F460981

General Info

Members Datasets Scaffolds Average Seq Length
538 225 1076 102

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101400235|Ga0070683_1014002352
Length 118
Sequence VVGAADGALGHNRCVIALVFSYEVREPEGFERAYGADGEWAQFFRRGPGYVGTELLRDVEIPGRYLVIDRWESAEAYNAFAAAHRDEYMRRVDDTRYHYDQELRFGTFETVWDDSSEG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
55 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
84 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
119 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
122 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 1.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.92
Rhizosphere 90.52
Stem 0
Stem Tuber 0
Unclassified 19.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101400235 3300005329 Bacteria 672
2 Ga0070658_10041281 3300005327 Bacteria 3721
3 Ga0070683_100012711 3300005329 Bacteria 7321
4 Ga0070683_100363253 3300005329 Bacteria 1379
5 Ga0070680_100372631 3300005336 Unclassified 1215
6 Ga0070680_100486175 3300005336 Bacteria 1055
7 Ga0070680_100677915 3300005336 Unclassified 887
8 Ga0070680_101214800 3300005336 Unclassified 652
9 Ga0070682_100119389 3300005337 Bacteria 1768
10 Ga0070660_100012626 3300005339 Bacteria 6036
11 Ga0070660_100046115 3300005339 Bacteria 3339
12 Ga0070660_100076799 3300005339 Unclassified 2616
13 Ga0070660_100640195 3300005339 Unclassified 890
14 Ga0070660_100659076 3300005339 Unclassified 877
15 Ga0070661_100514100 3300005344 Bacteria 960
16 Ga0070661_100638126 3300005344 Unclassified 864
17 Ga0070661_101143063 3300005344 Bacteria 650
18 Ga0070661_101229782 3300005344 Unclassified 627
19 Ga0070675_101300355 3300005354 Bacteria 670
20 Ga0070671_100692418 3300005355 Bacteria 884
21 Ga0070671_100704332 3300005355 Bacteria 876
22 Ga0070659_100287065 3300005366 Unclassified 1370
23 Ga0070703_10458868 3300005406 Unclassified 566
24 Ga0070709_10036645 3300005434 Bacteria 2990
25 Ga0070709_10121421 3300005434 Bacteria 1771
26 Ga0070714_100017037 3300005435 Bacteria 5881
27 Ga0070714_100070053 3300005435 Bacteria 3031
28 Ga0070714_100075331 3300005435 Bacteria 2927
29 Ga0070714_100359172 3300005435 Bacteria 1369
30 Ga0070714_100430853 3300005435 Bacteria 1250
31 Ga0070714_100471294 3300005435 Bacteria 1195
32 Ga0070714_101210356 3300005435 Unclassified 737
33 Ga0070713_100014626 3300005436 Bacteria 5837
34 Ga0070713_100028948 3300005436 Bacteria 4379
35 Ga0070713_100188703 3300005436 Bacteria 1856
36 Ga0070713_101049439 3300005436 Bacteria 787
37 Ga0070713_101182128 3300005436 Bacteria 740
38 Ga0070710_10110359 3300005437 Bacteria 1651
39 Ga0070711_100149775 3300005439 Bacteria 1758
40 Ga0070711_100754253 3300005439 Unclassified 823
41 Ga0070708_100287475 3300005445 Unclassified 1548
42 Ga0070708_100580556 3300005445 Bacteria 1057
43 Ga0070708_100910059 3300005445 Unclassified 826
44 Ga0070681_10033361 3300005458 Bacteria 5168
45 Ga0070681_10094140 3300005458 Bacteria 2944
46 Ga0070681_10175244 3300005458 Bacteria 2066
47 Ga0070681_10212496 3300005458 Bacteria 1850
48 Ga0070681_10246834 3300005458 Bacteria 1698
49 Ga0070681_10908034 3300005458 Bacteria 799
50 Ga0070706_100613140 3300005467 Unclassified 1011
51 Ga0070706_101102624 3300005467 Unclassified 731
52 Ga0070706_102020238 3300005467 Unclassified 522
53 Ga0070707_100035621 3300005468 Bacteria 4748
54 Ga0070707_100223871 3300005468 Unclassified 1832
55 Ga0070707_100585089 3300005468 Bacteria 1078
56 Ga0070698_100071078 3300005471 Bacteria 3491
57 Ga0070698_101167863 3300005471 Bacteria 719
58 Ga0070698_102082054 3300005471 Unclassified 521
59 Ga0070699_100162536 3300005518 Unclassified 1977
60 Ga0070679_100065256 3300005530 Bacteria 3629
61 Ga0070679_100094836 3300005530 Bacteria 2972
62 Ga0070679_100141564 3300005530 Bacteria 2384
63 Ga0070679_100151941 3300005530 Bacteria 2292
64 Ga0070679_100308118 3300005530 Bacteria 1534
65 Ga0070679_100693894 3300005530 Bacteria 961
66 Ga0070679_100735046 3300005530 Bacteria 930
67 Ga0070684_100010092 3300005535 Bacteria 7469
68 Ga0070684_100017682 3300005535 Bacteria 5860
69 Ga0070684_100762060 3300005535 Bacteria 904
70 Ga0068853_100335514 3300005539 Bacteria 1404
71 Ga0068853_101090173 3300005539 Bacteria 770
72 Ga0070686_100656661 3300005544 Bacteria 832
73 Ga0070695_100542044 3300005545 Unclassified 906
74 Ga0070696_101483146 3300005546 Unclassified 580
75 Ga0070693_100418065 3300005547 Bacteria 933
76 Ga0070693_100482946 3300005547 Unclassified 876
77 Ga0068855_100042971 3300005563 Bacteria 5355
78 Ga0068855_100189526 3300005563 Unclassified 2321
79 Ga0068855_100582060 3300005563 Bacteria 1209
80 Ga0068855_101620971 3300005563 Bacteria 662
81 Ga0068856_100694895 3300005614 Bacteria 1038
82 Ga0068852_100462775 3300005616 Bacteria 1257
83 Ga0068852_101037617 3300005616 Bacteria 839
84 Ga0070717_10014104 3300006028 Bacteria 6142
85 Ga0070717_10166052 3300006028 Bacteria 1917
86 Ga0070717_10437148 3300006028 Bacteria 1178
87 Ga0070717_10596463 3300006028 Bacteria 1002
88 Ga0070717_11032006 3300006028 Unclassified 749
