 | Ga0207678_103113232 | 150 |
| 349 | 3300026067 | Ga0207678_10758873 | Ga0207678_107588731 | 150 |
| 350 | 3300026078 | Ga0207702_10000642 | Ga0207702_1000064212 | 150 |
| 351 | 3300026089 | Ga0207648_10040752 | Ga0207648_100407522 | 150 |
| 352 | 3300026089 | Ga0207648_10404454 | Ga0207648_104044542 | 150 |
| 353 | 3300026095 | Ga0207676_10007867 | Ga0207676_100078674 | 150 |
| 354 | 3300026116 | Ga0207674_10087556 | Ga0207674_100875563 | 150 |
| 355 | 3300026116 | Ga0207674_10307914 | Ga0207674_103079142 | 150 |
| 356 | 3300026116 | Ga0207674_10394029 | Ga0207674_103940292 | 150 |
| 357 | 3300026116 | Ga0207674_10400558 | Ga0207674_104005582 | 150 |
| 358 | 3300026142 | Ga0207698_10105894 | Ga0207698_101058942 | 150 |
| 359 | 3300026142 | Ga0207698_10749307 | Ga0207698_107493071 | 150 |
| 360 | 3300026142 | Ga0207698_10999615 | Ga0207698_109996152 | 150 |
| 361 | 3300026142 | Ga0207698_11011503 | Ga0207698_110115032 | 150 |
| 362 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022553 | 150 |
| 363 | 3300028786 | Ga0307517_10035306 | Ga0307517_100353062 | 150 |
| 364 | 3300028800 | Ga0265338_11035185 | Ga0265338_110351851 | 150 |
| 365 | 3300030745 | Ga0316182_1308535 | Ga0316182_13085351 | 150 |
| 366 | 3300031251 | Ga0265327_10123173 | Ga0265327_101231732 | 150 |
| 367 | 3300031456 | Ga0307513_10235409 | Ga0307513_102354092 | 150 |
| 368 | 3300031456 | Ga0307513_10371019 | Ga0307513_103710191 | 150 |
| 369 | 3300031456 | Ga0307513_10480595 | Ga0307513_104805952 | 150 |
| 370 | 3300031507 | Ga0307509_10623807 | Ga0307509_106238071 | 150 |
| 371 | 3300031548 | Ga0307408_100076682 | Ga0307408_1000766822 | 150 |
| 372 | 3300031711 | Ga0265314_10008944 | Ga0265314_100089443 | 150 |
| 373 | 3300031727 | Ga0316576_10681855 | Ga0316576_106818551 | 150 |
| 374 | 3300031730 | Ga0307516_10536883 | Ga0307516_105368831 | 150 |
| 375 | 3300031731 | Ga0307405_10316380 | Ga0307405_103163801 | 150 |
| 376 | 3300031731 | Ga0307405_10759391 | Ga0307405_107593911 | 150 |
| 377 | 3300031731 | Ga0307405_10798462 | Ga0307405_107984622 | 150 |
| 378 | 3300031824 | Ga0307413_10186022 | Ga0307413_101860222 | 150 |
| 379 | 3300031824 | Ga0307413_10599412 | Ga0307413_105994121 | 150 |
| 380 | 3300031852 | Ga0307410_10346822 | Ga0307410_103468222 | 150 |
| 381 | 3300031852 | Ga0307410_10991444 | Ga0307410_109914441 | 150 |
| 382 | 3300031911 | Ga0307412_10023153 | Ga0307412_100231532 | 150 |
| 383 | 3300031911 | Ga0307412_10076349 | Ga0307412_100763492 | 150 |
| 384 | 3300031911 | Ga0307412_10513923 | Ga0307412_105139232 | 150 |
| 385 | 3300032002 | Ga0307416_100311290 | Ga0307416_1003112902 | 150 |
| 386 | 3300032002 | Ga0307416_100661116 | Ga0307416_1006611162 | 150 |
