F460987

General Info

Members Datasets Scaffolds Average Seq Length
538 264 1076 378

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100027345|Ga0070707_1000273454
Length 372
Sequence VRFEIQTKDSRTRARRGRLHTPHGVVETPIFMPVGTQATVKSMTPDQLRDLNVEILLCNSYHLFLRPGHDTVARLGGLHRFMAWDRPILTDSGGYQVFSLSSLRNISDDGVKFQSHLDGSPHFLSPEIAIDVQLALGSDIMMILDDCLAYPASQFETEKSMNRSLVWADRCKNHFDAVDSPNSLFGIVQGGIYHDLRKESAERLIAMNFPGYAIGGLAVGEPKPLMYEVIDQLEPHLPQEKPRYLMGVGTPADLVEAVALGVDMFDCVMPTRHARNGWLFTRDGHIVIKHAKYKDDGAPIDSNCGCVVCQTYSRAYLRHLFIANEILSSVLNTIHNLYFYLDMIRRIRQFIEFHRFEDLLTETRKAGITPAR

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
210 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
211 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
212 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
215 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
216 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
217 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
218 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
223 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
234 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
242 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
243 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
244 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
247 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
248 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 2738541278 Niastella sp. CF465 Isolate Unclassified
254 2818991444 Filimonas endophytica 3197 Isolate Unclassified
255 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
256 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
257 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
258 2914759650 Rhizosphaericola mali Isolate Rhizosphere
259 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
260 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
261 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
262 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
263 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
264 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.36
Nodule 0
Rhizoplane 0.74
Rhizosphere 85.13
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100027345 3300005468 Bacteria 5427
2 SwRhRL2b_contig_1886170 2162886007 Bacteria 206362
3 JGI25154J39366_1000004 3300002738 Bacteria 346460
4 JGI25406J46586_10018576 3300003203 Bacteria 2855
5 JGI25153J46596_10000224 3300003215 Bacteria 48671
6 JGI25153J46596_10018443 3300003215 Bacteria 2710
7 rootH1_10110809 3300003316 Bacteria 4708
8 rootL2_10069444 3300003322 Bacteria 5571
9 rootL2_10072575 3300003322 Bacteria 2909
10 rootH1_10006409 3300003323 Bacteria 43159
11 rootH1_10017832 3300003323 Bacteria 13579
12 rootH1_10173670 3300003323 Bacteria 8287
13 rootH1_10203735 3300003323 Bacteria 11065
14 Ga0055528_1000355 3300003790 Bacteria 37201
15 Ga0055530_10000425 3300003791 Bacteria 37501
16 Ga0055531_10000411 3300003794 Bacteria 41180
17 Ga0065165_1000148 3300005262 Bacteria 122640
18 Ga0065704_10070159 3300005289 Bacteria 207348
19 Ga0065712_10019540 3300005290 Bacteria 1497
20 Ga0070658_10033087 3300005327 Bacteria 4158
21 Ga0070658_10088276 3300005327 Bacteria 2553
22 Ga0070658_10210866 3300005327 Bacteria 1641
23 Ga0070676_10003990 3300005328 Bacteria 7746
24 Ga0070683_100001238 3300005329 Bacteria 19432
25 Ga0070683_100046488 3300005329 Bacteria 4010
26 Ga0070683_100210349 3300005329 Bacteria 1848
27 Ga0070670_100001148 3300005331 Bacteria 21016
28 Ga0070670_100277963 3300005331 Bacteria 1462
29 Ga0070666_10001301 3300005335 Bacteria 15111
30 Ga0070666_10007735 3300005335 Bacteria 6635
31 Ga0070682_100000039 3300005337 Bacteria 144400
32 Ga0070682_100004056 3300005337 Bacteria 8137
33 Ga0070682_100052649 3300005337 Bacteria 2548
34 Ga0070682_100088048 3300005337 Bacteria 2026
35 Ga0068868_100017008 3300005338 Bacteria 5411
36 Ga0068868_100019000 3300005338 Bacteria 5144
37 Ga0068868_100076415 3300005338 Bacteria 2677
38 Ga0070660_100003380 3300005339 Bacteria 10980
39 Ga0070660_100030689 3300005339 Bacteria 4033
40 Ga0070660_100119060 3300005339 Bacteria 2106
41 Ga0070689_100043882 3300005340 Bacteria 3439
42 Ga0070689_100220763 3300005340 Bacteria 1555
43 Ga0070691_10005553 3300005341 Bacteria 5739
44 Ga0070691_10022587 3300005341 Bacteria 2919
45 Ga0070661_100005250 3300005344 Bacteria 8917
46 Ga0070661_100006927 3300005344 Bacteria 7823
47 Ga0070668_100040857 3300005347 Bacteria 3551
48 Ga0070669_100166853 3300005353 Bacteria 1714
49 Ga0070675_100008200 3300005354 Bacteria 8104
50 Ga0070675_100089042 3300005354 Bacteria 2583
51 Ga0070671_100028128 3300005355 Bacteria 4629
52 Ga0070671_100062191 3300005355 Bacteria 3109
53 Ga0070674_100072291 3300005356 Bacteria 2442
54 Ga0070673_100001737 3300005364 Bacteria 12969
55 Ga0070673_100013460 3300005364 Bacteria 5659
56 Ga0070673_100015361 3300005364 Bacteria 5376
57 Ga0070688_100188857 3300005365 Bacteria 1434
58 Ga0070659_100025770 3300005366 Bacteria 4522
59 Ga0070667_100000718 3300005367 Bacteria 31876
60 Ga0070667_100156137 3300005367 Bacteria 2007
61 Ga0070700_100055422 3300005441 Bacteria 2481
62 Ga0070708_100150936 3300005445 Bacteria 2161
63 Ga0070663_100114979 3300005455 Bacteria 2026
64 Ga0070678_100006728 3300005456 Bacteria 6770
65 Ga0070678_100078413 3300005456 Bacteria 2495