89 Ga0070717_11439600 3300006028 Bacteria 625
90 Ga0070715_10002345 3300006163 Bacteria 5790
91 Ga0070716_100126134 3300006173 Bacteria 1610
92 Ga0070716_100389250 3300006173 Bacteria 999
93 Ga0070716_101769780 3300006173 Bacteria 511
94 Ga0070712_100223274 3300006175 Bacteria 1492
95 Ga0070712_100919081 3300006175 Unclassified 755
96 Ga0075433_11700181 3300006852 Unclassified 543
97 Ga0105240_10032119 3300009093 Bacteria 6799
98 Ga0105240_10081180 3300009093 Bacteria 3985
99 Ga0105240_10141337 3300009093 Bacteria 2878
100 Ga0105240_10467496 3300009093 Unclassified 1408
101 Ga0105240_12123053 3300009093 Unclassified 583
102 Ga0105247_10010231 3300009101 Bacteria 5677
103 Ga0114129_11286594 3300009147 Bacteria 907
104 Ga0105242_12373835 3300009176 Bacteria 577
105 Ga0105238_10295586 3300009551 Bacteria 1603
106 Ga0157373_10504960 3300013100 Bacteria 874
107 Ga0157371_10091031 3300013102 Bacteria 2160
108 Ga0157371_10426725 3300013102 Unclassified 972
109 Ga0157370_10142938 3300013104 Bacteria 2229
110 Ga0157370_10436079 3300013104 Bacteria 1205
111 Ga0157370_12119711 3300013104 Bacteria 504
112 Ga0157369_10080940 3300013105 Bacteria 3476
113 Ga0157369_10107992 3300013105 Bacteria 2960
114 Ga0157369_11340932 3300013105 Unclassified 729
115 Ga0157374_10045274 3300013296 Unclassified 4072
116 Ga0157372_10270280 3300013307 Bacteria 1975
117 Ga0157372_10562815 3300013307 Bacteria 1329
118 Ga0157372_11134080 3300013307 Bacteria 904
119 Ga0163163_10504634 3300014325 Bacteria 1271
120 Ga0157380_11812530 3300014326 Unclassified 669
121 Ga0182006_1003657 3300015261 Bacteria 7805
122 Ga0206356_10786061 3300020070 Bacteria 1661
123 Ga0206354_10135545 3300020081 Bacteria 1543
124 Ga0206353_10103202 3300020082 Unclassified 563
125 Ga0206353_10280606 3300020082 Bacteria 4495
126 Ga0206353_10824648 3300020082 Bacteria 1641
127 Ga0206353_11740688 3300020082 Bacteria 1510
128 Ga0206353_11820395 3300020082 Bacteria 1706
129 Ga0213873_10024693 3300021358 Bacteria 1445
130 Ga0213871_10040231 3300021441 Bacteria 1253
131 Ga0207692_10058708 3300025898 Bacteria 1983
132 Ga0207685_10035850 3300025905 Bacteria 1814
133 Ga0207699_10012632 3300025906 Bacteria 4301
134 Ga0207705_10335503 3300025909 Bacteria 1163
135 Ga0207705_10342849 3300025909 Bacteria 1150
136 Ga0207684_10739533 3300025910 Unclassified 834
137 Ga0207684_10926900 3300025910 Bacteria 731
138 Ga0207684_11013305 3300025910 Bacteria 694
139 Ga0207654_10401253 3300025911 Unclassified 953
140 Ga0207707_10018035 3300025912 Bacteria 6149
141 Ga0207707_10026752 3300025912 Bacteria 5041
142 Ga0207707_10105274 3300025912 Bacteria 2466
143 Ga0207707_10132149 3300025912 Bacteria 2183
144 Ga0207707_10204724 3300025912 Bacteria 1720
145 Ga0207695_10051621 3300025913 Bacteria 4315
146 Ga0207695_10094601 3300025913 Bacteria 2995
147 Ga0207695_10221295 3300025913 Bacteria 1800
148 Ga0207693_10005607 3300025915 Bacteria 10437
149 Ga0207693_10388638 3300025915 Bacteria 1091
150 Ga0207693_11155675 3300025915 Unclassified 586
151 Ga0207663_10113771 3300025916 Bacteria 1841
152 Ga0207663_10115300 3300025916 Bacteria 1830
153 Ga0207660_10077507 3300025917 Bacteria 2433
154 Ga0207660_10109082 3300025917 Archaea 2080
155 Ga0207660_10230050 3300025917 Bacteria 1457
156 Ga0207660_10493923 3300025917 Bacteria 993
157 Ga0207660_10981461 3300025917 Bacteria 689
158 Ga0207660_11032242 3300025917 Bacteria 670
159 Ga0207660_11040923 3300025917 Bacteria 667
160 Ga0207657_10007009 3300025919 Bacteria 11596
161 Ga0207657_10028182 3300025919 Bacteria 5129
162 Ga0207657_10050347 3300025919 Bacteria 3625
163 Ga0207657_10123134 3300025919 Bacteria 2132
164 Ga0207657_10289703 3300025919 Unclassified 1298
165 Ga0207657_10806651 3300025919 Bacteria 725
166 Ga0207657_11389045 3300025919 Unclassified 528
167 Ga0207649_10466926 3300025920 Unclassified 955
168 Ga0207649_10817441 3300025920 Unclassified 728
169 Ga0207652_10180948 3300025921 Unclassified 1894
170 Ga0207652_10235643 3300025921 Bacteria 1650
171 Ga0207652_10240052 3300025921 Unclassified 1633
172 Ga0207652_10244754 3300025921 Bacteria 1617
173 Ga0207652_10472013 3300025921 Bacteria 1130
174 Ga0207652_10544404 3300025921 Bacteria 1043
175 Ga0207652_10596848 3300025921 Bacteria 990
176 Ga0207646_10176513 3300025922 Bacteria 1930
177 Ga0207646_10334391 3300025922 Bacteria 1368
178 Ga0207646_10429510 3300025922 Unclassified 1192
179 Ga0207646_10856242 3300025922 Unclassified 808
180 Ga0207646_11707196 3300025922 Unclassified 541
181 Ga0207694_11282787 3300025924 Unclassified 619
182 Ga0207659_10738795 3300025926 Bacteria 844
183 Ga0207687_10909380 3300025927 Unclassified 753
184 Ga0207700_10134932 3300025928 Bacteria 2020
185 Ga0207700_10238276 3300025928 Bacteria 1550
186 Ga0207700_11200997 3300025928 Bacteria 677
187 Ga0207664_10006780 3300025929 Bacteria 7911
188 Ga0207664_10011319 3300025929 Bacteria 6331
189 Ga0207664_10193913 3300025929 Bacteria 1750
190 Ga0207664_10225121 3300025929 Bacteria 1628
191 Ga0207664_10509085 3300025929 Bacteria 1078
192 Ga0207664_10604907 3300025929 Bacteria 984
193 Ga0207664_11398704 3300025929 Unclassified 620
194 Ga0207664_11646753 3300025929 Unclassified 564
195 Ga0207644_10103986 3300025931 Bacteria 2138
196 Ga0207644_10158506 3300025931 Bacteria 1757
197 Ga0207665_10004267 3300025939 Bacteria 9500
198 Ga0207665_10301760 3300025939 Bacteria 1197
199 Ga0207665_10989105 3300025939 Bacteria 669
200 Ga0207661_10005378 3300025944 Bacteria 9021
201 Ga0207661_10120131 3300025944 Bacteria 2236
202 Ga0207661_11141935 3300025944 Unclassified 717
203 Ga0207667_10157282 3300025949 Bacteria 2338
204 Ga0207667_10266796 3300025949 Unclassified 1750
205 Ga0207667_10653702 3300025949 Bacteria 1057
206 Ga0207667_11913286 3300025949 Bacteria 555
207 Ga0207639_10615870 3300026041 Bacteria 1002
208 Ga0207683_11407185 3300026121 Unclassified 645
209 Ga0265337_1135635 3300028556 Bacteria 667
210 Ga0265326_10079274 3300028558 Bacteria 929
211 Ga0265319_1000329 3300028563 Bacteria 34971
212 Ga0265319_1001123 3300028563 Bacteria 16646
213 Ga0265319_1018914 3300028563 Bacteria 2584
214 Ga0265319_1050113 3300028563 Bacteria 1380
215 Ga0265319_1164699 3300028563 Bacteria 684
216 Ga0265334_10033626 3300028573 Bacteria 2039
217 Ga0265334_10061403 3300028573 Bacteria 1416
218 Ga0265318_10002158 3300028577 Bacteria 10677
219 Ga0265318_10010045 3300028577 Bacteria 4137
220 Ga0265318_10152019 3300028577 Bacteria 849
221 Ga0265318_10348744 3300028577 Bacteria 540
222 Ga0265323_10044823 3300028653 Bacteria 1591
223 Ga0265322_10004609 3300028654 Bacteria 4097
224 Ga0265322_10042069 3300028654 Bacteria 1300
225 Ga0265322_10103584 3300028654 Bacteria 809
226 Ga0265336_10004521 3300028666 Bacteria 5246
227 Ga0265336_10075201 3300028666 Bacteria 1009
228 Ga0265338_10007713 3300028800 Bacteria 13246
229 Ga0265338_10007903 3300028800 Bacteria 13040
230 Ga0265338_10008673 3300028800 Bacteria 12299
231 Ga0265338_10017807 3300028800 Bacteria 7639
232 Ga0265338_10080894 3300028800 Bacteria 2727
233 Ga0265338_10450336 3300028800 Bacteria 911
234 Ga0265338_10631745 3300028800 Bacteria 744
235 Ga0265324_10069484 3300029957 Bacteria 1200
236 Ga0265324_10124421 3300029957 Bacteria 875
237 Ga0265330_10000357 3300031235 Bacteria 32239
238 Ga0265330_10016149 3300031235 Bacteria 3448
239 Ga0265330_10122853 3300031235 Bacteria 1106
240 Ga0265332_10002382 3300031238 Bacteria 9583
241 Ga0265328_10000653 3300031239 Bacteria 16088
242 Ga0265328_10064806 3300031239 Bacteria 1342
243 Ga0265320_10012684 3300031240 Bacteria 4887
244 Ga0265320_10019509 3300031240 Bacteria 3705
245 Ga0265325_10000216 3300031241 Bacteria 41023
246 Ga0265325_10248887 3300031241 Bacteria 805
247 Ga0265329_10006109 3300031242 Bacteria 4806
248 Ga0265329_10033718 3300031242 Bacteria 1655
249 Ga0265340_10009582 3300031247 Bacteria 5192
250 Ga0265340_10009977 3300031247 Bacteria 5088
251 Ga0265340_10151396 3300031247 Bacteria 1057
252 Ga0265340_10302962 3300031247 Bacteria 709
253 Ga0265339_10008709 3300031249 Bacteria 6434
254 Ga0265339_10103101 3300031249 Bacteria 1482
255 Ga0265339_10129003 3300031249 Bacteria 1294
256 Ga0265331_10055206 3300031250 Bacteria 1889
257 Ga0265327_10009340 3300031251 Bacteria 7092
258 Ga0265327_10011166 3300031251 Bacteria 6224
259 Ga0265327_10079146 3300031251 Bacteria 1627
260 Ga0265327_10093130 3300031251 Bacteria 1466
261 Ga0265327_10435533 3300031251 Unclassified 567
262 Ga0265316_10005528 3300031344 Bacteria 12258
263 Ga0265316_10028623 3300031344 Bacteria 4593
264 Ga0265316_10148654 3300031344 Bacteria 1756
265 Ga0307408_100094061 3300031548 Bacteria 2269
266 Ga0265313_10001279 3300031595 Bacteria 23827
267 Ga0265313_10154120 3300031595 Bacteria 980
268 Ga0265314_10004208 3300031711 Bacteria 13500
269 Ga0265314_10314864 3300031711 Bacteria 873
270 Ga0265314_10391119 3300031711 Bacteria 754
271 Ga0265342_10006803 3300031712 Bacteria 8459
272 Ga0265342_10285400 3300031712 Bacteria 873
273 Ga0307405_10321442 3300031731 Unclassified 1182
274 Ga0307410_10261652 3300031852 Bacteria 1349
275 Ga0307406_10127566 3300031901 Bacteria 1780
276 Ga0307407_10581844 3300031903 Bacteria 831
277 Ga0307412_10153098 3300031911 Bacteria 1704
278 Ga0307409_100087660 3300031995 Bacteria 2537
279 Ga0307416_100175634 3300032002 Unclassified 2000
280 Ga0307414_10075695 3300032004 Bacteria 2444
281 Ga0307411_10330144 3300032005 Bacteria 1235
282 Ga0307415_101875488 3300032126 Unclassified 581
283 Ga0316583_10038783 3300032133 Bacteria 1688
284 Ga0373959_0147556 3300034820 Unclassified 593
285 Ga0373928_0104111 3300035084 Bacteria 744
286 Ga0373940_0057266 3300035088 Bacteria 1107
287 Ga0373952_0037732 3300035092 Bacteria 1104
288 Ga0373939_0044531 3300035114 Bacteria 1351
289 Ga0373954_0399693 3300035118 Bacteria 679
290 Ga0373956_0050344 3300035119 Bacteria 1870
291 Ga0373960_0066428 3300035121 Bacteria 1105
292 Ga0373946_0199150 3300035171 Bacteria 958
293 Ga0373931_0784046 3300035691 Unclassified 634
294 Ga0373931_1122577 3300035691 Unclassified 536
295 Ga0373935_0696461 3300035692 Bacteria 747
296 Ga0373933_0373589 3300035724 Bacteria 928
297 Ga0373933_1032271 3300035724 Unclassified 542
298 Ga0373937_0045180 3300036401 Bacteria 4024
299 Ga0373937_0269323 3300036401 Bacteria 1607
300 Ga0373937_1619732 3300036401 Bacteria 594
301 Ga0373925_0634021 3300037068 Unclassified 881
302 Ga0373925_0795269 3300037068 Bacteria 780
303 Ga0395899_0066025 3300037312 Bacteria 2657
304 Ga0395899_0141581 3300037312 Bacteria 1711
305 Ga0395899_0269988 3300037312 Unclassified 1160
306 Ga0395900_0175418 3300037418 Bacteria 2180
307 Ga0395900_0231379 3300037418 Bacteria 1858
308 Ga0395900_0328587 3300037418 Bacteria 1508
309 Ga0395900_0457542 3300037418 Bacteria 1231
310 Ga0395900_1290796 3300037418 Unclassified 644
311 Ga0395898_0164713 3300037466 Bacteria 2120
312 Ga0395898_0236926 3300037466 Unclassified 1740
313 Ga0395898_0338837 3300037466 Unclassified 1434
314 Ga0395898_1489484 3300037466 Bacteria 603
315 Ga0395905_0194450 3300037471 Bacteria 1902
316 Ga0395905_0372974 3300037471 Bacteria 1320
317 Ga0395905_0417775 3300037471 Bacteria 1237
318 Ga0395901_0011642 3300038443 Bacteria 8908
319 Ga0395901_0174965 3300038443 Unclassified 2251
320 Ga0395901_0184105 3300038443 Bacteria 2191
321 Ga0395901_0352625 3300038443 Unclassified 1518
322 Ga0395901_0931305 3300038443 Bacteria 849
323 Ga0395901_1416311 3300038443 Bacteria 653
324 Ga0242420_017846 3300038996 Bacteria 1245
325 Ga0436365_0086785 3300039437 Unclassified 507
326 Ga0436360_0059844 3300039438 Bacteria 7930
327 Ga0436363_0811091 3300039450 Unclassified 559
328 Ga0436362_1198614 3300039453 Bacteria 1713
329 Ga0451833_0422872 3300041491 Unclassified 500
330 Ga0466969_0421890 3300044656 Bacteria 606
331 Ga0466969_0455440 3300044656 Bacteria 582
332 Ga0466965_0104394 3300044683 Bacteria 1452
333 Ga0466965_0294517 3300044683 Unclassified 879
334 Ga0466966_0015342 3300044684 Bacteria 5066
335 Ga0466966_0178740 3300044684 Bacteria 1288
336 Ga0466966_0263264 3300044684 Unclassified 1038
337 Ga0466961_0022855 3300044693 Bacteria 4022
338 Ga0466961_0034184 3300044693 Bacteria 3264
339 Ga0466961_0178573 3300044693 Bacteria 1319
340 Ga0466961_0217822 3300044693 Bacteria 1177
341 Ga0466963_0001217 3300044694 Bacteria 13563
342 Ga0466963_0005928 3300044694 Bacteria 7194
343 Ga0466963_0009202 3300044694 Bacteria 5944
344 Ga0466963_0033865 3300044694 Bacteria 3320
345 Ga0466963_0055730 3300044694 Bacteria 2629
346 Ga0466963_0478158 3300044694 Bacteria 879
347 Ga0466964_0108718 3300044706 Bacteria 1234
348 Ga0466964_0495714 3300044706 Unclassified 655
349 Ga0466964_0547655 3300044706 Unclassified 628
350 Ga0466971_0004002 3300044719 Bacteria 6342
351 Ga0466971_0009367 3300044719 Bacteria 4279
352 Ga0466971_0090532 3300044719 Bacteria 1401
353 Ga0466971_0445967 3300044719 Bacteria 634
354 Ga0466968_0005729 3300044735 Bacteria 4661
355 Ga0466968_0327380 3300044735 Bacteria 741
356 Ga0466970_0027048 3300044765 Bacteria 3008
357 Ga0466970_0035551 3300044765 Bacteria 2639
358 Ga0466970_0205861 3300044765 Bacteria 1095
359 Ga0466957_0009446 3300044842 Bacteria 5568
360 Ga0466957_0014655 3300044842 Bacteria 4567
361 Ga0466957_0040967 3300044842 Bacteria 2800
362 Ga0466957_0600388 3300044842 Bacteria 770
363 Ga0466957_0673567 3300044842 Bacteria 729
364 Ga0466957_0935677 3300044842 Bacteria 620
365 Ga0466960_0017906 3300044901 Bacteria 3097
366 Ga0466960_0608524 3300044901 Bacteria 649
367 Ga0466959_0041548 3300045049 Bacteria 3394
368 Ga0466959_0303331 3300045049 Bacteria 1093
369 Ga0466959_0390533 3300045049 Bacteria 946
370 Ga0466959_0601510 3300045049 Unclassified 740
371 Ga0466959_0969715 3300045049 Bacteria 566
372 Ga0466959_1179735 3300045049 Bacteria 509
373 Ga0466958_0003256 3300045836 Bacteria 8387
374 Ga0466958_0020118 3300045836 Bacteria 3891
375 Ga0466958_0021836 3300045836 Bacteria 3744
376 Ga0466958_0061100 3300045836 Bacteria 2294
377 Ga0466958_0111481 3300045836 Bacteria 1708
378 Ga0466958_0165821 3300045836 Bacteria 1397
379 Ga0466958_0173459 3300045836 Unclassified 1366
380 Ga0466958_0224768 3300045836 Bacteria 1198
381 Ga0466958_0293789 3300045836 Bacteria 1043
382 Ga0466967_0000126 3300045976 Bacteria 29061
383 Ga0466967_0023025 3300045976 Bacteria 5097
384 Ga0466967_0049311 3300045976 Bacteria 3681
385 Ga0466967_0060124 3300045976 Unclassified 3366
386 Ga0466967_0105465 3300045976 Bacteria 2582
387 Ga0466967_0117875 3300045976 Bacteria 2448
388 Ga0466967_0149683 3300045976 Bacteria 2180
389 Ga0466967_0187420 3300045976 Bacteria 1954
390 Ga0466967_0202679 3300045976 Bacteria 1879
391 Ga0466967_0227306 3300045976 Bacteria 1775
392 Ga0466967_0297006 3300045976 Bacteria 1553
393 Ga0466967_0486982 3300045976 Bacteria 1209
394 Ga0466967_0492999 3300045976 Bacteria 1201
395 Ga0495592_0047905 3300046454 Bacteria 3182
396 Ga0495629_0082061 3300046459 Bacteria 2250
397 Ga0495629_0180839 3300046459 Bacteria 1461
398 Ga0495629_0460937 3300046459 Unclassified 860
399 Ga0495641_0008544 3300046461 Bacteria 6225
400 Ga0495641_0050164 3300046461 Bacteria 1908
401 Ga0495641_0228468 3300046461 Archaea 835
402 Ga0495651_0011502 3300046462 Bacteria 6796
403 Ga0495651_0072892 3300046462 Bacteria 2607
404 Ga0495653_0028132 3300046463 Bacteria 4498
405 Ga0495653_0066673 3300046463 Bacteria 2707
406 Ga0495653_0071000 3300046463 Bacteria 2604
407 Ga0495582_0308338 3300046473 Bacteria 910
408 Ga0495582_0567932 3300046473 Bacteria 656
409 Ga0495662_0545628 3300046476 Bacteria 568
410 Ga0495664_0635868 3300046477 Bacteria 633
411 Ga0495594_0186337 3300046499 Bacteria 1182
412 Ga0495608_0008353 3300046511 Bacteria 7260
413 Ga0495618_0123329 3300046514 Bacteria 1659
414 Ga0495618_0130528 3300046514 Bacteria 1608
415 Ga0495618_0536148 3300046514 Unclassified 702
416 Ga0495628_0134289 3300046516 Bacteria 1892
417 Ga0495628_0817649 3300046516 Bacteria 651
418 Ga0495630_0012385 3300046517 Bacteria 6192
419 Ga0495630_0768053 3300046517 Bacteria 736
420 Ga0495630_1026103 3300046517 Bacteria 626
421 Ga0495630_1373896 3300046517 Archaea 531
422 Ga0495644_0178554 3300046523 Bacteria 816
423 Ga0495652_0443030 3300046529 Bacteria 911
424 Ga0495586_0004291 3300046535 Bacteria 7618
425 Ga0495586_0749391 3300046535 Unclassified 564
426 Ga0495587_0344529 3300046536 Unclassified 831
427 Ga0495587_0347550 3300046536 Bacteria 827
428 Ga0495645_0388077 3300046543 Bacteria 892
429 Ga0495667_0104678 3300046559 Bacteria 1829
430 Ga0495634_0131498 3300046642 Bacteria 1595
431 Ga0495634_0218526 3300046642 Bacteria 1177
432 Ga0495634_0644573 3300046642 Unclassified 612
433 Ga0495634_0791651 3300046642 Archaea 541
434 Ga0495635_0146052 3300046663 Bacteria 1610
435 Ga0495635_0152983 3300046663 Bacteria 1570
436 Ga0495657_0044418 3300046675 Bacteria 3023
437 Ga0495646_0233590 3300046680 Bacteria 990
438 Ga0495646_0505473 3300046680 Unclassified 620
439 Ga0495647_0089810 3300046681 Bacteria 1258
440 Ga0495658_0034191 3300046683 Bacteria 2787
441 Ga0495613_0083884 3300046689 Bacteria 2314
442 Ga0495613_0126179 3300046689 Unclassified 1835
443 Ga0495624_0303897 3300046690 Bacteria 962
444 Ga0495624_0475588 3300046690 Unclassified 748
445 Ga0495600_0054095 3300046809 Bacteria 2622
446 Ga0495600_0335331 3300046809 Bacteria 949
447 Ga0495604_0179878 3300047317 Bacteria 1480
448 Ga0495674_0001471 3300047319 Bacteria 23093
449 Ga0495674_0412006 3300047319 Bacteria 1090
450 Ga0495674_0420245 3300047319 Bacteria 1077
451 Ga0495676_0150507 3300047321 Bacteria 1657
452 Ga0495676_0189995 3300047321 Bacteria 1433
453 Ga0495680_0002468 3300047322 Bacteria 18917
454 Ga0495680_0018023 3300047322 Bacteria 6008
455 Ga0495675_0149098 3300047444 Bacteria 1446
456 Ga0495675_0352258 3300047444 Bacteria 866
457 Ga0495684_0025347 3300047471 Bacteria 4559
458 Ga0495684_0296875 3300047471 Bacteria 1161
459 Ga0495593_0145632 3300047673 Bacteria 1199
460 Ga0495602_0195950 3300048088 Bacteria 1545
461 Ga0495602_0965753 3300048088 Bacteria 564
462 Ga0496100_0120059 3300048903 Bacteria 1837
463 Ga0496100_0287756 3300048903 Bacteria 1227
464 Ga0496100_0367753 3300048903 Bacteria 1090
465 Ga0496101_0126558 3300048904 Bacteria 1936
466 Ga0496101_0441867 3300048904 Bacteria 1026
467 Ga0496101_1332474 3300048904 Unclassified 561
468 Ga0496102_0139110 3300048905 Unclassified 2276
469 Ga0496102_0332276 3300048905 Bacteria 1431
470 Ga0496102_1237005 3300048905 Unclassified 666
471 Ga0496102_1483715 3300048905 Bacteria 597
472 Ga0496102_1839216 3300048905 Unclassified 522
473 Ga0496103_0065449 3300048906 Bacteria 2267
474 Ga0496103_0857720 3300048906 Bacteria 571
475 Ga0496103_0901334 3300048906 Unclassified 554
476 Ga0496104_0040927 3300048907 Bacteria 4345
477 Ga0496104_0045125 3300048907 Bacteria 4144
478 Ga0496105_0017234 3300048908 Bacteria 5786
479 Ga0496105_0193537 3300048908 Bacteria 1662
480 Ga0496106_0008277 3300048909 Bacteria 7695
481 Ga0496106_0009027 3300048909 Bacteria 7366
482 Ga0496107_0011845 3300048910 Bacteria 6090
483 Ga0496107_0051937 3300048910 Bacteria 2957
484 Ga0496108_0071073 3300048911 Bacteria 2936
485 Ga0496109_0133872 3300048912 Bacteria 2315
486 Ga0496109_0457939 3300048912 Bacteria 1205
487 Ga0496109_1100744 3300048912 Bacteria 731
488 Ga0496110_0157571 3300048913 Bacteria 2057
489 Ga0496110_0214920 3300048913 Bacteria 1748
490 Ga0496111_0026175 3300048914 Bacteria 4118
491 Ga0496112_0018379 3300048915 Bacteria 6581
492 Ga0496112_0112810 3300048915 Bacteria 2689
493 Ga0496112_0115948 3300048915 Unclassified 2649
494 Ga0496112_0170899 3300048915 Bacteria 2139
495 Ga0496112_0217399 3300048915 Bacteria 1867
496 Ga0496112_0370571 3300048915 Bacteria 1373
497 Ga0496112_0464985 3300048915 Unclassified 1202
498 Ga0496112_0675872 3300048915 Bacteria 961
499 Ga0496112_1050815 3300048915 Bacteria 733
500 Ga0496113_0007964 3300048916 Bacteria 6864
501 Ga0496113_0084683 3300048916 Bacteria 2435
502 Ga0496113_0096395 3300048916 Unclassified 2287
503 Ga0496113_0388262 3300048916 Bacteria 1121
504 Ga0496113_0408725 3300048916 Unclassified 1090
505 Ga0496113_0458574 3300048916 Unclassified 1024
506 Ga0496114_0038856 3300048917 Unclassified 3938
507 Ga0496114_1110410 3300048917 Bacteria 676
508 Ga0496115_0030638 3300048918 Bacteria 4233
509 Ga0496115_0641187 3300048918 Bacteria 841
510 Ga0501067_0076033 3300049583 Bacteria 1860
511 Ga0501067_0226382 3300049583 Unclassified 1041
512 Ga0501068_0377857 3300049584 Unclassified 912
513 Ga0501069_0040184 3300049585 Bacteria 2585
514 Ga0501069_0203909 3300049585 Bacteria 1146
515 Ga0501070_0002893 3300049586 Bacteria 14969
516 Ga0501070_0007340 3300049586 Bacteria 9360
517 Ga0501072_0009079 3300049588 Bacteria 7550
518 Ga0501073_0091848 3300049589 Bacteria 2110
519 Ga0501074_0015385 3300049590 Bacteria 5561
520 Ga0501079_0199597 3300049741 Unclassified 1562
521 Ga0501080_0411096 3300049742 Unclassified 1216
522 Ga0501080_0545007 3300049742 Unclassified 1034
523 Ga0501083_0007525 3300049744 Bacteria 7717
524 Ga0501035_0750729 3300049822 Archaea 783
525 nmdc:mga0n895_1657317_c1 3300050512 Bacteria 603
526 Ga0495601_0740349 3300053077 Bacteria 626
527 Ga0495601_0832190 3300053077 Bacteria 585
528 Ga0495595_0241630 3300053084 Unclassified 903
529 Ga0495595_0592765 3300053084 Unclassified 567
530 Ga0495619_0058278 3300053085 Bacteria 2563
531 Ga0495619_0126738 3300053085 Bacteria 1752
532 Ga0501082_0824496 3300060353 Bacteria 811
533 Ga0466962_0006449 3300061719 Bacteria 5633
534 Ga0466962_0007964 3300061719 Bacteria 5083
535 Ga0466962_0008543 3300061719 Bacteria 4909
536 Ga0466962_0048462 3300061719 Archaea 2030
537 Ga0466962_0126903 3300061719 Bacteria 1232
538 Ga0466962_0564326 3300061719 Unclassified 579
539 Ga0070683_101400235
540 Ga0070658_10041281
541 Ga0070683_100012711
542 Ga0070683_100363253
543 Ga0070680_100372631
544 Ga0070680_100486175
545 Ga0070680_100677915
546 Ga0070680_101214800
547 Ga0070682_100119389
548 Ga0070660_100012626
549 Ga0070660_100046115
550 Ga0070660_100076799
551 Ga0070660_100640195
552 Ga0070660_100659076
553 Ga0070661_100514100
554 Ga0070661_100638126
555 Ga0070661_101143063
556 Ga0070661_101229782
557 Ga0070675_101300355
558 Ga0070671_100692418
559 Ga0070671_100704332
560 Ga0070659_100287065
561 Ga0070703_10458868
562 Ga0070709_10036645
563 Ga0070709_10121421
564 Ga0070714_100017037
565 Ga0070714_100070053
566 Ga0070714_100075331
567 Ga0070714_100359172
568 Ga0070714_100430853
569 Ga0070714_100471294
570 Ga0070714_101210356
571 Ga0070713_100014626
572 Ga0070713_100028948
573 Ga0070713_100188703
574 Ga0070713_101049439
575 Ga0070713_101182128
576 Ga0070710_10110359
577 Ga0070711_100149775
578 Ga0070711_100754253
579 Ga0070708_100287475
580 Ga0070708_100580556
581 Ga0070708_100910059
582 Ga0070681_10033361
583 Ga0070681_10094140
584 Ga0070681_10175244
585 Ga0070681_10212496
586 Ga0070681_10246834
587 Ga0070681_10908034
588 Ga0070706_100613140
589 Ga0070706_101102624
590 Ga0070706_102020238
591 Ga0070707_100035621
592 Ga0070707_100223871
593 Ga0070707_100585089
594 Ga0070698_100071078
595 Ga0070698_101167863
596 Ga0070698_102082054
597 Ga0070699_100162536
598 Ga0070679_100065256
599 Ga0070679_100094836
600 Ga0070679_100141564
601 Ga0070679_100151941
602 Ga0070679_100308118
603 Ga0070679_100693894
604 Ga0070679_100735046
605 Ga0070684_100010092
606 Ga0070684_100017682
607 Ga0070684_100762060
608 Ga0068853_100335514
609 Ga0068853_101090173
610 Ga0070686_100656661
611 Ga0070695_100542044
612 Ga0070696_101483146
613 Ga0070693_100418065
614 Ga0070693_100482946
615 Ga0068855_100042971
616 Ga0068855_100189526
617 Ga0068855_100582060
618 Ga0068855_101620971
619 Ga0068856_100694895
620 Ga0068852_100462775
621 Ga0068852_101037617
622 Ga0070717_10014104
623 Ga0070717_10166052
624 Ga0070717_10437148
625 Ga0070717_10596463
626 Ga0070717_11032006
627 Ga0070717_11439600
628 Ga0070715_10002345
629 Ga0070716_100126134
630 Ga0070716_100389250
631 Ga0070716_101769780
632 Ga0070712_100223274
633 Ga0070712_100919081
634 Ga0075433_11700181
635 Ga0105240_10032119
636 Ga0105240_10081180
637 Ga0105240_10141337
638 Ga0105240_10467496
639 Ga0105240_12123053
640 Ga0105247_10010231
641 Ga0114129_11286594
642 Ga0105242_12373835
643 Ga0105238_10295586
644 Ga0157373_10504960
645 Ga0157371_10091031
646 Ga0157371_10426725
647 Ga0157370_10142938
648 Ga0157370_10436079
649 Ga0157370_12119711
650 Ga0157369_10080940
651 Ga0157369_10107992
652 Ga0157369_11340932
653 Ga0157374_10045274
654 Ga0157372_10270280
655 Ga0157372_10562815
656 Ga0157372_11134080
657 Ga0163163_10504634
658 Ga0157380_11812530
659 Ga0182006_1003657
660 Ga0206356_10786061
661 Ga0206354_10135545
662 Ga0206353_10103202
663 Ga0206353_10280606
664 Ga0206353_10824648
665 Ga0206353_11740688
666 Ga0206353_11820395
667 Ga0213873_10024693
668 Ga0213871_10040231
669 Ga0207692_10058708
670 Ga0207685_10035850
671 Ga0207699_10012632
672 Ga0207705_10335503
673 Ga0207705_10342849
674 Ga0207684_10739533
675 Ga0207684_10926900
676 Ga0207684_11013305
677 Ga0207654_10401253
678 Ga0207707_10018035
679 Ga0207707_10026752
680 Ga0207707_10105274
681 Ga0207707_10132149
682 Ga0207707_10204724
683 Ga0207695_10051621
684 Ga0207695_10094601
685 Ga0207695_10221295
686 Ga0207693_10005607
687 Ga0207693_10388638
688 Ga0207693_11155675
689 Ga0207663_10113771
690 Ga0207663_10115300
691 Ga0207660_10077507
692 Ga0207660_10109082
693 Ga0207660_10230050
694 Ga0207660_10493923
695 Ga0207660_10981461
696 Ga0207660_11032242
697 Ga0207660_11040923
698 Ga0207657_10007009
699 Ga0207657_10028182
700 Ga0207657_10050347
701 Ga0207657_10123134
702 Ga0207657_10289703
703 Ga0207657_10806651
704 Ga0207657_11389045
705 Ga0207649_10466926
706 Ga0207649_10817441
707 Ga0207652_10180948
708 Ga0207652_10235643
709 Ga0207652_10240052
710 Ga0207652_10244754
711 Ga0207652_10472013
712 Ga0207652_10544404
713 Ga0207652_10596848
714 Ga0207646_10176513
715 Ga0207646_10334391
716 Ga0207646_10429510
717 Ga0207646_10856242
718 Ga0207646_11707196
719 Ga0207694_11282787
720 Ga0207659_10738795
721 Ga0207687_10909380
722 Ga0207700_10134932
723 Ga0207700_10238276
724 Ga0207700_11200997
725 Ga0207664_10006780
726 Ga0207664_10011319
727 Ga0207664_10193913
728 Ga0207664_10225121
729 Ga0207664_10509085
730 Ga0207664_10604907
731 Ga0207664_11398704
732 Ga0207664_11646753
733 Ga0207644_10103986
734 Ga0207644_10158506
735 Ga0207665_10004267
736 Ga0207665_10301760
737 Ga0207665_10989105
738 Ga0207661_10005378
739 Ga0207661_10120131
740 Ga0207661_11141935
741 Ga0207667_10157282
742 Ga0207667_10266796
743 Ga0207667_10653702
744 Ga0207667_11913286
745 Ga0207639_10615870
746 Ga0207683_11407185
747 Ga0265337_1135635
748 Ga0265326_10079274
749 Ga0265319_1000329
750 Ga0265319_1001123
751 Ga0265319_1018914
752 Ga0265319_1050113
753 Ga0265319_1164699
754 Ga0265334_10033626
755 Ga0265334_10061403
756 Ga0265318_10002158
757 Ga0265318_10010045
758 Ga0265318_10152019
759 Ga0265318_10348744
760 Ga0265323_10044823
761 Ga0265322_10004609
762 Ga0265322_10042069
763 Ga0265322_10103584
764 Ga0265336_10004521
765 Ga0265336_10075201
766 Ga0265338_10007713
767 Ga0265338_10007903
768 Ga0265338_10008673
769 Ga0265338_10017807
770 Ga0265338_10080894
771 Ga0265338_10450336
772 Ga0265338_10631745
773 Ga0265324_10069484
774 Ga0265324_10124421
775 Ga0265330_10000357
776 Ga0265330_10016149
777 Ga0265330_10122853
778 Ga0265332_10002382
779 Ga0265328_10000653
780 Ga0265328_10064806
781 Ga0265320_10012684
782 Ga0265320_10019509
783 Ga0265325_10000216
784 Ga0265325_10248887
785 Ga0265329_10006109
786 Ga0265329_10033718
787 Ga0265340_10009582
788 Ga0265340_10009977
789 Ga0265340_10151396
790 Ga0265340_10302962
791 Ga0265339_10008709
792 Ga0265339_10103101
793 Ga0265339_10129003
794 Ga0265331_10055206
795 Ga0265327_10009340
796 Ga0265327_10011166
797 Ga0265327_10079146
798 Ga0265327_10093130
799 Ga0265327_10435533
800 Ga0265316_10005528
801 Ga0265316_10028623
802 Ga0265316_10148654
803 Ga0307408_100094061
804 Ga0265313_10001279
805 Ga0265313_10154120
806 Ga0265314_10004208
807 Ga0265314_10314864
808 Ga0265314_10391119
809 Ga0265342_10006803
810 Ga0265342_10285400
811 Ga0307405_10321442
812 Ga0307410_10261652
813 Ga0307406_10127566
814 Ga0307407_10581844
815 Ga0307412_10153098
816 Ga0307409_100087660
817 Ga0307416_100175634
818 Ga0307414_10075695
819 Ga0307411_10330144
820 Ga0307415_101875488
821 Ga0316583_10038783
822 Ga0373959_0147556
823 Ga0373928_0104111
824 Ga0373940_0057266
825 Ga0373952_0037732
826 Ga0373939_0044531
827 Ga0373954_0399693
828 Ga0373956_0050344
829 Ga0373960_0066428
830 Ga0373946_0199150
831 Ga0373931_0784046
832 Ga0373931_1122577
833 Ga0373935_0696461
834 Ga0373933_0373589
835 Ga0373933_1032271
836 Ga0373937_0045180
837 Ga0373937_0269323
838 Ga0373937_1619732
839 Ga0373925_0634021
840 Ga0373925_0795269
841 Ga0395899_0066025
842 Ga0395899_0141581
843 Ga0395899_0269988
844 Ga0395900_0175418
845 Ga0395900_0231379
846 Ga0395900_0328587
847 Ga0395900_0457542
848 Ga0395900_1290796
849 Ga0395898_0164713
850 Ga0395898_0236926
851 Ga0395898_0338837
852 Ga0395898_1489484
853 Ga0395905_0194450
854 Ga0395905_0372974
855 Ga0395905_0417775
856 Ga0395901_0011642
857 Ga0395901_0174965
858 Ga0395901_0184105
859 Ga0395901_0352625
860 Ga0395901_0931305
861 Ga0395901_1416311
862 Ga0242420_017846
863 Ga0436365_0086785
864 Ga0436360_0059844
865 Ga0436363_0811091
866 Ga0436362_1198614
867 Ga0451833_0422872
868 Ga0466969_0421890
869 Ga0466969_0455440
870 Ga0466965_0104394
871 Ga0466965_0294517
872 Ga0466966_0015342
873 Ga0466966_0178740
874 Ga0466966_0263264
875 Ga0466961_0022855
876 Ga0466961_0034184
877 Ga0466961_0178573
878 Ga0466961_0217822
879 Ga0466963_0001217
880 Ga0466963_0005928
881 Ga0466963_0009202
882 Ga0466963_0033865
883 Ga0466963_0055730
884 Ga0466963_0478158
885 Ga0466964_0108718
886 Ga0466964_0495714
887 Ga0466964_0547655
888 Ga0466971_0004002
889 Ga0466971_0009367
890 Ga0466971_0090532
891 Ga0466971_0445967
892 Ga0466968_0005729
893 Ga0466968_0327380
894 Ga0466970_0027048
895 Ga0466970_0035551
896 Ga0466970_0205861
897 Ga0466957_0009446
898 Ga0466957_0014655
899 Ga0466957_0040967
900 Ga0466957_0600388
901 Ga0466957_0673567
902 Ga0466957_0935677
903 Ga0466960_0017906
904 Ga0466960_0608524
905 Ga0466959_0041548
906 Ga0466959_0303331
907 Ga0466959_0390533
908 Ga0466959_0601510
909 Ga0466959_0969715
910 Ga0466959_1179735
911 Ga0466958_0003256
912 Ga0466958_0020118
913 Ga0466958_0021836
914 Ga0466958_0061100
915 Ga0466958_0111481
916 Ga0466958_0165821
917 Ga0466958_0173459
918 Ga0466958_0224768
919 Ga0466958_0293789
920 Ga0466967_0000126
921 Ga0466967_0023025
922 Ga0466967_0049311
923 Ga0466967_0060124
924 Ga0466967_0105465
925 Ga0466967_0117875
926 Ga0466967_0149683
927 Ga0466967_0187420
928 Ga0466967_0202679
929 Ga0466967_0227306
930 Ga0466967_0297006
931 Ga0466967_0486982
932 Ga0466967_0492999
933 Ga0495592_0047905
934 Ga0495629_0082061
935 Ga0495629_0180839
936 Ga0495629_0460937
937 Ga0495641_0008544
938 Ga0495641_0050164
939 Ga0495641_0228468
940 Ga0495651_0011502
941 Ga0495651_0072892
942 Ga0495653_0028132
943 Ga0495653_0066673
944 Ga0495653_0071000
945 Ga0495582_0308338
946 Ga0495582_0567932
947 Ga0495662_0545628
948 Ga0495664_0635868
949 Ga0495594_0186337
950 Ga0495608_0008353
951 Ga0495618_0123329
952 Ga0495618_0130528
953 Ga0495618_0536148
954 Ga0495628_0134289
955 Ga0495628_0817649
956 Ga0495630_0012385
957 Ga0495630_0768053
958 Ga0495630_1026103
959 Ga0495630_1373896
960 Ga0495644_0178554
961 Ga0495652_0443030
962 Ga0495586_0004291
963 Ga0495586_0749391
964 Ga0495587_0344529
965 Ga0495587_0347550
966 Ga0495645_0388077
967 Ga0495667_0104678
968 Ga0495634_0131498
969 Ga0495634_0218526
970 Ga0495634_0644573
971 Ga0495634_0791651
972 Ga0495635_0146052
973 Ga0495635_0152983
974 Ga0495657_0044418
975 Ga0495646_0233590
976 Ga0495646_0505473
977 Ga0495647_0089810
978 Ga0495658_0034191
979 Ga0495613_0083884
980 Ga0495613_0126179
981 Ga0495624_0303897
982 Ga0495624_0475588
983 Ga0495600_0054095
984 Ga0495600_0335331
985 Ga0495604_0179878
986 Ga0495674_0001471
987 Ga0495674_0412006
988 Ga0495674_0420245
989 Ga0495676_0150507
990 Ga0495676_0189995
991 Ga0495680_0002468
992 Ga0495680_0018023
993 Ga0495675_0149098
994 Ga0495675_0352258
995 Ga0495684_0025347
996 Ga0495684_0296875
997 Ga0495593_0145632
998 Ga0495602_0195950
999 Ga0495602_0965753
1000 Ga0496100_0120059
1001 Ga0496100_0287756
1002 Ga0496100_0367753
1003 Ga0496101_0126558
1004 Ga0496101_0441867
1005 Ga0496101_1332474
1006 Ga0496102_0139110
1007 Ga0496102_0332276
1008 Ga0496102_1237005
1009 Ga0496102_1483715
1010 Ga0496102_1839216
1011 Ga0496103_0065449
1012 Ga0496103_0857720
1013 Ga0496103_0901334
1014 Ga0496104_0040927
1015 Ga0496104_0045125
1016 Ga0496105_0017234
1017 Ga0496105_0193537
1018 Ga0496106_0008277
1019 Ga0496106_0009027
1020 Ga0496107_0011845
1021 Ga0496107_0051937
1022 Ga0496108_0071073
1023 Ga0496109_0133872
1024 Ga0496109_0457939
1025 Ga0496109_1100744
1026 Ga0496110_0157571
1027 Ga0496110_0214920
1028 Ga0496111_0026175
1029 Ga0496112_0018379
1030 Ga0496112_0112810
1031 Ga0496112_0115948
1032 Ga0496112_0170899
1033 Ga0496112_0217399
1034 Ga0496112_0370571
1035 Ga0496112_0464985
1036 Ga0496112_0675872
1037 Ga0496112_1050815
1038 Ga0496113_0007964
1039 Ga0496113_0084683
1040 Ga0496113_0096395
1041 Ga0496113_0388262
1042 Ga0496113_0408725
1043 Ga0496113_0458574
1044 Ga0496114_0038856
1045 Ga0496114_1110410
1046 Ga0496115_0030638
1047 Ga0496115_0641187
1048 Ga0501067_0076033
1049 Ga0501067_0226382
1050 Ga0501068_0377857
1051 Ga0501069_0040184
1052 Ga0501069_0203909
1053 Ga0501070_0002893
1054 Ga0501070_0007340
1055 Ga0501072_0009079
1056 Ga0501073_0091848
1057 Ga0501074_0015385
1058 Ga0501079_0199597
1059 Ga0501080_0411096
1060 Ga0501080_0545007
1061 Ga0501083_0007525
1062 Ga0501035_0750729
1063 nmdc:mga0n895_1657317_c1
1064 Ga0495601_0740349
1065 Ga0495601_0832190
1066 Ga0495595_0241630
1067 Ga0495595_0592765
1068 Ga0495619_0058278
1069 Ga0495619_0126738
1070 Ga0501082_0824496
1071 Ga0466962_0006449
1072 Ga0466962_0007964
1073 Ga0466962_0008543
1074 Ga0466962_0048462
1075 Ga0466962_0126903
1076 Ga0466962_0564326

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

38

92

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tvz-assembly3.cif.gz_C structure of bacillus subtilis hmob 0.8432 2 65
3tvz-assembly2.cif.gz_B structure of bacillus subtilis hmob 0.8325 2 67
7bio-assembly1.cif.gz_A crystal structure of monooxygenase rslo4 from streptomyces bottropensis 0.8243 2 102
3kg1-assembly3.cif.gz_A-2 crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a 0.8135 2 102
3kng-assembly1.cif.gz_B crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.9 resolution 0.7969 2 102
ID Description Score Start End Superfamily
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8135 2 102 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7998 2 97 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.784 2 102 3.30.70.100
3e8oA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7788 1 101 3.30.70.100
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.775 1 100 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A538JC12-F1-model_v4 ABM domain-containing protein 0.9998 2 98
AF-A0A538IK52-F1-model_v4 ABM domain-containing protein 0.9923 1 99
AF-A0A3D3I4B8-F1-model_v4 ABM domain-containing protein 0.9896 2 98
AF-A0A2V8VFF0-F1-model_v4 ABM domain-containing protein 0.9865 2 97
AF-A0A2N2YZP1-F1-model_v4 ABM domain-containing protein 0.986 2 98

Map