| 387 | 3300032004 | Ga0307414_11019294 | Ga0307414_110192941 | 150 |
| 388 | 3300032005 | Ga0307411_10540412 | Ga0307411_105404122 | 150 |
| 389 | 3300032126 | Ga0307415_100167809 | Ga0307415_1001678092 | 150 |
| 390 | 3300032126 | Ga0307415_100238801 | Ga0307415_1002388012 | 150 |
| 391 | 3300032126 | Ga0307415_101740959 | Ga0307415_1017409591 | 150 |
| 392 | 3300033180 | Ga0307510_10195604 | Ga0307510_101956042 | 150 |
| 393 | 3300035692 | Ga0373935_0770095 | Ga0373935_0770095_241_693 | 150 |
| 394 | 3300037068 | Ga0373925_0096599 | Ga0373925_0096599_58_519 | 150 |
| 395 | 3300037312 | Ga0395899_0316674 | Ga0395899_0316674_551_1003 | 150 |
| 396 | 3300037471 | Ga0395905_0081929 | Ga0395905_0081929_2451_2903 | 150 |
| 397 | 3300037471 | Ga0395905_0082380 | Ga0395905_0082380_2503_2955 | 150 |
| 398 | 3300037471 | Ga0395905_0271644 | Ga0395905_0271644_429_881 | 150 |
| 399 | 3300037471 | Ga0395905_0365844 | Ga0395905_0365844_652_1107 | 150 |
| 400 | 3300038443 | Ga0395901_0078158 | Ga0395901_0078158_2075_2527 | 150 |
| 401 | 3300038443 | Ga0395901_0133979 | Ga0395901_0133979_2115_2567 | 150 |
| 402 | 3300038443 | Ga0395901_1404846 | Ga0395901_1404846_91_543 | 150 |
| 403 | 3300039062 | Ga0400483_118183 | Ga0400483_118183_701_1165 | 150 |
| 404 | 3300039437 | Ga0436365_0451774 | Ga0436365_0451774_384_845 | 150 |
| 405 | 3300039437 | Ga0436365_1683674 | Ga0436365_1683674_548_1000 | 150 |
| 406 | 3300039450 | Ga0436363_1555732 | Ga0436363_1555732_61_513 | 150 |
| 407 | 3300039453 | Ga0436362_1224760 | Ga0436362_1224760_492_944 | 150 |
| 408 | 3300041451 | Ga0451791_0405096 | Ga0451791_0405096_81_542 | 150 |
| 409 | 3300041452 | Ga0451793_0536722 | Ga0451793_0536722_242_703 | 150 |
| 410 | 3300041453 | Ga0451797_0626230 | Ga0451797_0626230_37_498 | 150 |
| 411 | 3300041501 | Ga0451845_0355435 | Ga0451845_0355435_108_560 | 150 |
| 412 | 3300041511 | Ga0451855_0355703 | Ga0451855_0355703_166_618 | 150 |
| 413 | 3300041512 | Ga0451853_1144479 | Ga0451853_1144479_14_466 | 150 |
| 414 | 3300042005 | Ga0439448_0076338 | Ga0439448_0076338_617_1069 | 150 |
| 415 | 3300046453 | Ga0495627_001497 | Ga0495627_001497_9214_9666 | 150 |
| 416 | 3300046460 | Ga0495638_0007575 | Ga0495638_0007575_5489_5941 | 150 |
| 417 | 3300046471 | Ga0495650_0000340 | Ga0495650_0000340_22534_22986 | 150 |
| 418 | 3300046500 | Ga0495596_0052404 | Ga0495596_0052404_1114_1566 | 150 |
| 419 | 3300046506 | Ga0495583_0019131 | Ga0495583_0019131_2592_3044 | 150 |
| 420 | 3300046506 | Ga0495583_0019651 | Ga0495583_0019651_2966_3418 | 150 |
| 421 | 3300046506 | Ga0495583_0034397 | Ga0495583_0034397_1844_2296 | 150 |