66 Ga0070681_10039631 3300005458 Bacteria 4722
67 Ga0070681_10056780 3300005458 Bacteria 3895
68 Ga0070681_10177440 3300005458 Bacteria 2052
69 Ga0068867_100001523 3300005459 Bacteria 16072
70 Ga0068867_100003218 3300005459 Bacteria 11512
71 Ga0068867_100073573 3300005459 Bacteria 2559
72 Ga0068867_100146468 3300005459 Bacteria 1851
73 Ga0068867_100165056 3300005459 Bacteria 1749
74 Ga0070679_100001124 3300005530 Bacteria 23362
75 Ga0070679_100018133 3300005530 Bacteria 6824
76 Ga0070684_100004827 3300005535 Bacteria 10298
77 Ga0070684_100030813 3300005535 Bacteria 4562
78 Ga0068853_100011683 3300005539 Bacteria 7137
79 Ga0068853_100017878 3300005539 Bacteria 5858
80 Ga0068853_100047765 3300005539 Bacteria 3674
81 Ga0068853_100107422 3300005539 Bacteria 2474
82 Ga0068853_100328430 3300005539 Bacteria 1419
83 Ga0070672_100001763 3300005543 Bacteria 13529
84 Ga0070672_100097622 3300005543 Bacteria 2378
85 Ga0070672_100306989 3300005543 Bacteria 1346
86 Ga0070686_100002769 3300005544 Bacteria 9657
87 Ga0070686_100211984 3300005544 Bacteria 1395
88 Ga0070693_100004404 3300005547 Bacteria 6658
89 Ga0068855_100000210 3300005563 Bacteria 74786
90 Ga0068855_100030429 3300005563 Bacteria 6458
91 Ga0068855_100036149 3300005563 Bacteria 5881
92 Ga0068855_100446372 3300005563 Bacteria 1412
93 Ga0070664_100000094 3300005564 Bacteria 57212
94 Ga0070664_100014873 3300005564 Bacteria 6350
95 Ga0070664_100018853 3300005564 Bacteria 5673
96 Ga0068857_100001139 3300005577 Bacteria 20729
97 Ga0068857_100003724 3300005577 Bacteria 12796
98 Ga0068857_100007529 3300005577 Bacteria 9369
99 Ga0068857_100129428 3300005577 Bacteria 2276
100 Ga0068857_100309668 3300005577 Bacteria 1457
101 Ga0068854_100089500 3300005578 Bacteria 2287
102 Ga0068854_100101248 3300005578 Bacteria 2160
103 Ga0068856_100002822 3300005614 Bacteria 17786
104 Ga0068856_100085700 3300005614 Bacteria 3129
105 Ga0068856_100085888 3300005614 Bacteria 3126
106 Ga0068852_100006664 3300005616 Bacteria 8369
107 Ga0068852_100020044 3300005616 Bacteria 5310
108 Ga0068852_100059892 3300005616 Bacteria 3304
109 Ga0068852_100070886 3300005616 Bacteria 3059
110 Ga0068859_100000035 3300005617 Bacteria 169846
111 Ga0068859_100002181 3300005617 Bacteria 19881
112 Ga0068859_100006691 3300005617 Bacteria 11705
113 Ga0068859_100053831 3300005617 Bacteria 4047
114 Ga0068859_100125655 3300005617 Bacteria 2634
115 Ga0068864_100014629 3300005618 Bacteria 6518
116 Ga0068864_100024578 3300005618 Bacteria 5069
117 Ga0068864_100035063 3300005618 Bacteria 4270
118 Ga0068864_100169276 3300005618 Bacteria 1991
119 Ga0068866_10023134 3300005718 Bacteria 2886
120 Ga0068851_10017036 3300005834 Bacteria 3485
121 Ga0068863_100000284 3300005841 Bacteria 52416
122 Ga0068863_100018942 3300005841 Bacteria 6588
123 Ga0068863_100035776 3300005841 Bacteria 4728
124 Ga0068863_100053103 3300005841 Bacteria 3840
125 Ga0068863_100087231 3300005841 Bacteria 2956
126 Ga0068858_100004864 3300005842 Bacteria 13174
127 Ga0068858_100016448 3300005842 Bacteria 6946
128 Ga0068860_100000004 3300005843 Bacteria 506126
129 Ga0068860_100003394 3300005843 Bacteria 16385
130 Ga0068860_100003442 3300005843 Bacteria 16284
131 Ga0068860_100049431 3300005843 Bacteria 4005
132 Ga0068860_100068572 3300005843 Bacteria 3370
133 Ga0081540_1085388 3300005983 Bacteria 1406
134 Ga0081539_10000037 3300005985 Bacteria 296160
135 Ga0075366_10090499 3300006195 Bacteria 1832
136 Ga0097621_100021477 3300006237 Bacteria 4995
137 Ga0097621_100058794 3300006237 Bacteria 3146
138 Ga0097621_100105717 3300006237 Bacteria 2374
139 Ga0068871_100003140 3300006358 Bacteria 11342
140 Ga0068871_100018729 3300006358 Bacteria 5272
141 Ga0068871_100027799 3300006358 Bacteria 4428
142 Ga0068871_100048263 3300006358 Bacteria 3436
143 Ga0068871_100130322 3300006358 Bacteria 2132
144 Ga0097620_100000035 3300006931 Bacteria 169846
145 Ga0097620_100002181 3300006931 Bacteria 19881
146 Ga0097620_100006691 3300006931 Bacteria 11705
147 Ga0097620_100053827 3300006931 Bacteria 4047
148 Ga0097620_100125660 3300006931 Bacteria 2634
149 Ga0105240_10002773 3300009093 Bacteria 27676
150 Ga0105240_10003397 3300009093 Bacteria 24765
151 Ga0105240_10004711 3300009093 Bacteria 20598
152 Ga0105240_10006456 3300009093 Bacteria 17233
153 Ga0105240_10020111 3300009093 Bacteria 8911
154 Ga0105240_10053237 3300009093 Bacteria 5082
155 Ga0105240_10067674 3300009093 Bacteria 4427
156 Ga0105240_10096401 3300009093 Bacteria 3604
157 Ga0111539_10025919 3300009094 Bacteria 7178
158 Ga0105247_10016667 3300009101 Bacteria 4406
159 Ga0114129_10056351 3300009147 Bacteria 5505
160 Ga0114129_10416728 3300009147 Bacteria 1767
161 Ga0105241_10001925 3300009174 Bacteria 15714
162 Ga0105241_10006406 3300009174 Bacteria 8676
163 Ga0105242_10034702 3300009176 Bacteria 4044
164 Ga0105248_10000605 3300009177 Bacteria 40854
165 Ga0105237_10000769 3300009545 Bacteria 43902
166 Ga0105237_10002457 3300009545 Bacteria 23008
167 Ga0105237_10008643 3300009545 Bacteria 11004
168 Ga0105237_10013544 3300009545 Bacteria 8546
169 Ga0105237_10062115 3300009545 Bacteria 3735
170 Ga0105237_10091455 3300009545 Bacteria 3032
171 Ga0105238_10004009 3300009551 Bacteria 14610
172 Ga0105238_10023913 3300009551 Bacteria 6228
173 Ga0105249_10001414 3300009553 Bacteria 20992