| 422 | 3300046506 | Ga0495583_0148538 | Ga0495583_0148538_132_584 | 150 |
| 423 | 3300046507 | Ga0495606_0000824 | Ga0495606_0000824_7239_7691 | 150 |
| 424 | 3300046518 | Ga0495631_0208054 | Ga0495631_0208054_109_561 | 150 |
| 425 | 3300046519 | Ga0495632_0083915 | Ga0495632_0083915_792_1244 | 150 |
| 426 | 3300046520 | Ga0495637_0014507 | Ga0495637_0014507_728_1180 | 150 |
| 427 | 3300046522 | Ga0495643_0008432 | Ga0495643_0008432_2221_2673 | 150 |
| 428 | 3300046522 | Ga0495643_0012592 | Ga0495643_0012592_3282_3734 | 150 |
| 429 | 3300046522 | Ga0495643_0013731 | Ga0495643_0013731_3539_3991 | 150 |
| 430 | 3300046522 | Ga0495643_0051552 | Ga0495643_0051552_1303_1755 | 150 |
| 431 | 3300046522 | Ga0495643_0382958 | Ga0495643_0382958_35_487 | 150 |
| 432 | 3300046522 | Ga0495643_0384346 | Ga0495643_0384346_70_522 | 150 |
| 433 | 3300046522 | Ga0495643_0434514 | Ga0495643_0434514_42_494 | 150 |
| 434 | 3300046524 | Ga0495648_0000303 | Ga0495648_0000303_48458_48919 | 150 |
| 435 | 3300046525 | Ga0495663_0014875 | Ga0495663_0014875_42_494 | 150 |
| 436 | 3300046526 | Ga0495666_0144415 | Ga0495666_0144415_64_516 | 150 |
| 437 | 3300046528 | Ga0495642_0106863 | Ga0495642_0106863_374_826 | 150 |
| 438 | 3300046538 | Ga0495609_0014516 | Ga0495609_0014516_2589_3041 | 150 |
| 439 | 3300046557 | Ga0495622_0032906 | Ga0495622_0032906_929_1381 | 150 |
| 440 | 3300046558 | Ga0495633_0007722 | Ga0495633_0007722_153_605 | 150 |
| 441 | 3300046558 | Ga0495633_0103301 | Ga0495633_0103301_75_536 | 150 |
| 442 | 3300046616 | Ga0495668_0000007 | Ga0495668_0000007_204085_204537 | 150 |
| 443 | 3300046648 | Ga0495611_0150263 | Ga0495611_0150263_223_675 | 150 |
| 444 | 3300046660 | Ga0495625_0001479 | Ga0495625_0001479_25614_26066 | 150 |
| 445 | 3300046660 | Ga0495625_0009233 | Ga0495625_0009233_3598_4050 | 150 |
| 446 | 3300046660 | Ga0495625_0013066 | Ga0495625_0013066_2615_3067 | 150 |
| 447 | 3300046660 | Ga0495625_0025766 | Ga0495625_0025766_126_578 | 150 |
| 448 | 3300046660 | Ga0495625_0144593 | Ga0495625_0144593_627_1088 | 150 |
| 449 | 3300046660 | Ga0495625_0214403 | Ga0495625_0214403_364_816 | 150 |
| 450 | 3300046660 | Ga0495625_0284306 | Ga0495625_0284306_531_983 | 150 |
| 451 | 3300046660 | Ga0495625_0789239 | Ga0495625_0789239_80_532 | 150 |
| 452 | 3300046665 | Ga0495661_0086288 | Ga0495661_0086288_1331_1783 | 150 |
| 453 | 3300046684 | Ga0495669_0000507 | Ga0495669_0000507_16835_17287 | 150 |
| 454 | 3300046691 | Ga0495670_0049902 | Ga0495670_0049902_475_927 | 150 |
| 455 | 3300046691 | Ga0495670_0052447 | Ga0495670_0052447_1487_1939 | 150 |
| 456 | 3300046692 | Ga0495671_0080673 | Ga0495671_0080673_971_1423 | 150 |
| 457 | 3300046692 | Ga0495671_0424616 | Ga0495671_0424616_168_620 | 150 |
| 458 | 3300046809 | Ga0495600_0013303 | Ga0495600_0013303_1947_2399 | 150 |
| 459 | 3300046810 | Ga0495660_0157130 | Ga0495660_0157130_166_618 | 150 |
| 460 | 3300047323 | Ga0495683_0030887 | Ga0495683_0030887_1710_2162 | 150 |
| 461 | 3300047323 | Ga0495683_0204867 | Ga0495683_0204867_304_756 | 150 |
| 462 | 3300047443 | Ga0495687_004439 | Ga0495687_004439_3621_4073 | 150 |
| 463 | 3300047443 | Ga0495687_013793 | Ga0495687_013793_3540_3992 | 150 |
| 464 | 3300047445 | Ga0495677_0006691 | Ga0495677_0006691_3229_3681 | 150 |
| 465 | 3300047470 | Ga0495681_0000011 | Ga0495681_0000011_192161_192613 | 150 |
| 466 | 3300047470 | Ga0495681_0150222 | Ga0495681_0150222_290_742 | 150 |
| 467 | 3300047472 | Ga0495686_0052596 | Ga0495686_0052596_915_1367 | 150 |
| 468 | 3300048905 | Ga0496102_0011729 | Ga0496102_0011729_4101_4553 | 150 |
| 469 | 3300048905 | Ga0496102_1609536 | Ga0496102_1609536_27_485 | 150 |
| 470 | 3300048906 | Ga0496103_0000836 | Ga0496103_0000836_2717_3169 | 150 |
| 471 | 3300048907 | Ga0496104_0033295 | Ga0496104_0033295_1377_1829 | 150 |
| 472 | 3300048908 | Ga0496105_0052177 | Ga0496105_0052177_2814_3266 | 150 |
| 473 | 3300048908 | Ga0496105_0343701 | Ga0496105_0343701_447_899 | 150 |
| 474 | 3300048910 | Ga0496107_0141097 | Ga0496107_0141097_626_1078 | 150 |
| 475 | 3300048913 | Ga0496110_0501370 | Ga0496110_0501370_640_1092 | 150 |
| 476 | 3300048914 | Ga0496111_0007641 | Ga0496111_0007641_905_1357 | 150 |
| 477 | 3300048916 | Ga0496113_1172694 | Ga0496113_1172694_20_487 | 150 |
| 478 | 3300048917 | Ga0496114_0137219 | Ga0496114_0137219_92_544 | 150 |
| 479 | 3300048917 | Ga0496114_0195286 | Ga0496114_0195286_196_648 | 150 |
| 480 | 3300048918 | Ga0496115_0000597 | Ga0496115_0000597_1906_2358 | 150 |
| 481 | 3300048918 | Ga0496115_0002445 | Ga0496115_0002445_10070_10522 | 150 |
| 482 | 3300048919 | Ga0496116_0017799 | Ga0496116_0017799_2966_3418 | 150 |
| 483 | 3300048920 | Ga0496117_0000182 | Ga0496117_0000182_61574_62026 | 150 |
| 484 | 3300048920 | Ga0496117_0179801 | Ga0496117_0179801_17_469 | 150 |
| 485 | 3300048921 | Ga0496118_0000125 | Ga0496118_0000125_66011_66463 | 150 |
| 486 | 3300048921 | Ga0496118_0073182 | Ga0496118_0073182_909_1361 | 150 |
| 487 | 3300048922 | Ga0496119_0010214 | Ga0496119_0010214_5315_5767 | 150 |
| 488 | 3300048923 | Ga0496120_0033907 | Ga0496120_0033907_1055_1507 | 150 |
| 489 | 3300048924 | Ga0496121_0000367 | Ga0496121_0000367_89917_90369 | 150 |
| 490 | 3300048924 | Ga0496121_0007290 | Ga0496121_0007290_2951_3403 | 150 |
| 491 | 3300048924 | Ga0496121_0034537 | Ga0496121_0034537_2082_2534 | 150 |