174 Ga0105249_10021951 3300009553 Bacteria 5717
175 Ga0105249_10499265 3300009553 Bacteria 1262
176 Ga0105239_10000029 3300010375 Bacteria 234749
177 Ga0105239_10000606 3300010375 Bacteria 51062
178 Ga0105239_10001999 3300010375 Bacteria 26499
179 Ga0105239_10002549 3300010375 Bacteria 23115
180 Ga0105239_10005380 3300010375 Bacteria 15037
181 Ga0105239_10016570 3300010375 Bacteria 8146
182 Ga0105239_10022019 3300010375 Bacteria 7026
183 Ga0105239_10032586 3300010375 Bacteria 5726
184 Ga0105239_10050939 3300010375 Bacteria 4540
185 Ga0105239_10132263 3300010375 Bacteria 2776
186 Ga0105246_10002396 3300011119 Bacteria 11315
187 Ga0157373_10009312 3300013100 Bacteria 7261
188 Ga0157373_10011582 3300013100 Bacteria 6478
189 Ga0157373_10107608 3300013100 Bacteria 1960
190 Ga0157371_10030971 3300013102 Bacteria 3856
191 Ga0157371_10057733 3300013102 Bacteria 2753
192 Ga0157371_10173194 3300013102 Bacteria 1542
193 Ga0157370_10001941 3300013104 Bacteria 25465
194 Ga0157370_10027949 3300013104 Bacteria 5556
195 Ga0157370_10037677 3300013104 Bacteria 4686
196 Ga0157370_10156514 3300013104 Bacteria 2120
197 Ga0157369_10014995 3300013105 Bacteria 8747
198 Ga0157369_10208910 3300013105 Bacteria 2047
199 Ga0157374_10000001 3300013296 Bacteria 1077351
200 Ga0157374_10035170 3300013296 Bacteria 4582
201 Ga0157374_10190713 3300013296 Bacteria 2005
202 Ga0157378_10002213 3300013297 Bacteria 17244
203 Ga0157378_10012724 3300013297 Bacteria 7362
204 Ga0157378_10053865 3300013297 Bacteria 3582
205 Ga0157378_10323627 3300013297 Bacteria 1498
206 Ga0163162_10000333 3300013306 Bacteria 43185
207 Ga0163162_10001306 3300013306 Bacteria 23316
208 Ga0163162_10002251 3300013306 Bacteria 18116
209 Ga0163162_10004691 3300013306 Bacteria 13180
210 Ga0163162_10008316 3300013306 Bacteria 10124
211 Ga0163162_10013610 3300013306 Bacteria 7947
212 Ga0163162_10022863 3300013306 Bacteria 6165
213 Ga0163162_10061534 3300013306 Bacteria 3792
214 Ga0163162_10334911 3300013306 Bacteria 1646
215 Ga0157372_10000535 3300013307 Bacteria 41817
216 Ga0157372_10002089 3300013307 Bacteria 21710
217 Ga0157372_10020369 3300013307 Bacteria 7154
218 Ga0157372_10039517 3300013307 Bacteria 5208
219 Ga0157372_10041980 3300013307 Bacteria 5058
220 Ga0157372_10128645 3300013307 Bacteria 2912
221 Ga0157372_10129000 3300013307 Bacteria 2908
222 Ga0157372_10237342 3300013307 Bacteria 2115
223 Ga0157372_10255527 3300013307 Bacteria 2034
224 Ga0157372_10516173 3300013307 Bacteria 1393
225 Ga0157375_10008654 3300013308 Bacteria 8916
226 Ga0157375_10052345 3300013308 Bacteria 4013
227 Ga0157375_10078459 3300013308 Bacteria 3335
228 Ga0157375_10139228 3300013308 Bacteria 2553
229 Ga0157375_10224135 3300013308 Bacteria 2039
230 Ga0157375_10439660 3300013308 Bacteria 1470
231 Ga0163163_10000610 3300014325 Bacteria 31130
232 Ga0163163_10014951 3300014325 Bacteria 7152
233 Ga0163163_10019409 3300014325 Bacteria 6386
234 Ga0163163_10054845 3300014325 Bacteria 3939
235 Ga0163163_10108946 3300014325 Bacteria 2797
236 Ga0163163_10237846 3300014325 Bacteria 1871
237 Ga0157379_10091338 3300014968 Bacteria 2731
238 Ga0157376_10005368 3300014969 Bacteria 8954
239 Ga0157376_10007810 3300014969 Bacteria 7667
240 Ga0157376_10052696 3300014969 Bacteria 3384
241 Ga0157376_10104668 3300014969 Bacteria 2480
242 Ga0157376_10115063 3300014969 Bacteria 2374
243 Ga0163161_10094213 3300017792 Bacteria 2220
244 Ga0163161_10246837 3300017792 Bacteria 1390
245 Ga0213876_10001135 3300021384 Bacteria 16968
246 Ga0213876_10008319 3300021384 Bacteria 5613
247 Ga0213876_10084913 3300021384 Bacteria 1675
248 Ga0209258_100075 3300025242 Bacteria 270751
249 Ga0209646_1000025 3300025246 Bacteria 406493
250 Ga0209026_1000312 3300025250 Bacteria 52141
251 Ga0209148_1000085 3300025254 Bacteria 265193
252 Ga0209673_1000197 3300025273 Bacteria 121313
253 Ga0209564_1002016 3300025295 Bacteria 17679
254 Ga0209758_1008066 3300025297 Bacteria 6944
255 Ga0209758_1013571 3300025297 Bacteria 4426
256 Ga0209050_1000204 3300025298 Bacteria 133087
257 Ga0207426_1000019 3300025302 Bacteria 558579
258 Ga0207426_1000332 3300025302 Bacteria 89192
259 Ga0209257_1000004 3300025304 Bacteria 1678347
260 Ga0209257_1003489 3300025304 Bacteria 13396
261 Ga0207688_10021530 3300025901 Bacteria 3524
262 Ga0207680_10000133 3300025903 Bacteria 34979
263 Ga0207647_10001026 3300025904 Bacteria 21697
264 Ga0207647_10009021 3300025904 Bacteria 7104
265 Ga0207645_10000245 3300025907 Bacteria 45135
266 Ga0207643_10003965 3300025908 Bacteria 7968
267 Ga0207705_10140118 3300025909 Bacteria 1806
268 Ga0207654_10000493 3300025911 Bacteria 22608
269 Ga0207654_10001439 3300025911 Bacteria 12621
270 Ga0207707_10000121 3300025912 Bacteria 80174
271 Ga0207707_10118266 3300025912 Bacteria 2317
272 Ga0207695_10000057 3300025913 Bacteria 376090
273 Ga0207695_10000092 3300025913 Bacteria 270514
274 Ga0207695_10000568 3300025913 Bacteria 75553
275 Ga0207695_10001216 3300025913 Bacteria 44107
276 Ga0207695_10009568 3300025913 Bacteria 11975
277 Ga0207695_10020873 3300025913 Bacteria 7485
278 Ga0207671_10000725 3300025914 Bacteria 41972
279 Ga0207671_10000832 3300025914 Bacteria 39197
280 Ga0207671_10002783 3300025914 Bacteria 18250
281 Ga0207671_10005217 3300025914 Bacteria 12078
282 Ga0207671_10009985 3300025914 Bacteria 7885
283 Ga0207671_10062438 3300025914 Bacteria 2766
284 Ga0207671_10063394 3300025914 Bacteria 2746
285 Ga0207660_10000354 3300025917 Bacteria 29872
286 Ga0207660_10025838 3300025917 Bacteria 3992
287 Ga0207657_10006314 3300025919 Bacteria 12314
288 Ga0207657_10050682 3300025919 Bacteria 3612
289 Ga0207649_10007338 3300025920 Bacteria 6001
290 Ga0207649_10012951 3300025920 Bacteria 4647
291 Ga0207649_10034015 3300025920 Bacteria 3050
292 Ga0207652_10000561 3300025921 Bacteria 37514
293 Ga0207652_10063790 3300025921 Bacteria 3187
294 Ga0207646_10002455 3300025922 Bacteria 21894
295 Ga0207681_10015434 3300025923 Bacteria 4763
296 Ga0207681_10105413 3300025923 Bacteria 2041
297 Ga0207681_10232752 3300025923 Bacteria 1431
298 Ga0207694_10049453 3300025924 Bacteria 3255
299 Ga0207694_10050387 3300025924 Bacteria 3224
300 Ga0207650_10000352 3300025925 Bacteria 44284
301 Ga0207650_10000628 3300025925 Bacteria 28146
302 Ga0207650_10061327 3300025925 Bacteria 2808
303 Ga0207650_10092250 3300025925 Bacteria 2316
304 Ga0207650_10164870 3300025925 Bacteria 1758
305 Ga0207650_10326635 3300025925 Bacteria 1257
306 Ga0207659_10065524 3300025926 Bacteria 2633
307 Ga0207659_10291073 3300025926 Bacteria 1338
308 Ga0207644_10030754 3300025931 Bacteria 3737
309 Ga0207644_10294866 3300025931 Bacteria 1305
310 Ga0207690_10024842 3300025932 Bacteria 3756
311 Ga0207706_10003545 3300025933 Bacteria 14896
312 Ga0207686_10028624 3300025934 Bacteria 3277
313 Ga0207670_10036401 3300025936 Bacteria 3200
314 Ga0207670_10073499 3300025936 Bacteria 2371
315 Ga0207670_10087581 3300025936 Bacteria 2194
316 Ga0207691_10006183 3300025940 Bacteria 11570
317 Ga0207691_10012868 3300025940 Bacteria 8009
318 Ga0207691_10023276 3300025940 Bacteria 5831
319 Ga0207691_10026632 3300025940 Bacteria 5425
320 Ga0207691_10104437 3300025940 Bacteria 2525
321 Ga0207711_10007400 3300025941 Bacteria 9187
322 Ga0207689_10000344 3300025942 Bacteria 43532
323 Ga0207689_10002162 3300025942 Bacteria 18494
324 Ga0207689_10058886 3300025942 Bacteria 3160
325 Ga0207689_10099341 3300025942 Bacteria 2391
326 Ga0207661_10000620 3300025944 Bacteria 22786
327 Ga0207661_10001341 3300025944 Bacteria 16523
328 Ga0207661_10103952 3300025944 Bacteria 2391
329 Ga0207679_10000683 3300025945 Bacteria 22726
330 Ga0207679_10034357 3300025945 Bacteria 3576
331 Ga0207679_10038161 3300025945 Unclassified 3420
332 Ga0207667_10000246 3300025949 Bacteria 76379
333 Ga0207667_10038930 3300025949 Bacteria 5071
334 Ga0207667_10055813 3300025949 Bacteria 4151
335 Ga0207651_10045889 3300025960 Bacteria 2934
336 Ga0207651_10047686 3300025960 Bacteria 2891
337 Ga0207651_10191892 3300025960 Bacteria 1630
338 Ga0207712_10003110 3300025961 Bacteria 10587
339 Ga0207668_10031227 3300025972 Bacteria 3506
340 Ga0207640_10079709 3300025981 Bacteria 2233
341 Ga0207658_10022728 3300025986 Bacteria 4368
342 Ga0207658_10118244 3300025986 Bacteria 2108
343 Ga0207658_10319304 3300025986 Bacteria 1344
344 Ga0207703_10003019 3300026035 Bacteria 14263
345 Ga0207703_10199198 3300026035 Bacteria 1779
346 Ga0207639_10000970 3300026041 Bacteria 19495
347 Ga0207639_10005235 3300026041 Bacteria 8748
348 Ga0207639_10012745 3300026041 Bacteria 5865
349 Ga0207639_10029529 3300026041 Bacteria 4015
350 Ga0207639_10101174 3300026041 Bacteria 2330
351 Ga0207639_10268218 3300026041 Bacteria 1496
352 Ga0207641_10000043 3300026088 Bacteria 186340
353 Ga0207641_10006948 3300026088 Bacteria 9473
354 Ga0207641_10022784 3300026088 Bacteria 5156
355 Ga0207641_10114344 3300026088 Bacteria 2398
356 Ga0207648_10004405 3300026089 Bacteria 14463
357 Ga0207648_10040122 3300026089 Bacteria 4114
358 Ga0207648_10178346 3300026089 Bacteria 1880
359 Ga0207648_10249022 3300026089 Bacteria 1584
360 Ga0207676_10070697 3300026095 Bacteria 2800
361 Ga0207676_10083307 3300026095 Bacteria 2604
362 Ga0207674_10006324 3300026116 Bacteria 13953
363 Ga0207674_10021677 3300026116 Bacteria 6917
364 Ga0207674_10085776 3300026116 Bacteria 3143
365 Ga0207675_100031854 3300026118 Bacteria 4912
366 Ga0207675_100059256 3300026118 Bacteria 3573
367 Ga0207675_100214645 3300026118 Bacteria 1852
368 Ga0207683_10007492 3300026121 Bacteria 9356
369 Ga0207683_10125839 3300026121 Bacteria 2303
370 Ga0207698_10020901 3300026142 Bacteria 4516
371 Ga0207698_10040592 3300026142 Bacteria 3460
372 Ga0207698_10053438 3300026142 Bacteria 3101
373 Ga0207698_10185563 3300026142 Bacteria 1847
374 Ga0207698_10325750 3300026142 Bacteria 1441
375 Ga0268266_10110735 3300028379 Bacteria 2432
376 Ga0268264_10000011 3300028381 Bacteria 580884
377 Ga0268264_10001289 3300028381 Bacteria 23664
378 Ga0268264_10006705 3300028381 Bacteria 9678
379 Ga0268264_10052819 3300028381 Bacteria 3389
380 Ga0268264_10055492 3300028381 Bacteria 3310
381 Ga0307517_10190825 3300028786 Bacteria 1301
382 Ga0307515_10000001 3300028794 Bacteria 4259510
383 Ga0307515_10000036 3300028794 Bacteria 332188
384 Ga0265338_10149558 3300028800 Bacteria 1816
385 Ga0307511_10000734 3300030521 Bacteria 34994
386 Ga0265327_10000159 3300031251 Bacteria 145537
387 Ga0265327_10000168 3300031251 Bacteria 141392
388 Ga0265327_10000486 3300031251 Bacteria 69971
389 Ga0265327_10064266 3300031251 Bacteria 1860
390 Ga0307513_10048708 3300031456 Bacteria 4596
391 Ga0307516_10002940 3300031730 Bacteria 22319
392 Ga0307410_10105309 3300031852 Bacteria 2030
393 Ga0307412_10062306 3300031911 Bacteria 2511
394 Ga0307414_10010515 3300032004 Bacteria 5376
395 Ga0307414_10086069 3300032004 Bacteria 2318
396 Ga0307510_10006641 3300033180 Bacteria 13799
397 Ga0373953_0141994 3300035117 Bacteria 1027
398 Ga0373937_0008637 3300036401 Bacteria 8851
399 Ga0373937_0028676 3300036401 Bacteria 5039
400 Ga0373937_0112891 3300036401 Bacteria 2528
401 Ga0316584_0001213 3300036712 Bacteria 15236
402 Ga0395900_0225438 3300037418 Bacteria 1887
403 Ga0395905_0000424 3300037471 Bacteria 58940
404 Ga0436365_0722843 3300039437 Bacteria 20827
405 Ga0436365_1318181 3300039437 Bacteria 2761
406 Ga0436365_1777169 3300039437 Bacteria 24248
407 Ga0451791_1423946 3300041451 Bacteria 1293
408 Ga0439449_0011507 3300042007 Bacteria 3328
409 Ga0439457_000194 3300042014 Bacteria 16029
410 Ga0439462_0018362 3300042015 Bacteria 1816
411 Ga0466969_0000235 3300044656 Bacteria 30219
412 Ga0466972_0000017 3300044658 Bacteria 199884
413 Ga0466966_0000280 3300044684 Bacteria 33412
414 Ga0466964_0067507 3300044706 Bacteria 1504
415 Ga0453684_0240750 3300044712 Bacteria 2083
416 Ga0453684_0291370 3300044712 Bacteria 1858
417 Ga0466971_0028510 3300044719 Bacteria 2498
418 Ga0466968_0015168 3300044735 Bacteria 3052
419 Ga0466970_0001553 3300044765 Bacteria 11067
420 Ga0466957_0000047 3300044842 Bacteria 45485
421 Ga0466957_0037287 3300044842 Bacteria 2927
422 Ga0466960_0013865 3300044901 Bacteria 3434
423 Ga0466959_0000015 3300045049 Bacteria 149242
424 Ga0466959_0008407 3300045049 Bacteria 7296
425 Ga0495627_003275 3300046453 Bacteria 7250
426 Ga0495592_0004044 3300046454 Bacteria 10661
427 Ga0495638_0000001 3300046460 Bacteria 1114121
428 Ga0495582_0083600 3300046473 Bacteria 1774
429 Ga0495664_0138302 3300046477 Bacteria 1476
430 Ga0495606_0012333 3300046507 Bacteria 6868
431 Ga0495633_0000017 3300046558 Bacteria 249973
432 Ga0495667_0003616 3300046559 Bacteria 10397
433 Ga0495668_0010673 3300046616 Bacteria 5549
434 Ga0495634_0102450 3300046642 Bacteria 1849
435 Ga0495657_0003157 3300046675 Bacteria 13582
436 Ga0495613_0007286 3300046689 Bacteria 8237
437 Ga0495636_0000018 3300047318 Bacteria 77559
438 Ga0495674_0109669 3300047319 Bacteria 2341
439 Ga0495674_0151573 3300047319 Bacteria 1943
440 Ga0495684_0163728 3300047471 Bacteria 1658
441 Ga0495686_0000094 3300047472 Bacteria 187720
442 Ga0496101_0047341 3300048904 Bacteria 3087
443 Ga0496114_0001487 3300048917 Bacteria 17788
444 Ga0496115_0003476 3300048918 Bacteria 11330
445 Ga0496126_0016487 3300048929 Bacteria 7384
446 Ga0501033_0009322 3300049570 Bacteria 7560
447 Ga0501033_0107302 3300049570 Bacteria 2034
448 Ga0501034_0000002 3300049571 Bacteria 565510
449 Ga0501034_0003274 3300049571 Bacteria 18491
450 Ga0501034_0029353 3300049571 Bacteria 5589
451 Ga0501034_0102393 3300049571 Bacteria 2857
452 Ga0501034_0123572 3300049571 Bacteria 2574
453 Ga0501034_0175767 3300049571 Bacteria 2107
454 Ga0501036_0027216 3300049572 Bacteria 4830
455 Ga0501037_0026355 3300049573 Bacteria 4296
456 Ga0501043_0042881 3300049579 Bacteria 3556
457 Ga0501043_0166977 3300049579 Bacteria 1718
458 Ga0501046_0024101 3300049580 Bacteria 4997
459 Ga0501046_0259793 3300049580 Bacteria 1276
460 Ga0501047_0017969 3300049581 Bacteria 6778
461 Ga0501047_0066686 3300049581 Bacteria 3470
462 Ga0501047_0110478 3300049581 Bacteria 2632
463 Ga0501047_0163601 3300049581 Bacteria 2096
464 Ga0501071_0054915 3300049587 Bacteria 2875
465 Ga0501072_0126328 3300049588 Bacteria 2038
466 Ga0501198_003484 3300049649 Bacteria 2151
467 Ga0501201_001571 3300049651 Bacteria 2124
468 Ga0501206_000657 3300049653 Bacteria 4182
469 Ga0501216_017825 3300049660 Bacteria 1217
470 Ga0501217_002130 3300049661 Bacteria 3845
471 Ga0501217_040139 3300049661 Bacteria 1188
472 Ga0501223_001352 3300049663 Bacteria 5680
473 Ga0501224_001254 3300049664 Bacteria 3346
474 Ga0501235_003416 3300049669 Bacteria 3438
475 Ga0501257_029068 3300049686 Bacteria 1328
476 Ga0501259_004075 3300049688 Bacteria 2325
477 Ga0501225_0000843 3300049705 Bacteria 9534
478 Ga0501225_0012941 3300049705 Bacteria 2339
479 Ga0501080_0062571 3300049742 Bacteria 3463
480 Ga0501080_0067250 3300049742 Bacteria 3333
481 Ga0501080_0117981 3300049742 Bacteria 2460
482 Ga0501083_0069987 3300049744 Bacteria 2334
483 Ga0501241_000089 3300049758 Bacteria 19792
484 Ga0501241_019702 3300049758 Bacteria 1240
485 Ga0501272_002895 3300049769 Bacteria 1720
486 Ga0501035_0037119 3300049822 Bacteria 4414
487 Ga0501044_0012704 3300049823 Bacteria 9120
488 Ga0501044_0108561 3300049823 Bacteria 2785
489 Ga0501044_0210161 3300049823 Bacteria 1900
490 Ga0501044_0299827 3300049823 Bacteria 1536
491 Ga0501284_00104 3300050005 Bacteria 17195
492 nmdc:mga05p37_3235_c1 3300050507 Bacteria 18970
493 nmdc:mga09592_77198_c1 3300050508 Bacteria 2833
494 nmdc:mga08y16_110428_c1 3300050511 Bacteria 2863
495 nmdc:mga08y16_116912_c1 3300050511 Bacteria 2776
496 nmdc:mga0n895_126734_c1 3300050512 Bacteria 2577
497 Ga0500578_0000362 3300053086 Bacteria 55748
498 Ga0500644_0007075 3300053088 Bacteria 2907
499 Ga0500646_0001918 3300053090 Bacteria 5444
500 Ga0500646_0018695 3300053090 Bacteria 1827
501 Ga0500583_0000053 3300053092 Bacteria 74724
502 Ga0500583_0002832 3300053092 Bacteria 5321
503 Ga0500562_000025 3300053108 Bacteria 105616
504 Ga0500569_001850 3300053109 Bacteria 4073
505 Ga0500642_0046519 3300053130 Bacteria 1898
506 Ga0500652_029661 3300053131 Bacteria 2135
507 Ga0500652_040440 3300053131 Bacteria 1874
508 Ga0500559_0009913 3300053136 Bacteria 4104
509 Ga0500559_0019091 3300053136 Bacteria 2897
510 Ga0500568_0000593 3300053139 Bacteria 26321
511 Ga0500573_0030137 3300053140 Bacteria 3129
512 Ga0500577_0003429 3300053142 Bacteria 4117
513 Ga0500588_0010141 3300053146 Bacteria 2265
514 Ga0500589_049224 3300053147 Bacteria 1958
515 Ga0500589_064964 3300053147 Bacteria 1665
516 Ga0500616_0000009 3300053153 Bacteria 779095
517 Ga0500616_0023892 3300053153 Bacteria 3401
518 Ga0500622_0000319 3300053156 Bacteria 48315
519 Ga0500622_0000917 3300053156 Bacteria 25097
520 Ga0500634_0011404 3300053161 Bacteria 4586
521 Ga0500636_0007522 3300053177 Bacteria 6299
522 Ga0500636_0135806 3300053177 Bacteria 1366
523 Ga0500645_052893 3300053730 Bacteria 1182
524 Ga0501084_0170418 3300054114 Bacteria 1837
525 Ga0501082_0008683 3300060353 Bacteria 8761
526 Ga0466962_0018012 3300061719 Bacteria 3398
527 2738724432 2738541278 Bacteria 9755573
528 2819586393 2818991444 Bacteria 6968812
529 2883073142 2883068021 Bacteria 6192739
530 2896087439 2896085136 Bacteria 6129793
531 2896114789 2896109856 Bacteria 7140722
532 2914763690 2914759650 Bacteria 4701441
533 2929155192 2929154850 Bacteria 6753285
534 2929245334 2929239360 Bacteria 7745570
535 2929927583 2929921140 Bacteria 8649150
536 2945979162 2945977869 Bacteria 7777518
537 2946014972 2946013367 Bacteria 7766675
538 8003151431 8003151029 Bacteria 8187759
539 Ga0070707_100027345
540 SwRhRL2b_contig_1886170
541 JGI25154J39366_1000004
542 JGI25406J46586_10018576
543 JGI25153J46596_10000224
544 JGI25153J46596_10018443
545 rootH1_10110809
546 rootL2_10069444
547 rootL2_10072575
548 rootH1_10006409
549 rootH1_10017832
550 rootH1_10173670
551 rootH1_10203735
552 Ga0055528_1000355
553 Ga0055530_10000425
554 Ga0055531_10000411
555 Ga0065165_1000148
556 Ga0065704_10070159
557 Ga0065712_10019540
558 Ga0070658_10033087
559 Ga0070658_10088276
560 Ga0070658_10210866
561 Ga0070676_10003990
562 Ga0070683_100001238
563 Ga0070683_100046488
564 Ga0070683_100210349
565 Ga0070670_100001148
566 Ga0070670_100277963
567 Ga0070666_10001301
568 Ga0070666_10007735
569 Ga0070682_100000039
570 Ga0070682_100004056
571 Ga0070682_100052649
572 Ga0070682_100088048
573 Ga0068868_100017008
574 Ga0068868_100019000
575 Ga0068868_100076415
576 Ga0070660_100003380
577 Ga0070660_100030689
578 Ga0070660_100119060
579 Ga0070689_100043882
580 Ga0070689_100220763
581 Ga0070691_10005553
582 Ga0070691_10022587
583 Ga0070661_100005250
584 Ga0070661_100006927
585 Ga0070668_100040857
586 Ga0070669_100166853
587 Ga0070675_100008200
588 Ga0070675_100089042
589 Ga0070671_100028128
590 Ga0070671_100062191
591 Ga0070674_100072291
592 Ga0070673_100001737
593 Ga0070673_100013460
594 Ga0070673_100015361
595 Ga0070688_100188857
596 Ga0070659_100025770
597 Ga0070667_100000718
598 Ga0070667_100156137
599 Ga0070700_100055422
600 Ga0070708_100150936
601 Ga0070663_100114979
602 Ga0070678_100006728
603 Ga0070678_100078413
604 Ga0070681_10039631
605 Ga0070681_10056780
606 Ga0070681_10177440
607 Ga0068867_100001523
608 Ga0068867_100003218
609 Ga0068867_100073573
610 Ga0068867_100146468
611 Ga0068867_100165056
612 Ga0070679_100001124
613 Ga0070679_100018133
614 Ga0070684_100004827
615 Ga0070684_100030813
616 Ga0068853_100011683
617 Ga0068853_100017878
618 Ga0068853_100047765
619 Ga0068853_100107422
620 Ga0068853_100328430
621 Ga0070672_100001763
622 Ga0070672_100097622
623 Ga0070672_100306989
624 Ga0070686_100002769
625 Ga0070686_100211984
626 Ga0070693_100004404
627 Ga0068855_100000210
628 Ga0068855_100030429
629 Ga0068855_100036149
630 Ga0068855_100446372
631 Ga0070664_100000094
632 Ga0070664_100014873
633 Ga0070664_100018853
634 Ga0068857_100001139
635 Ga0068857_100003724
636 Ga0068857_100007529
637 Ga0068857_100129428
638 Ga0068857_100309668
639 Ga0068854_100089500
640 Ga0068854_100101248
641 Ga0068856_100002822
642 Ga0068856_100085700
643 Ga0068856_100085888
644 Ga0068852_100006664
645 Ga0068852_100020044
646 Ga0068852_100059892
647 Ga0068852_100070886
648 Ga0068859_100000035
649 Ga0068859_100002181
650 Ga0068859_100006691
651 Ga0068859_100053831
652 Ga0068859_100125655
653 Ga0068864_100014629
654 Ga0068864_100024578
655 Ga0068864_100035063
656 Ga0068864_100169276
657 Ga0068866_10023134
658 Ga0068851_10017036
659 Ga0068863_100000284
660 Ga0068863_100018942
661 Ga0068863_100035776
662 Ga0068863_100053103
663 Ga0068863_100087231
664 Ga0068858_100004864
665 Ga0068858_100016448
666 Ga0068860_100000004
667 Ga0068860_100003394
668 Ga0068860_100003442
669 Ga0068860_100049431
670 Ga0068860_100068572
671 Ga0081540_1085388
672 Ga0081539_10000037
673 Ga0075366_10090499
674 Ga0097621_100021477
675 Ga0097621_100058794
676 Ga0097621_100105717
677 Ga0068871_100003140
678 Ga0068871_100018729
679 Ga0068871_100027799
680 Ga0068871_100048263
681 Ga0068871_100130322
682 Ga0097620_100000035
683 Ga0097620_100002181
684 Ga0097620_100006691
685 Ga0097620_100053827
686 Ga0097620_100125660
687 Ga0105240_10002773
688 Ga0105240_10003397
689 Ga0105240_10004711
690 Ga0105240_10006456
691 Ga0105240_10020111
692 Ga0105240_10053237
693 Ga0105240_10067674
694 Ga0105240_10096401
695 Ga0111539_10025919
696 Ga0105247_10016667
697 Ga0114129_10056351
698 Ga0114129_10416728
699 Ga0105241_10001925
700 Ga0105241_10006406
701 Ga0105242_10034702
702 Ga0105248_10000605
703 Ga0105237_10000769
704 Ga0105237_10002457
705 Ga0105237_10008643
706 Ga0105237_10013544
707 Ga0105237_10062115
708 Ga0105237_10091455
709 Ga0105238_10004009
710 Ga0105238_10023913
711 Ga0105249_10001414
712 Ga0105249_10021951
713 Ga0105249_10499265
714 Ga0105239_10000029
715 Ga0105239_10000606
716 Ga0105239_10001999
717 Ga0105239_10002549
718 Ga0105239_10005380
719 Ga0105239_10016570
720 Ga0105239_10022019
721 Ga0105239_10032586
722 Ga0105239_10050939
723 Ga0105239_10132263
724 Ga0105246_10002396
725 Ga0157373_10009312
726 Ga0157373_10011582
727 Ga0157373_10107608
728 Ga0157371_10030971
729 Ga0157371_10057733
730 Ga0157371_10173194
731 Ga0157370_10001941
732 Ga0157370_10027949
733 Ga0157370_10037677
734 Ga0157370_10156514
735 Ga0157369_10014995
736 Ga0157369_10208910
737 Ga0157374_10000001
738 Ga0157374_10035170
739 Ga0157374_10190713
740 Ga0157378_10002213
741 Ga0157378_10012724
742 Ga0157378_10053865
743 Ga0157378_10323627
744 Ga0163162_10000333
745 Ga0163162_10001306
746 Ga0163162_10002251
747 Ga0163162_10004691
748 Ga0163162_10008316
749 Ga0163162_10013610
750 Ga0163162_10022863
751 Ga0163162_10061534
752 Ga0163162_10334911
753 Ga0157372_10000535
754 Ga0157372_10002089
755 Ga0157372_10020369
756 Ga0157372_10039517
757 Ga0157372_10041980
758 Ga0157372_10128645
759 Ga0157372_10129000
760 Ga0157372_10237342
761 Ga0157372_10255527
762 Ga0157372_10516173
763 Ga0157375_10008654
764 Ga0157375_10052345
765 Ga0157375_10078459
766 Ga0157375_10139228
767 Ga0157375_10224135
768 Ga0157375_10439660
769 Ga0163163_10000610
770 Ga0163163_10014951
771 Ga0163163_10019409
772 Ga0163163_10054845
773 Ga0163163_10108946
774 Ga0163163_10237846
775 Ga0157379_10091338
776 Ga0157376_10005368
777 Ga0157376_10007810
778 Ga0157376_10052696
779 Ga0157376_10104668
780 Ga0157376_10115063
781 Ga0163161_10094213
782 Ga0163161_10246837
783 Ga0213876_10001135
784 Ga0213876_10008319
785 Ga0213876_10084913
786 Ga0209258_100075
787 Ga0209646_1000025
788 Ga0209026_1000312
789 Ga0209148_1000085
790 Ga0209673_1000197
791 Ga0209564_1002016
792 Ga0209758_1008066
793 Ga0209758_1013571
794 Ga0209050_1000204
795 Ga0207426_1000019
796 Ga0207426_1000332
797 Ga0209257_1000004
798 Ga0209257_1003489
799 Ga0207688_10021530
800 Ga0207680_10000133
801 Ga0207647_10001026
802 Ga0207647_10009021
803 Ga0207645_10000245
804 Ga0207643_10003965
805 Ga0207705_10140118
806 Ga0207654_10000493
807 Ga0207654_10001439
808 Ga0207707_10000121
809 Ga0207707_10118266
810 Ga0207695_10000057
811 Ga0207695_10000092
812 Ga0207695_10000568
813 Ga0207695_10001216
814 Ga0207695_10009568
815 Ga0207695_10020873
816 Ga0207671_10000725
817 Ga0207671_10000832
818 Ga0207671_10002783
819 Ga0207671_10005217
820 Ga0207671_10009985
821 Ga0207671_10062438
822 Ga0207671_10063394
823 Ga0207660_10000354
824 Ga0207660_10025838
825 Ga0207657_10006314
826 Ga0207657_10050682
827 Ga0207649_10007338
828 Ga0207649_10012951
829 Ga0207649_10034015
830 Ga0207652_10000561
831 Ga0207652_10063790
832 Ga0207646_10002455
833 Ga0207681_10015434
834 Ga0207681_10105413
835 Ga0207681_10232752
836 Ga0207694_10049453
837 Ga0207694_10050387
838 Ga0207650_10000352
839 Ga0207650_10000628
840 Ga0207650_10061327
841 Ga0207650_10092250
842 Ga0207650_10164870
843 Ga0207650_10326635
844 Ga0207659_10065524
845 Ga0207659_10291073
846 Ga0207644_10030754
847 Ga0207644_10294866
848 Ga0207690_10024842
849 Ga0207706_10003545
850 Ga0207686_10028624
851 Ga0207670_10036401
852 Ga0207670_10073499
853 Ga0207670_10087581
854 Ga0207691_10006183
855 Ga0207691_10012868
856 Ga0207691_10023276
857 Ga0207691_10026632
858 Ga0207691_10104437
859 Ga0207711_10007400
860 Ga0207689_10000344
861 Ga0207689_10002162
862 Ga0207689_10058886
863 Ga0207689_10099341
864 Ga0207661_10000620
865 Ga0207661_10001341
866 Ga0207661_10103952
867 Ga0207679_10000683
868 Ga0207679_10034357
869 Ga0207679_10038161
870 Ga0207667_10000246
871 Ga0207667_10038930
872 Ga0207667_10055813
873 Ga0207651_10045889
874 Ga0207651_10047686
875 Ga0207651_10191892
876 Ga0207712_10003110
877 Ga0207668_10031227
878 Ga0207640_10079709
879 Ga0207658_10022728
880 Ga0207658_10118244
881 Ga0207658_10319304
882 Ga0207703_10003019
883 Ga0207703_10199198
884 Ga0207639_10000970
885 Ga0207639_10005235
886 Ga0207639_10012745
887 Ga0207639_10029529
888 Ga0207639_10101174
889 Ga0207639_10268218
890 Ga0207641_10000043
891 Ga0207641_10006948
892 Ga0207641_10022784
893 Ga0207641_10114344
894 Ga0207648_10004405
895 Ga0207648_10040122
896 Ga0207648_10178346
897 Ga0207648_10249022
898 Ga0207676_10070697
899 Ga0207676_10083307
900 Ga0207674_10006324
901 Ga0207674_10021677
902 Ga0207674_10085776
903 Ga0207675_100031854
904 Ga0207675_100059256
905 Ga0207675_100214645
906 Ga0207683_10007492
907 Ga0207683_10125839
908 Ga0207698_10020901
909 Ga0207698_10040592
910 Ga0207698_10053438
911 Ga0207698_10185563
912 Ga0207698_10325750
913 Ga0268266_10110735
914 Ga0268264_10000011
915 Ga0268264_10001289
916 Ga0268264_10006705
917 Ga0268264_10052819
918 Ga0268264_10055492
919 Ga0307517_10190825
920 Ga0307515_10000001
921 Ga0307515_10000036
922 Ga0265338_10149558
923 Ga0307511_10000734
924 Ga0265327_10000159
925 Ga0265327_10000168
926 Ga0265327_10000486
927 Ga0265327_10064266
928 Ga0307513_10048708
929 Ga0307516_10002940
930 Ga0307410_10105309
931 Ga0307412_10062306
932 Ga0307414_10010515
933 Ga0307414_10086069
934 Ga0307510_10006641
935 Ga0373953_0141994
936 Ga0373937_0008637
937 Ga0373937_0028676
938 Ga0373937_0112891
939 Ga0316584_0001213
940 Ga0395900_0225438
941 Ga0395905_0000424
942 Ga0436365_0722843
943 Ga0436365_1318181
944 Ga0436365_1777169
945 Ga0451791_1423946
946 Ga0439449_0011507
947 Ga0439457_000194
948 Ga0439462_0018362
949 Ga0466969_0000235
950 Ga0466972_0000017
951 Ga0466966_0000280
952 Ga0466964_0067507
953 Ga0453684_0240750
954 Ga0453684_0291370
955 Ga0466971_0028510
956 Ga0466968_0015168
957 Ga0466970_0001553
958 Ga0466957_0000047
959 Ga0466957_0037287
960 Ga0466960_0013865
961 Ga0466959_0000015
962 Ga0466959_0008407
963 Ga0495627_003275
964 Ga0495592_0004044
965 Ga0495638_0000001
966 Ga0495582_0083600
967 Ga0495664_0138302
968 Ga0495606_0012333
969 Ga0495633_0000017
970 Ga0495667_0003616
971 Ga0495668_0010673
972 Ga0495634_0102450
973 Ga0495657_0003157
974 Ga0495613_0007286
975 Ga0495636_0000018
976 Ga0495674_0109669
977 Ga0495674_0151573
978 Ga0495684_0163728
979 Ga0495686_0000094
980 Ga0496101_0047341
981 Ga0496114_0001487
982 Ga0496115_0003476
983 Ga0496126_0016487
984 Ga0501033_0009322
985 Ga0501033_0107302
986 Ga0501034_0000002
987 Ga0501034_0003274
988 Ga0501034_0029353
989 Ga0501034_0102393
990 Ga0501034_0123572
991 Ga0501034_0175767
992 Ga0501036_0027216
993 Ga0501037_0026355
994 Ga0501043_0042881
995 Ga0501043_0166977
996 Ga0501046_0024101
997 Ga0501046_0259793
998 Ga0501047_0017969
999 Ga0501047_0066686
1000 Ga0501047_0110478
1001 Ga0501047_0163601
1002 Ga0501071_0054915
1003 Ga0501072_0126328
1004 Ga0501198_003484
1005 Ga0501201_001571
1006 Ga0501206_000657
1007 Ga0501216_017825
1008 Ga0501217_002130
1009 Ga0501217_040139
1010 Ga0501223_001352
1011 Ga0501224_001254
1012 Ga0501235_003416
1013 Ga0501257_029068
1014 Ga0501259_004075
1015 Ga0501225_0000843
1016 Ga0501225_0012941
1017 Ga0501080_0062571
1018 Ga0501080_0067250
1019 Ga0501080_0117981
1020 Ga0501083_0069987
1021 Ga0501241_000089
1022 Ga0501241_019702
1023 Ga0501272_002895
1024 Ga0501035_0037119
1025 Ga0501044_0012704
1026 Ga0501044_0108561
1027 Ga0501044_0210161
1028 Ga0501044_0299827
1029 Ga0501284_00104
1030 nmdc:mga05p37_3235_c1
1031 nmdc:mga09592_77198_c1
1032 nmdc:mga08y16_110428_c1
1033 nmdc:mga08y16_116912_c1
1034 nmdc:mga0n895_126734_c1
1035 Ga0500578_0000362
1036 Ga0500644_0007075
1037 Ga0500646_0001918
1038 Ga0500646_0018695
1039 Ga0500583_0000053
1040 Ga0500583_0002832
1041 Ga0500562_000025
1042 Ga0500569_001850
1043 Ga0500642_0046519
1044 Ga0500652_029661
1045 Ga0500652_040440
1046 Ga0500559_0009913
1047 Ga0500559_0019091
1048 Ga0500568_0000593
1049 Ga0500573_0030137
1050 Ga0500577_0003429
1051 Ga0500588_0010141
1052 Ga0500589_049224
1053 Ga0500589_064964
1054 Ga0500616_0000009
1055 Ga0500616_0023892
1056 Ga0500622_0000319
1057 Ga0500622_0000917
1058 Ga0500634_0011404
1059 Ga0500636_0007522
1060 Ga0500636_0135806
1061 Ga0500645_052893
1062 Ga0501084_0170418
1063 Ga0501082_0008683
1064 Ga0466962_0018012
1065 2738724432
1066 2819586393
1067 2883073142
1068 2896087439
1069 2896114789
1070 2914763690
1071 2929155192
1072 2929245334
1073 2929927583
1074 2945979162
1075 2946014972
1076 8003151431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01702

TGT

Queuine tRNA-ribosyltransferase

9

367

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bbf-assembly1.cif.gz_A-2 crystal structure of trna-guanine transglycosylase (tgt) from zymomonas mobilis in complex with 6-amino-3,7-dihydro-imidazo[4,5-g]quinazolin-8-one 0.9736 3 371
1s39-assembly1.cif.gz_A-2 crystal structure of tgt in complex with 2-aminoquinazolin-4(3h)-one 0.9734 3 371
5n6f-assembly1.cif.gz_A-2 crystal structure of tgt in complex with guanine fragment 0.9734 3 371
2z1w-assembly1.cif.gz_A-2 trna guanine transglycosylase tgt e235q mutant in complex with bdi (2-butyl-5,6-dihydro-1h-imidazo[4,5-d]pyridazine-4,7-dione) 0.9731 3 371
1q4w-assembly1.cif.gz_A-2 crystal structure of tgt in complex with 2,6-diamino-3h-quinazolin-4-one 0.9729 3 371
ID Description Score Start End Superfamily
2ashB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9693 2 373 3.20.20.105
2ashB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9666 2 373 3.20.20.105
af_Q23623_1_366_3.20.20.105 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9589 1 371 3.20.20.105
4jbrA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9575 3 372 3.20.20.105
af_Q23623_1_366_3.20.20.105 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9462 1 371 3.20.20.105
ID Description Score Start End GO Terms
AF-A0A2E8MUA0-F1-model_v4 deleted 0.9897 1 376
AF-A0A353RME3-F1-model_v4 tRNA guanosine(34) transglycosylase Tgt (EC 2.4.2.29) 0.9892 154 251 GO:0002099
GO:0005829
GO:0008616
GO:0016757
AF-A0A3D5IXD7-F1-model_v4 tRNA guanosine(34) transglycosylase Tgt (EC 2.4.2.29) 0.9884 108 243 GO:0002099
GO:0005829
GO:0008616
GO:0016757
AF-A0A3G2LBY5-F1-model_v4 Queuine tRNA-ribosyltransferase (EC 2.4.2.29) (Guanine insertion enzyme) (tRNA-guanine transglycosylase) 0.9883 1 376 GO:0002099
GO:0005829
GO:0008479
GO:0008616
GO:0101030
AF-A0A3D2S676-F1-model_v4 tRNA guanosine(34) transglycosylase Tgt (EC 2.4.2.29) 0.9882 143 376 GO:0002099
GO:0005829
GO:0008616
GO:0016757

Map