| 492 | 3300048924 | Ga0496121_0129749 | Ga0496121_0129749_80_532 | 150 |
| 493 | 3300048925 | Ga0496122_0023643 | Ga0496122_0023643_2200_2664 | 150 |
| 494 | 3300048925 | Ga0496122_0036059 | Ga0496122_0036059_2666_3118 | 150 |
| 495 | 3300048926 | Ga0496123_0024694 | Ga0496123_0024694_358_819 | 150 |
| 496 | 3300048926 | Ga0496123_0041016 | Ga0496123_0041016_1189_1641 | 150 |
| 497 | 3300048927 | Ga0496124_0000082 | Ga0496124_0000082_69945_70397 | 150 |
| 498 | 3300048928 | Ga0496125_0002269 | Ga0496125_0002269_5233_5694 | 150 |
| 499 | 3300048929 | Ga0496126_0000221 | Ga0496126_0000221_57735_58187 | 150 |
| 500 | 3300048929 | Ga0496126_0633262 | Ga0496126_0633262_79_531 | 150 |
| 501 | 3300049459 | Ga0495678_226482 | Ga0495678_226482_11_463 | 150 |
| 502 | 3300049573 | Ga0501037_0130539 | Ga0501037_0130539_1110_1634 | 150 |
| 503 | 3300049574 | Ga0501038_0024065 | Ga0501038_0024065_4156_4617 | 150 |
| 504 | 3300049580 | Ga0501046_0356179 | Ga0501046_0356179_422_874 | 150 |
| 505 | 3300049586 | Ga0501070_0582583 | Ga0501070_0582583_395_847 | 150 |
| 506 | 3300049823 | Ga0501044_0327664 | Ga0501044_0327664_914_1366 | 150 |
| 507 | 3300050489 | nmdc:mga03683_7580_c1 | nmdc:mga03683_7580_c1_1337_1789 | 150 |
| 508 | 3300050491 | nmdc:mga00v17_302228_c1 | nmdc:mga00v17_302228_c1_338_790 | 150 |
| 509 | 3300050491 | nmdc:mga00v17_5943_c1 | nmdc:mga00v17_5943_c1_3369_3821 | 150 |
| 510 | 3300050493 | nmdc:mga0k408_53081_c1 | nmdc:mga0k408_53081_c1_1374_1826 | 150 |
| 511 | 3300050496 | nmdc:mga07m45_41377_c1 | nmdc:mga07m45_41377_c1_447_899 | 150 |
| 512 | 3300050516 | nmdc:mga0sz30_18727_c2 | nmdc:mga0sz30_18727_c2_242_694 | 150 |
| 513 | 3300053079 | Ga0500610_0000140 | Ga0500610_0000140_14896_15348 | 150 |
| 514 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_1332111_1332563 | 150 |
| 515 | 3300053087 | Ga0500643_009771 | Ga0500643_009771_2746_3198 | 150 |
| 516 | 3300053087 | Ga0500643_059905 | Ga0500643_059905_243_695 | 150 |
| 517 | 3300053091 | Ga0500647_0253708 | Ga0500647_0253708_150_602 | 150 |
| 518 | 3300053093 | Ga0500651_0497353 | Ga0500651_0497353_75_527 | 150 |
| 519 | 3300053096 | Ga0500641_0040456 | Ga0500641_0040456_466_918 | 150 |
| 520 | 3300053103 | Ga0500555_002842 | Ga0500555_002842_379_840 | 150 |
| 521 | 3300053108 | Ga0500562_011833 | Ga0500562_011833_1061_1513 | 150 |
| 522 | 3300053108 | Ga0500562_070644 | Ga0500562_070644_442_894 | 150 |
| 523 | 3300053119 | Ga0500595_010172 | Ga0500595_010172_267_719 | 150 |
| 524 | 3300053130 | Ga0500642_0000804 | Ga0500642_0000804_5860_6312 | 150 |
| 525 | 3300053136 | Ga0500559_0103072 | Ga0500559_0103072_308_760 | 150 |
| 526 | 3300053136 | Ga0500559_0183075 | Ga0500559_0183075_290_742 | 150 |
| 527 | 3300053136 | Ga0500559_0322299 | Ga0500559_0322299_62_514 | 150 |
| 528 | 3300053153 | Ga0500616_0007018 | Ga0500616_0007018_2154_2606 | 150 |
| 529 | 3300053153 | Ga0500616_0081604 | Ga0500616_0081604_582_1034 | 150 |
| 530 | 3300053153 | Ga0500616_0133312 | Ga0500616_0133312_481_933 | 150 |
| 531 | 3300053154 | Ga0500619_176045 | Ga0500619_176045_206_658 | 150 |
| 532 | 3300053177 | Ga0500636_0088068 | Ga0500636_0088068_364_816 | 150 |
| 533 | 3300053730 | Ga0500645_000080 | Ga0500645_000080_29174_29635 | 150 |
| 534 | 3300053730 | Ga0500645_142269 | Ga0500645_142269_116_568 | 150 |
| 535 | 3300053735 | Ga0500596_004831 | Ga0500596_004831_272_724 | 150 |
| 536 | 3300055283 | Ga0500661_026348 | Ga0500661_026348_491_943 | 150 |
| 537 | 3300055283 | Ga0500661_085737 | Ga0500661_085737_45_497 | 150 |
| 538 | 3300059623 | Ga0587101_048128 | Ga0587101_048128_181_645 | 150 |
| 539 | 3300060346 | Ga0587111_0089978 | Ga0587111_0089978_120_584 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ng6-assembly1.cif.gz_A | structure of cytosolic protein of unknown function yqey from bacillus subtilis | 0.774 | 4 | 150 |
| 1ng6-assembly1.cif.gz_A | structure of cytosolic protein of unknown function yqey from bacillus subtilis | 0.7515 | 4 | 150 |
| 7dgu-assembly1.cif.gz_A | de novo designed protein h4a1r | 0.5093 | 2 | 92 |
| 4uer-assembly1.cif.gz_a | 40s-eif1-eif1a-eif3-eif3j translation initiation complex from lachancea kluyveri | 0.4453 | 6 | 109 |
| 7dgu-assembly1.cif.gz_A | de novo designed protein h4a1r | 0.4359 | 2 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6Y4B8_28_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9274 | 1 | 93 | 1.10.1510.10 |
| af_C6Y4B8_28_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9174 | 1 | 93 | 1.10.1510.10 |
| af_Q12032_29_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.917 | 4 | 93 | 1.10.1510.10 |
| 1ng6A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9117 | 94 | 150 | 1.10.10.410 |
| af_Q12032_29_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.8977 | 4 | 93 | 1.10.1510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A653J3S8-F1-model_v4 | GatB protein | 0.9771 | 1 | 150 |
GO:0016884
|
| AF-A0A3D1U4K6-F1-model_v4 | Glutamyl-tRNA amidotransferase | 0.9377 | 2 | 150 |
GO:0016740
GO:0016884 |
| AF-A0A6J4BTS0-F1-model_v4 | Aspartyl-tRNA amidotransferase | 0.9307 | 1 | 150 |
GO:0016740
GO:0016884 |
| AF-A0A502FIE2-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9287 | 1 | 150 |
GO:0016884
|
| AF-A0A7C1DUB5-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9282 | 1 | 150 |
GO:0016884
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar