F460959

General Info

Members Datasets Scaffolds Average Seq Length
537 276 496 235

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0079192|Ga0501044_0079192_897_1682
Length 261
Sequence MDAPSARGVEERPLGKSSTLRQDALDLKPAILELRHIGKAYSSARDGRQVLTDLSYTLRVGEYVAIMGESGVGKSTLLNLIAGLDMPDTGEILIDDITLSSLDDDAATRLRRRKFGFIFQAFHILPHLTLSQNIALPLLLNDLPVGGTEDMLDAVGLAGRGDHFPRHLSGGELQRVAIARALVHRPKLILADEPTGNLDPDTAHDILMLMRREIKANGASGIIVTHSHAAAATADRILVLTKDGLYPFEPEKAADLPKQIK

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
4 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
5 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
6 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
7 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
8 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
9 2643221556 Massilia sp. Root1485 Isolate Unclassified
10 2643221684 Massilia sp. Root133 Isolate Unclassified
11 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
12 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
13 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
14 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
15 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
16 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
17 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
18 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
19 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
20 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
21 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
22 2818991450 Burkholderia sp. 604 Isolate Unclassified
23 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
24 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
25 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
26 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
27 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
28 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
29 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
30 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
31 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
32 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
33 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
34 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
35 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
36 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
37 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
38 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
39 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
40 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
41 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
42 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
43 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
44 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
45 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
48 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
49 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
50 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
87 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
114 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
115 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
125 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
139 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
140 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
264 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
274 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
275 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
276 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.99
Metatranscriptomes 0.37
Isolates 7.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.84
Nodule 2.23
Rhizoplane 5.96
Rhizosphere 75.42
Stem 0
Stem Tuber 0
Unclassified 11.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10024657 3300001979 Bacteria 2039
2 JGI24739J22299_10001866 3300001989 Bacteria 8033
3 JGI24739J22299_10017928 3300001989 Bacteria 2549
4 JGI24737J22298_10026455 3300001990 Bacteria 1832
5 JGI24737J22298_10111253 3300001990 Bacteria 810
6 JGI24735J21928_10008878 3300002067 Bacteria 3242
7 JGI24735J21928_10015716 3300002067 Bacteria 2357
8 JGI24738J21930_10004728 3300002075 Bacteria 3315
9 JGI25156J39149_1000507 3300002705 Bacteria 22743
10 JGI25156J39149_1000515 3300002705 Bacteria 22559
11 JGI25156J39149_1000749 3300002705 Bacteria 17020
12 JGI25164J39214_1004661 3300002772 Bacteria 1558
13 JGI25165J46597_1001393 3300003214 Bacteria 13235
14 rootH2_10157950 3300003320 Bacteria 3822
15 Ga0055533_1000064 3300003756 Bacteria 169672
16 Ga0055533_1000377 3300003756 Bacteria 18061
17 Ga0055532_1000013 3300003758 Bacteria 380677
18 Ga0055525_1000175 3300003759 Bacteria 80373
19 Ga0055527_1000010 3300003760 Bacteria 380677
20 Ga0055535_1000010 3300003761 Bacteria 380677
21 Ga0055542_1000016 3300003762 Bacteria 380677
22 Ga0055529_1000012 3300003763 Bacteria 380677
23 Ga0065165_1000760 3300005262 Bacteria 43755
24 Ga0065165_1008352 3300005262 Bacteria 4865
25 Ga0070658_10186438 3300005327 Bacteria 1747
26 Ga0070658_10316370 3300005327 Bacteria 1332
27 Ga0070658_10575781 3300005327 Bacteria 975
28 Ga0070682_100038036 3300005337 Bacteria 2949
29 Ga0070661_100783611 3300005344 Bacteria 781
30 Ga0070668_100003160 3300005347 Bacteria 12135
31 Ga0070668_100007534 3300005347 Bacteria 8084
32 Ga0070671_100369880 3300005355 Bacteria 1224
33 Ga0070659_100005526 3300005366 Bacteria 9082
34 Ga0070667_100004087 3300005367 Bacteria 12345
35 Ga0070663_100078958 3300005455 Bacteria 2413
36 Ga0070662_100242733 3300005457 Bacteria 1445
37 Ga0068855_100037349 3300005563 Bacteria 5776
38 Ga0068854_100157059 3300005578 Bacteria 1758
39 Ga0068852_100042521 3300005616 Bacteria 3847
40 Ga0068859_100026205 3300005617 Bacteria 5847
41 Ga0068864_100269575 3300005618 Bacteria 1586
42 Ga0068863_100069110 3300005841 Bacteria 3340
43 Ga0068858_100075399 3300005842 Bacteria 3133
44 Ga0068858_100745293 3300005842 Bacteria 954
45 Ga0068862_100029013 3300005844 Bacteria 4661
46 Ga0075430_100159830 3300006846 Bacteria 1876
47 Ga0068865_100372133 3300006881 Bacteria 1163
48 Ga0097620_100026204 3300006931 Bacteria 5847
49 Ga0105251_10000127 3300009011 Bacteria 76233
50 Ga0105243_10077434 3300009148 Bacteria 2705
51 Ga0105248_11211024 3300009177 Bacteria 854
52 Ga0105237_10000013 3300009545 Bacteria 297699
53 Ga0157373_10122347 3300013100 Bacteria 1829
54 Ga0157369_10048336 3300013105 Bacteria 4617
55 Ga0157369_10531723 3300013105 Bacteria 1216
56 Ga0157378_10192116 3300013297 Bacteria 1926
57 Ga0163162_10045201 3300013306 Bacteria 4412
58 Ga0157375_10074756 3300013308 Bacteria 3410
59 Ga0182008_10023532 3300014497 Bacteria 3145
60 Ga0182008_10143902 3300014497 Bacteria 1194
61 Ga0213875_10002309 3300021388 Bacteria 11541
62 Ga0209435_112181 3300025206 Bacteria 922
63 Ga0209674_100011 3300025226 Bacteria 997175
64 Ga0209674_100048 3300025226 Bacteria 353032
65 Ga0209672_100002 3300025228 Bacteria 1733325
66 Ga0209147_100003 3300025229 Bacteria 1733325
67 Ga0209563_100003 3300025230 Bacteria 1932942
68 Ga0209563_100615 3300025230 Bacteria 11574
69 Ga0207427_103533 3300025231 Bacteria 3213
70 Ga0209258_100042 3300025242 Bacteria 380729
71 Ga0209677_107781 3300025253 Bacteria 2198
72 Ga0209148_1000006 3300025254 Bacteria 1733325
73 Ga0209148_1006774 3300025254 Bacteria 2445
74 Ga0209759_1000002 3300025256 Bacteria 1027596
75 Ga0209759_1000032 3300025256 Bacteria 278697
76 Ga0209759_1000210 3300025256 Bacteria 90325
77 Ga0209759_1006775 3300025256 Bacteria 3797
78 Ga0209233_1000033 3300025261 Bacteria 596094
79 Ga0209455_1000003 3300025272 Bacteria 1471893
80 Ga0207426_1000020 3300025302 Bacteria 558084
81 Ga0207713_1000821 3300025735 Bacteria 28725
82 Ga0207647_10042202 3300025904 Bacteria 2863
83 Ga0207705_10007438 3300025909 Bacteria 8053
84 Ga0207705_10381425 3300025909 Bacteria 1089
85 Ga0207705_10408436 3300025909 Bacteria 1050
86 Ga0207671_10000024 3300025914 Bacteria 274628
87 Ga0207690_10042622 3300025932 Bacteria 2982
88 Ga0207686_10005089 3300025934 Bacteria 7071
89 Ga0207709_10054049 3300025935 Bacteria 2474
90 Ga0207679_10301693 3300025945 Bacteria 1381
91 Ga0207667_10370299 3300025949 Bacteria 1460
92 Ga0207668_10001604 3300025972 Bacteria 13206
93 Ga0207668_10002815 3300025972 Bacteria 10173
94 Ga0207703_10540026 3300026035 Bacteria 1098
95 Ga0207698_10073296 3300026142 Bacteria 2726
96 Ga0209371_1005398 3300027312 Bacteria 5096
97 Ga0268265_10001315 3300028380 Bacteria 21316
98 Ga0268265_10016068 3300028380 Bacteria 5135
99 Ga0268256_1005231 3300030500 Bacteria 5147
100 Ga0316181_1172359 3300030744 Bacteria 999
101 Ga0316182_1260099 3300030745 Bacteria 2812
102 Ga0316182_1275974 3300030745 Bacteria 1420
103 Ga0265327_10007625 3300031251 Bacteria 8296
104 Ga0307513_10000276 3300031456 Bacteria 74546
105 Ga0307513_10025651 3300031456 Bacteria 6822
106 Ga0307408_100014967 3300031548 Bacteria 5162
107 Ga0316576_10000886 3300031727 Bacteria 15219
108 Ga0316578_10012208 3300031728 Bacteria 4524
109 Ga0307516_10000042 3300031730 Bacteria 142687
110 Ga0316577_10000006 3300031733 Bacteria 43337
111 Ga0307412_10000095 3300031911 Bacteria 75002
112 Ga0307412_10028936 3300031911 Bacteria 3473
113 Ga0316580_10041191 3300032139 Bacteria 1426
114 Ga0316588_1005164 3300033528 Bacteria 2523
115 Ga0316596_1004061 3300033541 Bacteria 3252
116 Ga0316584_0001620 3300036712 Bacteria 13717
117 Ga0395899_0015952 3300037312 Bacteria 5728
118 Ga0395900_0001323 3300037418 Bacteria 30016
119 Ga0395900_0009461 3300037418 Bacteria 9988
120 Ga0395900_0076060 3300037418 Bacteria 3451
121 Ga0395900_0181496 3300037418 Bacteria 2138
122 Ga0395900_0523484 3300037418 Bacteria 1133
123 Ga0395898_0515936 3300037466 Bacteria 1136
124 Ga0395898_0931084 3300037466 Bacteria 806
125 Ga0395905_0113624 3300037471 Bacteria 2544
126 Ga0395905_0537624 3300037471 Bacteria 1069
127 Ga0436364_0842977 3300037853 Bacteria 11522
128 Ga0395901_0000852 3300038443 Bacteria 33536
129 Ga0395901_0001594 3300038443 Bacteria 23472
130 Ga0395901_0127002 3300038443 Bacteria 2680
131 Ga0395901_0208848 3300038443 Bacteria 2044
132 Ga0395901_0251634 3300038443 Bacteria 1840
133 Ga0395901_0657273 3300038443 Bacteria 1050
134 Ga0436365_0090088 3300039437 Bacteria 2509
135 Ga0436361_0189883 3300039447 Bacteria 6644
136 Ga0436363_1396499 3300039450 Bacteria 994
137 Ga0439448_0001100 3300042005 Bacteria 6802
138 Ga0439450_010677 3300042008 Bacteria 1778
139 Ga0439455_0000875 3300042012 Bacteria 4640
140 Ga0439455_0064968 3300042012 Bacteria 973
141 Ga0439458_0027564 3300042157 Bacteria 1341
142 Ga0439458_0093029 3300042157 Bacteria 777
143 Ga0451577_0005244 3300042876 Bacteria 13331
144 Ga0466969_0028437 3300044656 Bacteria 2857
145 Ga0466969_0158576 3300044656 Bacteria 1040
146 Ga0466972_0012689 3300044658 Bacteria 4232
147 Ga0466965_0004320 3300044683 Bacteria 6312
148 Ga0466966_0010667 3300044684 Bacteria 6108
149 Ga0466966_0064104 3300044684 Bacteria 2314
150 Ga0466966_0198471 3300044684 Bacteria 1214
151 Ga0466961_0027745 3300044693 Bacteria 3642
152 Ga0466961_0106700 3300044693 Bacteria 1763
153 Ga0466961_0126571 3300044693 Bacteria 1602
154 Ga0466963_0300311 3300044694 Bacteria 1129
155 Ga0466964_0000892 3300044706 Bacteria 9778
156 Ga0453684_0178483 3300044712 Bacteria 2495
157 Ga0466968_0000911 3300044735 Bacteria 10408
158 Ga0466957_0222190 3300044842 Bacteria 1247
159 Ga0466959_0089701 3300045049 Bacteria 2208
160 Ga0466959_0343941 3300045049 Bacteria 1017
161 Ga0466958_0073790 3300045836 Bacteria 2090
162 Ga0466958_0320109 3300045836 Bacteria 997
163 Ga0466967_0047559 3300045976 Bacteria 3740
164 Ga0466967_0052896 3300045976 Bacteria 3567
165 Ga0495592_0005446 3300046454 Bacteria 9397
166 Ga0495592_0045384 3300046454 Bacteria 3279
167 Ga0495592_0167931 3300046454 Bacteria 1504
168 Ga0495603_0008605 3300046455 Bacteria 6168
169 Ga0495603_0260471 3300046455 Bacteria 998
170 Ga0495590_0000054 3300046457 Bacteria 100477
171 Ga0495590_0000917 3300046457 Bacteria 13106
172 Ga0495590_0007302 3300046457 Bacteria 4269
173 Ga0495590_0007860 3300046457 Bacteria 4092
174 Ga0495590_0013639 3300046457 Bacteria 2982
175 Ga0495590_0022846 3300046457 Bacteria 2210
176 Ga0495591_000147 3300046458 Bacteria 74774
177 Ga0495591_002565 3300046458 Bacteria 9993
178 Ga0495629_0000137 3300046459 Bacteria 64048
179 Ga0495629_0000639 3300046459 Bacteria 28355
180 Ga0495629_0010751 3300046459 Bacteria 6658
181 Ga0495629_0120270 3300046459 Bacteria 1829
182 Ga0495629_0211165 3300046459 Bacteria 1340
183 Ga0495629_0227303 3300046459 Bacteria 1286
184 Ga0495641_0081856 3300046461 Bacteria 1446
185 Ga0495651_0130919 3300046462 Bacteria 1831
186 Ga0495653_0006616 3300046463 Bacteria 9515
187 Ga0495653_0065195 3300046463 Bacteria 2742
188 Ga0495653_0123093 3300046463 Bacteria 1845
189 Ga0495653_0155120 3300046463 Bacteria 1595
190 Ga0495650_0005597 3300046471 Bacteria 8103
191 Ga0495650_0005990 3300046471 Bacteria 7700
192 Ga0495650_0010411 3300046471 Bacteria 5189
193 Ga0495650_0015990 3300046471 Bacteria 3821
194 Ga0495580_0005093 3300046472 Bacteria 10944
195 Ga0495580_0012767 3300046472 Bacteria 6438
196 Ga0495580_0017122 3300046472 Bacteria 5427
197 Ga0495580_0017628 3300046472 Bacteria 5334
198 Ga0495580_0037362 3300046472 Bacteria 3486
199 Ga0495580_0038228 3300046472 Bacteria 3438
200 Ga0495580_0076708 3300046472 Bacteria 2331
201 Ga0495582_0005274 3300046473 Bacteria 7225
202 Ga0495582_0011150 3300046473 Bacteria 4950
203 Ga0495582_0048595 3300046473 Bacteria 2336
204 Ga0495582_0276787 3300046473 Bacteria 963
205 Ga0495605_0000150 3300046474 Bacteria 90165
206 Ga0495605_0008345 3300046474 Bacteria 5858
207 Ga0495605_0009742 3300046474 Bacteria 5399
208 Ga0495605_0011891 3300046474 Bacteria 4839
209 Ga0495605_0031187 3300046474 Bacteria 2724
210 Ga0495605_0154204 3300046474 Bacteria 1023
211 Ga0495662_0007941 3300046476 Bacteria 5224
212 Ga0495664_0025783 3300046477 Bacteria 3423
213 Ga0495664_0062466 3300046477 Bacteria 2218
214 Ga0495664_0166118 3300046477 Bacteria 1339
215 Ga0495584_0000629 3300046491 Bacteria 23589
216 Ga0495584_0001033 3300046491 Bacteria 17376
217 Ga0495584_0161482 3300046491 Bacteria 1139
218 Ga0495585_0011965 3300046492 Bacteria 5122
219 Ga0495585_0214355 3300046492 Bacteria 974
220 Ga0495596_0006425 3300046500 Bacteria 5408
221 Ga0495596_0017131 3300046500 Bacteria 3004
222 Ga0495596_0039943 3300046500 Bacteria 1852
223 Ga0495607_0003188 3300046501 Bacteria 12671
224 Ga0495607_0027165 3300046501 Bacteria 3543
225 Ga0495607_0100274 3300046501 Bacteria 1552
226 Ga0495583_0001034 3300046506 Bacteria 31557
227 Ga0495583_0016315 3300046506 Bacteria 4000
228 Ga0495606_0007730 3300046507 Bacteria 9520
229 Ga0495606_0012970 3300046507 Bacteria 6630
230 Ga0495606_0024717 3300046507 Bacteria 4322
231 Ga0495606_0027242 3300046507 Bacteria 4057
232 Ga0495606_0060533 3300046507 Bacteria 2424
233 Ga0495606_0069703 3300046507 Bacteria 2220
234 Ga0495606_0089241 3300046507 Bacteria 1899
235 Ga0495606_0141287 3300046507 Bacteria 1421
236 Ga0495608_0006593 3300046511 Bacteria 8239
237 Ga0495610_0002180 3300046512 Bacteria 16612
238 Ga0495610_0005592 3300046512 Bacteria 8872
239 Ga0495616_0066639 3300046513 Bacteria 1751
240 Ga0495616_0077194 3300046513 Bacteria 1599
241 Ga0495616_0149532 3300046513 Bacteria 1057
242 Ga0495618_0004890 3300046514 Bacteria 8189
243 Ga0495618_0016927 3300046514 Bacteria 4467
244 Ga0495618_0023147 3300046514 Bacteria 3839
245 Ga0495618_0025574 3300046514 Bacteria 3664
246 Ga0495620_0016943 3300046515 Bacteria 3643
247 Ga0495620_0074710 3300046515 Bacteria 1380
248 Ga0495628_0011676 3300046516 Bacteria 7418
249 Ga0495628_0011704 3300046516 Bacteria 7409
250 Ga0495628_0043700 3300046516 Bacteria 3567
251 Ga0495628_0101465 3300046516 Bacteria 2220
252 Ga0495628_0249827 3300046516 Bacteria 1324
253 Ga0495628_0445288 3300046516 Bacteria 941
254 Ga0495630_0026072 3300046517 Bacteria 4326
255 Ga0495630_0033548 3300046517 Bacteria 3829
256 Ga0495631_0007559 3300046518 Bacteria 5526
257 Ga0495632_0003390 3300046519 Bacteria 11351
258 Ga0495632_0029937 3300046519 Bacteria 2830
259 Ga0495637_0000012 3300046520 Bacteria 273124
260 Ga0495643_0001971 3300046522 Bacteria 17213
261 Ga0495643_0007102 3300046522 Bacteria 7265
262 Ga0495643_0017017 3300046522 Bacteria 4260
263 Ga0495644_0006238 3300046523 Bacteria 4631
264 Ga0495648_0043993 3300046524 Bacteria 2791
265 Ga0495648_0047423 3300046524 Bacteria 2655
266 Ga0495648_0065750 3300046524 Bacteria 2129
267 Ga0495648_0082821 3300046524 Bacteria 1819
268 Ga0495666_0008602 3300046526 Bacteria 5113
269 Ga0495666_0008699 3300046526 Bacteria 5086
270 Ga0495666_0011270 3300046526 Bacteria 4458
271 Ga0495642_0000170 3300046528 Bacteria 38143
272 Ga0495642_0010531 3300046528 Bacteria 3540
273 Ga0495642_0050227 3300046528 Bacteria 1714
274 Ga0495642_0152055 3300046528 Bacteria 1001
275 Ga0495642_0181530 3300046528 Bacteria 916
276 Ga0495652_0024459 3300046529 Bacteria 5345
277 Ga0495652_0084368 3300046529 Bacteria 2612
278 Ga0495652_0134157 3300046529 Bacteria 1955
279 Ga0495652_0164989 3300046529 Bacteria 1715
280 Ga0495665_0015182 3300046531 Bacteria 4151
281 Ga0495665_0030427 3300046531 Bacteria 2888
282 Ga0495665_0041436 3300046531 Bacteria 2451
283 Ga0495665_0129734 3300046531 Bacteria 1319
284 Ga0495640_0004306 3300046533 Bacteria 11366
285 Ga0495640_0081785 3300046533 Bacteria 2146
286 Ga0495640_0151854 3300046533 Bacteria 1488
287 Ga0495640_0290921 3300046533 Bacteria 1016
288 Ga0495586_0013497 3300046535 Bacteria 4334
289 Ga0495587_0006914 3300046536 Bacteria 7377
290 Ga0495621_0033488 3300046539 Bacteria 1771
291 Ga0495597_0028197 3300046542 Bacteria 2571
292 Ga0495645_0002624 3300046543 Bacteria 12223
293 Ga0495645_0186853 3300046543 Bacteria 1415
294 Ga0495645_0236630 3300046543 Bacteria 1220
295 Ga0495622_0000532 3300046557 Bacteria 22989
296 Ga0495633_0000856 3300046558 Bacteria 26642
297 Ga0495667_0191593 3300046559 Bacteria 1310
298 Ga0495668_0178800 3300046616 Bacteria 1162
299 Ga0495634_0025540 3300046642 Bacteria 4131
300 Ga0495634_0077964 3300046642 Bacteria 2171
301 Ga0495611_0000711 3300046648 Bacteria 18837
302 Ga0495611_0013334 3300046648 Bacteria 3498
303 Ga0495611_0024596 3300046648 Bacteria 2621
304 Ga0495611_0036208 3300046648 Bacteria 2189
305 Ga0495625_0114518 3300046660 Bacteria 1841
306 Ga0495635_0002797 3300046663 Bacteria 11958
307 Ga0495635_0008015 3300046663 Bacteria 7379
308 Ga0495635_0177482 3300046663 Bacteria 1448
309 Ga0495661_0006761 3300046665 Bacteria 8040
310 Ga0495661_0008995 3300046665 Bacteria 6873
311 Ga0495661_0038058 3300046665 Bacteria 3000
312 Ga0495661_0137850 3300046665 Bacteria 1330
313 Ga0495588_0000078 3300046674 Bacteria 214254
314 Ga0495588_0054335 3300046674 Bacteria 2066
315 Ga0495588_0120029 3300046674 Bacteria 1386
316 Ga0495657_0016932 3300046675 Bacteria 5298
317 Ga0495599_0156404 3300046678 Bacteria 1410
318 Ga0495623_0021995 3300046679 Bacteria 4118
319 Ga0495623_0022485 3300046679 Bacteria 4073
320 Ga0495623_0156979 3300046679 Bacteria 1340
321 Ga0495623_0242063 3300046679 Bacteria 1018
322 Ga0495646_0006215 3300046680 Bacteria 7577
323 Ga0495646_0012179 3300046680 Bacteria 5468
324 Ga0495646_0025699 3300046680 Bacteria 3702
325 Ga0495646_0081500 3300046680 Bacteria 1885
326 Ga0495646_0104855 3300046680 Bacteria 1616
327 Ga0495646_0330491 3300046680 Bacteria 801
328 Ga0495669_0024926 3300046684 Bacteria 2606
329 Ga0495669_0085295 3300046684 Bacteria 1453
330 Ga0495613_0008358 3300046689 Bacteria 7686
331 Ga0495613_0028860 3300046689 Bacteria 4126
332 Ga0495624_0003907 3300046690 Bacteria 10982
333 Ga0495624_0024679 3300046690 Bacteria 3954
334 Ga0495624_0043025 3300046690 Bacteria 2882
335 Ga0495671_0090180 3300046692 Bacteria 1500
336 Ga0495649_0001027 3300046694 Bacteria 21895
337 Ga0495649_0004438 3300046694 Bacteria 9171
338 Ga0495649_0009995 3300046694 Bacteria 5609
339 Ga0495649_0052874 3300046694 Bacteria 2200
340 Ga0495649_0059006 3300046694 Bacteria 2066
341 Ga0495589_0000118 3300046794 Bacteria 73742
342 Ga0495589_0002331 3300046794 Bacteria 10669
343 Ga0495589_0014393 3300046794 Bacteria 4074
344 Ga0495589_0027196 3300046794 Bacteria 2893
345 Ga0495589_0148396 3300046794 Bacteria 1120
346 Ga0495589_0151510 3300046794 Bacteria 1107
347 Ga0495600_0024067 3300046809 Bacteria 3920
348 Ga0495600_0027494 3300046809 Bacteria 3675
349 Ga0495600_0137252 3300046809 Bacteria 1588
350 Ga0495660_0000070 3300046810 Bacteria 112800
351 Ga0495660_0015808 3300046810 Bacteria 4357
352 Ga0495660_0024099 3300046810 Bacteria 3467
353 Ga0495660_0058352 3300046810 Bacteria 2079
354 Ga0495581_0021875 3300047315 Bacteria 3707
355 Ga0495581_0063067 3300047315 Bacteria 2141
356 Ga0495581_0170360 3300047315 Bacteria 1273
357 Ga0495604_0010038 3300047317 Bacteria 7497
358 Ga0495604_0022542 3300047317 Bacteria 5028
359 Ga0495604_0056048 3300047317 Bacteria 3035
360 Ga0495674_0040984 3300047319 Bacteria 4139
361 Ga0495674_0045907 3300047319 Bacteria 3879
362 Ga0495674_0085240 3300047319 Bacteria 2706
363 Ga0495674_0103575 3300047319 Bacteria 2419
364 Ga0495674_0150910 3300047319 Bacteria 1949
365 Ga0495674_0199305 3300047319 Bacteria 1661
366 Ga0495672_0000178 3300047320 Bacteria 91834
367 Ga0495672_0001923 3300047320 Bacteria 19705
368 Ga0495672_0011212 3300047320 Bacteria 6336
369 Ga0495672_0125516 3300047320 Bacteria 1358
370 Ga0495676_0050233 3300047321 Bacteria 3346
371 Ga0495676_0053156 3300047321 Bacteria 3230
372 Ga0495676_0084648 3300047321 Bacteria 2392
373 Ga0495680_0045003 3300047322 Bacteria 3487
374 Ga0495680_0113758 3300047322 Bacteria 2003
375 Ga0495680_0158778 3300047322 Bacteria 1643
376 Ga0495680_0292468 3300047322 Bacteria 1145
377 Ga0495680_0498827 3300047322 Bacteria 826
378 Ga0495683_0000262 3300047323 Bacteria 47167
379 Ga0495683_0001457 3300047323 Bacteria 15505
380 Ga0495683_0004426 3300047323 Bacteria 7977
381 Ga0495683_0010092 3300047323 Bacteria 5005
382 Ga0495683_0016412 3300047323 Bacteria 3846
383 Ga0495683_0078340 3300047323 Bacteria 1615
384 Ga0495687_000339 3300047443 Bacteria 59837
385 Ga0495687_000380 3300047443 Bacteria 55365
386 Ga0495687_003307 3300047443 Bacteria 11823
387 Ga0495687_005848 3300047443 Bacteria 7698
388 Ga0495687_029297 3300047443 Bacteria 2550
389 Ga0495687_136491 3300047443 Bacteria 860
390 Ga0495675_0006400 3300047444 Bacteria 7208
391 Ga0495675_0009080 3300047444 Bacteria 6179
392 Ga0495675_0048699 3300047444 Bacteria 2695
393 Ga0495675_0109143 3300047444 Bacteria 1728
394 Ga0495677_0001263 3300047445 Bacteria 10130
395 Ga0495677_0007836 3300047445 Bacteria 3977
396 Ga0495677_0082137 3300047445 Bacteria 1208
397 Ga0495679_000197 3300047446 Bacteria 53525
398 Ga0495679_002523 3300047446 Bacteria 9244
399 Ga0495679_003170 3300047446 Bacteria 8024
400 Ga0495679_011188 3300047446 Bacteria 3478
401 Ga0495673_0035604 3300047469 Bacteria 2291
402 Ga0495673_0050006 3300047469 Bacteria 1837
403 Ga0495681_0016944 3300047470 Bacteria 4063
404 Ga0495684_0224320 3300047471 Bacteria 1377
405 Ga0495686_0000012 3300047472 Bacteria 508428
406 Ga0495686_0000668 3300047472 Bacteria 46551
407 Ga0495686_0011810 3300047472 Bacteria 6142
408 Ga0495686_0014207 3300047472 Bacteria 5489
409 Ga0495593_0003384 3300047673 Bacteria 9557
410 Ga0495593_0030056 3300047673 Bacteria 2975
411 Ga0495593_0057884 3300047673 Bacteria 2034
412 Ga0495602_0017527 3300048088 Bacteria 7177
413 Ga0495602_0026907 3300048088 Bacteria 5539
414 Ga0495602_0048216 3300048088 Bacteria 3831
415 Ga0495602_0125109 3300048088 Bacteria 2061
416 Ga0495602_0177971 3300048088 Bacteria 1643
417 Ga0495614_0007131 3300048089 Bacteria 4984
418 Ga0495614_0044439 3300048089 Bacteria 1905
419 Ga0495626_0000014 3300048091 Bacteria 246660
420 Ga0495626_0000028 3300048091 Bacteria 204580
421 Ga0495626_0010962 3300048091 Bacteria 4813
422 Ga0495626_0011828 3300048091 Bacteria 4597
423 Ga0495626_0012277 3300048091 Bacteria 4498
424 Ga0495626_0053776 3300048091 Bacteria 1851
425 Ga0496100_0394190 3300048903 Bacteria 1053
426 Ga0496100_0626863 3300048903 Bacteria 836
427 Ga0496101_0084207 3300048904 Bacteria 2354
428 Ga0496101_0104828 3300048904 Bacteria 2121
429 Ga0496101_0540794 3300048904 Bacteria 921
430 Ga0496102_0054104 3300048905 Bacteria 3659
431 Ga0496102_0071232 3300048905 Bacteria 3192
432 Ga0496102_0098308 3300048905 Bacteria 2716
433 Ga0496102_0302653 3300048905 Bacteria 1507
434 Ga0496103_0003879 3300048906 Bacteria 9094
435 Ga0496103_0021215 3300048906 Bacteria 3908
436 Ga0496103_0362774 3300048906 Bacteria 931
437 Ga0496104_0081252 3300048907 Bacteria 3091
438 Ga0496104_0144954 3300048907 Bacteria 2280
439 Ga0496105_0067421 3300048908 Bacteria 2954
440 Ga0496105_0076649 3300048908 Bacteria 2761
441 Ga0496105_0479119 3300048908 Bacteria 979
442 Ga0496106_0013979 3300048909 Bacteria 5935
443 Ga0496106_0287678 3300048909 Bacteria 1317
444 Ga0496107_0019362 3300048910 Bacteria 4802
445 Ga0496107_0437654 3300048910 Bacteria 972
446 Ga0496107_0729241 3300048910 Bacteria 728
447 Ga0496109_0081604 3300048912 Bacteria 2980
448 Ga0496110_0014924 3300048913 Bacteria 6457
449 Ga0496112_0077046 3300048915 Bacteria 3297
450 Ga0496113_0007771 3300048916 Bacteria 6926
451 Ga0496113_0216084 3300048916 Bacteria 1527
452 Ga0496114_0001636 3300048917 Bacteria 16994
453 Ga0496114_0002817 3300048917 Bacteria 13320
454 Ga0496115_0061450 3300048918 Bacteria 3028
455 Ga0496115_0599206 3300048918 Bacteria 876
456 Ga0496116_0046900 3300048919 Bacteria 2913
457 Ga0496117_0001547 3300048920 Bacteria 32665
458 Ga0496117_0010541 3300048920 Bacteria 8404
459 Ga0496117_0043730 3300048920 Bacteria 3253
460 Ga0496117_0118451 3300048920 Bacteria 1632
461 Ga0496118_0000721 3300048921 Bacteria 53381
462 Ga0496118_0000726 3300048921 Bacteria 53204
463 Ga0496118_0008389 3300048921 Bacteria 10687
464 Ga0496118_0020234 3300048921 Bacteria 5909
465 Ga0496119_0168246 3300048922 Bacteria 1160
466 Ga0496121_0010342 3300048924 Bacteria 10542
467 Ga0496121_0027273 3300048924 Bacteria 5348
468 Ga0496121_0067751 3300048924 Bacteria 2891
469 Ga0496121_0206547 3300048924 Bacteria 1395
470 Ga0496121_0262125 3300048924 Bacteria 1193
471 Ga0496122_0006498 3300048925 Bacteria 13399
472 Ga0496123_0013350 3300048926 Bacteria 6906
473 Ga0496123_0019939 3300048926 Bacteria 5263
474 Ga0496124_0011704 3300048927 Bacteria 8753
475 Ga0496124_0011799 3300048927 Bacteria 8705
476 Ga0496124_0037938 3300048927 Bacteria 4186
477 Ga0496124_0336472 3300048927 Bacteria 1074
478 Ga0496125_0197541 3300048928 Bacteria 1321
479 Ga0496126_0000375 3300048929 Bacteria 92390
480 Ga0496126_0003271 3300048929 Bacteria 20678
481 Ga0496126_0025394 3300048929 Bacteria 5700
482 Ga0495678_000329 3300049459 Bacteria 50330
483 Ga0495678_014628 3300049459 Bacteria 3644
484 Ga0495678_089749 3300049459 Bacteria 1085
485 Ga0495682_0022130 3300049460 Bacteria 2379
486 Ga0495682_0053296 3300049460 Bacteria 1469
487 Ga0501032_0001258 3300049569 Bacteria 20325
488 Ga0501034_0698887 3300049571 Bacteria 913
489 Ga0501034_0800237 3300049571 Bacteria 835
490 Ga0501037_0037540 3300049573 Bacteria 3572
491 Ga0501039_0286459 3300049575 Bacteria 1295
492 Ga0501047_0098230 3300049581 Bacteria 2807
493 Ga0501035_0000487 3300049822 Bacteria 44652
494 Ga0501044_0022292 3300049823 Bacteria 6749
495 Ga0501044_0079192 3300049823 Bacteria 3330
496 nmdc:mga0qj67_196682_c1 3300050509 Bacteria 1638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0362774 Ga0496103_0362774_10_612 199
2 3300039437 Ga0436365_0090088 Ga0436365_0090088_1254_1895 208
3 iso_pu_bacteria 2643221556 2643802749 210
4 iso_pu_bacteria 2643221684 2644472254 210
5 iso_pu_bacteria 8047673197 8047675367 210
6 3300039447 Ga0436361_0189883 Ga0436361_0189883_5436_6083 211
7 3300049571 Ga0501034_0800237 Ga0501034_0800237_65_703 211
8 3300003759 Ga0055525_1000175 Ga0055525_100017529 212
9 3300025230 Ga0209563_100003 Ga0209563_100003492 212
10 3300025253 Ga0209677_107781 Ga0209677_1077811 212
11 3300025909 Ga0207705_10408436 Ga0207705_104084361 212
12 3300025932 Ga0207690_10042622 Ga0207690_100426222 212
13 3300037312 Ga0395899_0015952 Ga0395899_0015952_59_700 212
14 3300037418 Ga0395900_0009461 Ga0395900_0009461_5029_5670 212
15 3300037418 Ga0395900_0181496 Ga0395900_0181496_261_902 212
16 3300037466 Ga0395898_0515936 Ga0395898_0515936_129_770 212
17 3300037466 Ga0395898_0931084 Ga0395898_0931084_58_699 212
18 3300038443 Ga0395901_0251634 Ga0395901_0251634_463_1104 212
19 3300042012 Ga0439455_0064968 Ga0439455_0064968_34_675 212
20 3300044684 Ga0466966_0064104 Ga0466966_0064104_97_738 212
21 3300044684 Ga0466966_0198471 Ga0466966_0198471_526_1167 212
22 3300044693 Ga0466961_0126571 Ga0466961_0126571_595_1236 212
23 3300044694 Ga0466963_0300311 Ga0466963_0300311_65_706 212
24 3300045049 Ga0466959_0089701 Ga0466959_0089701_742_1383 212
25 3300045976 Ga0466967_0047559 Ga0466967_0047559_1052_1693 212
26 3300046457 Ga0495590_0007302 Ga0495590_0007302_2652_3293 212
27 3300048905 Ga0496102_0054104 Ga0496102_0054104_2154_2795 212
28 3300048916 Ga0496113_0216084 Ga0496113_0216084_25_666 212
29 3300048925 Ga0496122_0006498 Ga0496122_0006498_3812_4453 212
30 3300048926 Ga0496123_0013350 Ga0496123_0013350_3679_4320 212
31 3300048927 Ga0496124_0011799 Ga0496124_0011799_353_994 212
32 iso_pu_bacteria 2891633521 2891634565 212
33 3300042876 Ga0451577_0005244 Ga0451577_0005244_4023_4673 213
34 3300044712 Ga0453684_0178483 Ga0453684_0178483_142_792 213
35 3300005262 Ga0065165_1008352 Ga0065165_10083523 214
36 3300005327 Ga0070658_10575781 Ga0070658_105757812 214
37 3300025909 Ga0207705_10381425 Ga0207705_103814251 214
38 3300037418 Ga0395900_0001323 Ga0395900_0001323_25603_26250 214
39 3300037418 Ga0395900_0523484 Ga0395900_0523484_17_664 214
40 3300037471 Ga0395905_0537624 Ga0395905_0537624_145_792 214
41 3300038443 Ga0395901_0001594 Ga0395901_0001594_12231_12878 214
42 3300038443 Ga0395901_0657273 Ga0395901_0657273_387_1034 214
43 3300042157 Ga0439458_0027564 Ga0439458_0027564_133_780 214
44 3300044656 Ga0466969_0028437 Ga0466969_0028437_1471_2118 214
45 3300044656 Ga0466969_0158576 Ga0466969_0158576_233_880 214
46 3300044658 Ga0466972_0012689 Ga0466972_0012689_1268_1915 214
47 3300044683 Ga0466965_0004320 Ga0466965_0004320_1689_2336 214
48 3300044684 Ga0466966_0010667 Ga0466966_0010667_5282_5929 214
49 3300044693 Ga0466961_0106700 Ga0466961_0106700_341_988 214
50 3300044706 Ga0466964_0000892 Ga0466964_0000892_6544_7191 214
51 3300044735 Ga0466968_0000911 Ga0466968_0000911_4113_4760 214
52 3300044842 Ga0466957_0222190 Ga0466957_0222190_282_929 214
53 3300045049 Ga0466959_0343941 Ga0466959_0343941_318_965 214
54 3300045836 Ga0466958_0073790 Ga0466958_0073790_283_930 214
55 3300045836 Ga0466958_0320109 Ga0466958_0320109_115_762 214
56 3300046457 Ga0495590_0000054 Ga0495590_0000054_38545_39192 214
57 3300046457 Ga0495590_0000917 Ga0495590_0000917_4281_4928 214
58 3300046458 Ga0495591_000147 Ga0495591_000147_45394_46041 214
59 3300046474 Ga0495605_0000150 Ga0495605_0000150_28372_29019 214
60 3300046474 Ga0495605_0031187 Ga0495605_0031187_533_1180 214
61 3300046491 Ga0495584_0000629 Ga0495584_0000629_14646_15293 214
62 3300046491 Ga0495584_0001033 Ga0495584_0001033_5046_5693 214
63 3300046492 Ga0495585_0011965 Ga0495585_0011965_485_1132 214
64 3300046501 Ga0495607_0003188 Ga0495607_0003188_11223_11870 214
65 3300046501 Ga0495607_0027165 Ga0495607_0027165_2240_2887 214
66 3300046501 Ga0495607_0100274 Ga0495607_0100274_480_1127 214
67 3300046506 Ga0495583_0001034 Ga0495583_0001034_8458_9105 214
68 3300046507 Ga0495606_0089241 Ga0495606_0089241_1013_1660 214
69 3300046507 Ga0495606_0141287 Ga0495606_0141287_453_1100 214
70 3300046512 Ga0495610_0005592 Ga0495610_0005592_5617_6264 214
71 3300046513 Ga0495616_0077194 Ga0495616_0077194_849_1496 214
72 3300046513 Ga0495616_0149532 Ga0495616_0149532_101_748 214
73 3300046518 Ga0495631_0007559 Ga0495631_0007559_1143_1790 214
74 3300046519 Ga0495632_0003390 Ga0495632_0003390_6957_7604 214
75 3300046519 Ga0495632_0029937 Ga0495632_0029937_138_785 214
76 3300046520 Ga0495637_0000012 Ga0495637_0000012_266107_266754 214
77 3300046522 Ga0495643_0001971 Ga0495643_0001971_11236_11883 214
78 3300046522 Ga0495643_0007102 Ga0495643_0007102_5740_6387 214
79 3300046522 Ga0495643_0017017 Ga0495643_0017017_769_1416 214
80 3300046523 Ga0495644_0006238 Ga0495644_0006238_808_1455 214
81 3300046528 Ga0495642_0000170 Ga0495642_0000170_4718_5365 214
82 3300046558 Ga0495633_0000856 Ga0495633_0000856_13654_14301 214
83 3300046648 Ga0495611_0000711 Ga0495611_0000711_6682_7329 214
84 3300046648 Ga0495611_0013334 Ga0495611_0013334_268_915 214
85 3300046665 Ga0495661_0006761 Ga0495661_0006761_7307_7954 214
86 3300046674 Ga0495588_0000078 Ga0495588_0000078_85169_85816 214
87 3300046684 Ga0495669_0085295 Ga0495669_0085295_144_791 214
88 3300046694 Ga0495649_0001027 Ga0495649_0001027_16841_17488 214
89 3300046694 Ga0495649_0052874 Ga0495649_0052874_137_784 214
90 3300046794 Ga0495589_0000118 Ga0495589_0000118_46266_46913 214
91 3300046794 Ga0495589_0014393 Ga0495589_0014393_819_1466 214
92 3300046810 Ga0495660_0000070 Ga0495660_0000070_53446_54093 214
93 3300046810 Ga0495660_0015808 Ga0495660_0015808_2073_2720 214
94 3300046810 Ga0495660_0024099 Ga0495660_0024099_2012_2659 214
95 3300046810 Ga0495660_0058352 Ga0495660_0058352_472_1119 214
96 3300047320 Ga0495672_0000178 Ga0495672_0000178_28814_29461 214
97 3300047320 Ga0495672_0001923 Ga0495672_0001923_1367_2014 214
98 3300047322 Ga0495680_0113758 Ga0495680_0113758_103_750 214
99 3300047323 Ga0495683_0000262 Ga0495683_0000262_38158_38805 214
100 3300047443 Ga0495687_000339 Ga0495687_000339_42095_42742 214
101 3300047443 Ga0495687_000380 Ga0495687_000380_17338_17985 214
102 3300047444 Ga0495675_0109143 Ga0495675_0109143_968_1615 214
103 3300047445 Ga0495677_0001263 Ga0495677_0001263_144_791 214
104 3300047445 Ga0495677_0007836 Ga0495677_0007836_3127_3774 214
105 3300047445 Ga0495677_0082137 Ga0495677_0082137_211_858 214
106 3300047446 Ga0495679_011188 Ga0495679_011188_427_1074 214
107 3300047470 Ga0495681_0016944 Ga0495681_0016944_2608_3255 214
108 3300047472 Ga0495686_0000668 Ga0495686_0000668_21394_22041 214
109 3300047472 Ga0495686_0011810 Ga0495686_0011810_3016_3663 214
110 3300048091 Ga0495626_0000014 Ga0495626_0000014_198849_199496 214
111 3300048091 Ga0495626_0000028 Ga0495626_0000028_142565_143212 214
112 3300048091 Ga0495626_0053776 Ga0495626_0053776_684_1331 214
113 3300048909 Ga0496106_0013979 Ga0496106_0013979_801_1448 214
114 3300048910 Ga0496107_0019362 Ga0496107_0019362_3249_3896 214
115 3300048910 Ga0496107_0437654 Ga0496107_0437654_26_673 214
116 3300048924 Ga0496121_0262125 Ga0496121_0262125_471_1118 214
117 3300048926 Ga0496123_0019939 Ga0496123_0019939_3221_3868 214
118 3300048927 Ga0496124_0011704 Ga0496124_0011704_3911_4558 214
119 3300048927 Ga0496124_0037938 Ga0496124_0037938_2886_3533 214
120 3300048928 Ga0496125_0197541 Ga0496125_0197541_484_1131 214
121 3300049459 Ga0495678_000329 Ga0495678_000329_28805_29452 214
122 3300049571 Ga0501034_0698887 Ga0501034_0698887_244_891 214
123 3300049581 Ga0501047_0098230 Ga0501047_0098230_1768_2415 214
124 3300049822 Ga0501035_0000487 Ga0501035_0000487_24490_25137 214
125 3300046507 Ga0495606_0012970 Ga0495606_0012970_735_1391 215
126 3300005327 Ga0070658_10186438 Ga0070658_101864382 216
127 3300005327 Ga0070658_10316370 Ga0070658_103163701 216
128 3300005344 Ga0070661_100783611 Ga0070661_1007836111 216
129 3300005366 Ga0070659_100005526 Ga0070659_1000055268 216
130 3300009148 Ga0105243_10077434 Ga0105243_100774344 216
131 3300025934 Ga0207686_10005089 Ga0207686_100050895 216
132 3300025935 Ga0207709_10054049 Ga0207709_100540493 216
133 3300030745 Ga0316182_1275974 Ga0316182_12759742 216
134 3300031727 Ga0316576_10000886 Ga0316576_100008862 216
135 3300031728 Ga0316578_10012208 Ga0316578_100122085 216
136 3300031733 Ga0316577_10000006 Ga0316577_1000000644 216
137 3300032139 Ga0316580_10041191 Ga0316580_100411912 216
138 3300033528 Ga0316588_1005164 Ga0316588_10051644 216
139 3300033541 Ga0316596_1004061 Ga0316596_10040614 216
140 3300036712 Ga0316584_0001620 Ga0316584_0001620_12369_13040 216
141 3300038443 Ga0395901_0208848 Ga0395901_0208848_1249_1902 216
142 3300042008 Ga0439450_010677 Ga0439450_010677_937_1590 216
143 3300042157 Ga0439458_0093029 Ga0439458_0093029_49_702 216
144 3300044693 Ga0466961_0027745 Ga0466961_0027745_819_1472 216
145 3300045976 Ga0466967_0052896 Ga0466967_0052896_1265_1918 216
146 3300048904 Ga0496101_0540794 Ga0496101_0540794_136_789 216
147 3300048907 Ga0496104_0081252 Ga0496104_0081252_973_1626 216
148 3300005842 Ga0068858_100745293 Ga0068858_1007452931 217
149 3300025949 Ga0207667_10370299 Ga0207667_103702992 217
150 3300048906 Ga0496103_0003879 Ga0496103_0003879_6956_7618 217
151 3300025909 Ga0207705_10007438 Ga0207705_100074385 218
152 3300031456 Ga0307513_10000276 Ga0307513_1000027638 218
153 3300048905 Ga0496102_0098308 Ga0496102_0098308_1277_1936 219
154 3300049569 Ga0501032_0001258 Ga0501032_0001258_11893_12558 220
155 3300049575 Ga0501039_0286459 Ga0501039_0286459_150_815 220
156 3300005563 Ga0068855_100037349 Ga0068855_1000373494 221
157 3300005578 Ga0068854_100157059 Ga0068854_1001570592 221
158 3300005616 Ga0068852_100042521 Ga0068852_1000425212 221
159 3300013105 Ga0157369_10531723 Ga0157369_105317232 221
160 3300013297 Ga0157378_10192116 Ga0157378_101921162 221
161 3300025945 Ga0207679_10301693 Ga0207679_103016931 221
162 3300026142 Ga0207698_10073296 Ga0207698_100732961 221
163 3300042005 Ga0439448_0001100 Ga0439448_0001100_3326_3994 221
164 3300042012 Ga0439455_0000875 Ga0439455_0000875_3591_4259 221
165 3300046516 Ga0495628_0011676 Ga0495628_0011676_4325_5080 221
166 3300048910 Ga0496107_0729241 Ga0496107_0729241_13_702 221
167 3300006846 Ga0075430_100159830 Ga0075430_1001598302 222
168 3300048903 Ga0496100_0626863 Ga0496100_0626863_23_724 222
169 3300049823 Ga0501044_0022292 Ga0501044_0022292_1718_2476 222
170 3300046539 Ga0495621_0033488 Ga0495621_0033488_148_870 223
171 3300048908 Ga0496105_0076649 Ga0496105_0076649_156_878 223
172 3300048913 Ga0496110_0014924 Ga0496110_0014924_2457_3179 223
173 3300030744 Ga0316181_1172359 Ga0316181_11723591 224
174 3300030745 Ga0316182_1260099 Ga0316182_12600994 224
175 3300031251 Ga0265327_10007625 Ga0265327_100076258 224
176 3300025254 Ga0209148_1006774 Ga0209148_10067742 226
177 3300031456 Ga0307513_10025651 Ga0307513_100256514 226
178 3300046507 Ga0495606_0007730 Ga0495606_0007730_5345_6103 226
179 3300046616 Ga0495668_0178800 Ga0495668_0178800_420_1112 226
180 3300046684 Ga0495669_0024926 Ga0495669_0024926_111_869 226
181 3300046694 Ga0495649_0004438 Ga0495649_0004438_3876_4634 226
182 3300047323 Ga0495683_0078340 Ga0495683_0078340_824_1582 226
183 3300005347 Ga0070668_100003160 Ga0070668_1000031605 227
184 3300005347 Ga0070668_100007534 Ga0070668_1000075345 227
185 3300025972 Ga0207668_10001604 Ga0207668_100016043 227
186 3300028380 Ga0268265_10001315 Ga0268265_1000131510 227
187 3300005355 Ga0070671_100369880 Ga0070671_1003698801 228
188 3300005367 Ga0070667_100004087 Ga0070667_1000040876 228
189 3300005617 Ga0068859_100026205 Ga0068859_1000262052 228
190 3300005618 Ga0068864_100269575 Ga0068864_1002695752 228
191 3300005841 Ga0068863_100069110 Ga0068863_1000691102 228
192 3300005842 Ga0068858_100075399 Ga0068858_1000753992 228
193 3300005844 Ga0068862_100029013 Ga0068862_1000290136 228
194 3300006931 Ga0097620_100026204 Ga0097620_1000262042 228
195 3300009177 Ga0105248_11211024 Ga0105248_112110241 228
196 3300025972 Ga0207668_10002815 Ga0207668_100028156 228
197 3300026035 Ga0207703_10540026 Ga0207703_105400262 228
198 3300028380 Ga0268265_10016068 Ga0268265_100160686 228
199 3300005337 Ga0070682_100038036 Ga0070682_1000380362 229
200 3300005457 Ga0070662_100242733 Ga0070662_1002427332 229
201 3300009545 Ga0105237_10000013 Ga0105237_1000001321 229
202 3300013100 Ga0157373_10122347 Ga0157373_101223472 229
203 3300021388 Ga0213875_10002309 Ga0213875_100023093 229
204 3300025914 Ga0207671_10000024 Ga0207671_1000002455 229
205 3300037853 Ga0436364_0842977 Ga0436364_0842977_2126_2845 229
206 3300038443 Ga0395901_0000852 Ga0395901_0000852_17251_17991 229
207 3300039450 Ga0436363_1396499 Ga0436363_1396499_184_906 229
208 3300046473 Ga0495582_0048595 Ga0495582_0048595_344_1123 229
209 3300046514 Ga0495618_0025574 Ga0495618_0025574_2620_3399 229
210 3300046516 Ga0495628_0101465 Ga0495628_0101465_995_1774 229
211 3300046524 Ga0495648_0047423 Ga0495648_0047423_585_1364 229
212 3300046533 Ga0495640_0151854 Ga0495640_0151854_180_959 229
213 3300046543 Ga0495645_0186853 Ga0495645_0186853_559_1338 229
214 3300046648 Ga0495611_0024596 Ga0495611_0024596_440_1219 229
215 3300046663 Ga0495635_0177482 Ga0495635_0177482_380_1159 229
216 3300046689 Ga0495613_0028860 Ga0495613_0028860_1123_1902 229
217 3300046690 Ga0495624_0024679 Ga0495624_0024679_838_1617 229
218 3300047446 Ga0495679_003170 Ga0495679_003170_3149_3928 229
219 3300048912 Ga0496109_0081604 Ga0496109_0081604_714_1433 229
220 3300050509 nmdc:mga0qj67_196682_c1 nmdc:mga0qj67_196682_c1_262_993 229
221 iso_pu_bacteria 2818991450 2819622381 229
222 iso_pu_bacteria 2928108538 2928111806 229
223 iso_pu_bacteria 2928135762 2928139046 229
224 iso_pu_bacteria 2928503688 2928508745 229
225 3300006881 Ga0068865_100372133 Ga0068865_1003721331 231
226 3300031730 Ga0307516_10000042 Ga0307516_1000004238 231
227 3300037471 Ga0395905_0113624 Ga0395905_0113624_1239_1946 231
228 3300038443 Ga0395901_0127002 Ga0395901_0127002_64_771 231
229 3300046528 Ga0495642_0181530 Ga0495642_0181530_21_719 231
230 iso_pu_bacteria 2562617112 2563063524 231
231 iso_pu_bacteria 2711768613 2713474402 231
232 3300013308 Ga0157375_10074756 Ga0157375_100747565 232
233 3300037418 Ga0395900_0076060 Ga0395900_0076060_542_1273 232
234 3300048904 Ga0496101_0104828 Ga0496101_0104828_539_1255 232
235 3300048908 Ga0496105_0479119 Ga0496105_0479119_122_838 232
236 3300048917 Ga0496114_0002817 Ga0496114_0002817_9090_9806 232
237 3300048918 Ga0496115_0599206 Ga0496115_0599206_53_769 232
238 iso_pu_bacteria 2513237166 2514049023 232
239 3300001989 JGI24739J22299_10001866 JGI24739J22299_100018662 233
240 3300001990 JGI24737J22298_10111253 JGI24737J22298_101112531 233
241 3300009011 Ga0105251_10000127 Ga0105251_1000012763 233
242 3300014497 Ga0182008_10023532 Ga0182008_100235323 233
243 3300025735 Ga0207713_1000821 Ga0207713_10008219 233
244 3300048919 Ga0496116_0046900 Ga0496116_0046900_813_1523 233
245 3300048921 Ga0496118_0000726 Ga0496118_0000726_38737_39447 233
246 iso_pu_bacteria 2791355137 2792837598 233
247 iso_pu_bacteria 2904615490 2904621684 233
248 iso_pu_bacteria 2512047030 2512350734 234
249 3300003320 rootH2_10157950 rootH2_101579501 235
250 3300046457 Ga0495590_0022846 Ga0495590_0022846_49_759 235
251 3300046474 Ga0495605_0008345 Ga0495605_0008345_4872_5582 235
252 3300046506 Ga0495583_0016315 Ga0495583_0016315_235_945 235
253 3300046513 Ga0495616_0066639 Ga0495616_0066639_29_739 235
254 3300046524 Ga0495648_0082821 Ga0495648_0082821_269_979 235
255 3300046794 Ga0495589_0148396 Ga0495589_0148396_148_858 235
256 3300047319 Ga0495674_0199305 Ga0495674_0199305_526_1236 235
257 3300047323 Ga0495683_0016412 Ga0495683_0016412_584_1294 235
258 3300047443 Ga0495687_029297 Ga0495687_029297_1576_2286 235
259 3300048904 Ga0496101_0084207 Ga0496101_0084207_251_961 235
260 3300048907 Ga0496104_0144954 Ga0496104_0144954_232_942 235
261 3300048908 Ga0496105_0067421 Ga0496105_0067421_228_938 235
262 3300048915 Ga0496112_0077046 Ga0496112_0077046_2433_3143 235
263 3300048916 Ga0496113_0007771 Ga0496113_0007771_4661_5371 235
264 3300048922 Ga0496119_0168246 Ga0496119_0168246_224_934 235
265 3300048924 Ga0496121_0067751 Ga0496121_0067751_1971_2681 235
266 3300048927 Ga0496124_0336472 Ga0496124_0336472_272_982 235
267 3300049459 Ga0495678_089749 Ga0495678_089749_204_914 235
268 iso_pu_bacteria 2510065045 2510249464 235
269 iso_pu_bacteria 2515154122 2515682764 235
270 iso_pu_bacteria 2718217991 2719642129 235
271 iso_pu_bacteria 2885270888 2885271332 235
272 iso_pu_bacteria 2902682994 2902691013 235
273 3300013306 Ga0163162_10045201 Ga0163162_100452013 236
274 3300025206 Ga0209435_112181 Ga0209435_1121811 236
275 3300046543 Ga0495645_0236630 Ga0495645_0236630_440_1150 236
276 3300047472 Ga0495686_0000012 Ga0495686_0000012_256465_257220 236
277 3300048924 Ga0496121_0206547 Ga0496121_0206547_604_1359 236
278 3300005262 Ga0065165_1000760 Ga0065165_100076026 237
279 3300025302 Ga0207426_1000020 Ga0207426_1000020162 237
280 3300047320 Ga0495672_0011212 Ga0495672_0011212_122_1096 237
281 3300048905 Ga0496102_0302653 Ga0496102_0302653_671_1387 237
282 3300048920 Ga0496117_0001547 Ga0496117_0001547_21073_21789 237
283 3300048921 Ga0496118_0008389 Ga0496118_0008389_4435_5151 237
284 3300048924 Ga0496121_0010342 Ga0496121_0010342_189_908 237
285 3300048929 Ga0496126_0000375 Ga0496126_0000375_60080_60796 237
286 3300049573 Ga0501037_0037540 Ga0501037_0037540_1768_2514 237
287 3300049823 Ga0501044_0079192 Ga0501044_0079192_897_1682 237
288 3300046459 Ga0495629_0227303 Ga0495629_0227303_242_1003 238
289 3300046471 Ga0495650_0010411 Ga0495650_0010411_2283_3002 238
290 3300047321 Ga0495676_0084648 Ga0495676_0084648_397_1158 238
291 iso_pu_bacteria 2744054900 2746084832 239
292 iso_pu_bacteria 2744054901 2746098596 239
293 iso_pu_bacteria 642555113 642616098 239
294 3300046455 Ga0495603_0008605 Ga0495603_0008605_2163_2888 240
295 3300046459 Ga0495629_0000639 Ga0495629_0000639_7415_8140 240
296 3300046471 Ga0495650_0005597 Ga0495650_0005597_1579_2304 240
297 3300046472 Ga0495580_0012767 Ga0495580_0012767_92_817 240
298 3300046473 Ga0495582_0276787 Ga0495582_0276787_108_833 240
299 3300046474 Ga0495605_0154204 Ga0495605_0154204_16_741 240
300 3300046492 Ga0495585_0214355 Ga0495585_0214355_144_869 240
301 3300046528 Ga0495642_0010531 Ga0495642_0010531_1729_2454 240
302 3300046543 Ga0495645_0002624 Ga0495645_0002624_11348_12073 240
303 3300046674 Ga0495588_0054335 Ga0495588_0054335_1144_1869 240
304 3300046680 Ga0495646_0330491 Ga0495646_0330491_62_787 240
305 3300046794 Ga0495589_0027196 Ga0495589_0027196_686_1411 240
306 3300046809 Ga0495600_0137252 Ga0495600_0137252_222_947 240
307 3300047315 Ga0495581_0170360 Ga0495581_0170360_249_974 240
308 3300047319 Ga0495674_0150910 Ga0495674_0150910_930_1655 240
309 3300047320 Ga0495672_0125516 Ga0495672_0125516_299_1069 240
310 3300047443 Ga0495687_003307 Ga0495687_003307_7317_8042 240
311 3300047673 Ga0495593_0057884 Ga0495593_0057884_232_957 240
312 3300048903 Ga0496100_0394190 Ga0496100_0394190_257_982 240
313 3300048909 Ga0496106_0287678 Ga0496106_0287678_462_1187 240
314 3300048917 Ga0496114_0001636 Ga0496114_0001636_11860_12585 240
315 3300048918 Ga0496115_0061450 Ga0496115_0061450_2142_2867 240
316 3300046459 Ga0495629_0120270 Ga0495629_0120270_94_864 241
317 3300046665 Ga0495661_0137850 Ga0495661_0137850_170_940 241
318 iso_pu_bacteria 2900634093 2900641113 241
319 3300002705 JGI25156J39149_1000749 JGI25156J39149_10007492 243
320 3300025256 Ga0209759_1000002 Ga0209759_1000002948 243
321 3300046471 Ga0495650_0015990 Ga0495650_0015990_2155_2898 243
322 iso_pu_bacteria 2751185846 2753570425 243
323 iso_pu_bacteria 2842324504 2842332458 243
324 iso_pu_bacteria 2842348783 2842356861 243
325 iso_pu_bacteria 2842454564 2842461324 243
326 3300046457 Ga0495590_0013639 Ga0495590_0013639_1426_2160 244
327 3300046459 Ga0495629_0000137 Ga0495629_0000137_58945_59679 244
328 3300046463 Ga0495653_0006616 Ga0495653_0006616_4265_4999 244
329 3300046471 Ga0495650_0005990 Ga0495650_0005990_2781_3515 244
330 3300046472 Ga0495580_0017122 Ga0495580_0017122_4194_4928 244
331 3300046472 Ga0495580_0038228 Ga0495580_0038228_2025_2759 244
332 3300046474 Ga0495605_0009742 Ga0495605_0009742_244_978 244
333 3300046477 Ga0495664_0166118 Ga0495664_0166118_97_831 244
334 3300046491 Ga0495584_0161482 Ga0495584_0161482_153_887 244
335 3300046500 Ga0495596_0017131 Ga0495596_0017131_772_1506 244
336 3300046507 Ga0495606_0060533 Ga0495606_0060533_1646_2380 244
337 3300046514 Ga0495618_0023147 Ga0495618_0023147_463_1197 244
338 3300046515 Ga0495620_0016943 Ga0495620_0016943_1769_2503 244
339 3300046516 Ga0495628_0011704 Ga0495628_0011704_3710_4444 244
340 3300046517 Ga0495630_0033548 Ga0495630_0033548_17_751 244
341 3300046524 Ga0495648_0065750 Ga0495648_0065750_1372_2106 244
342 3300046528 Ga0495642_0152055 Ga0495642_0152055_221_955 244
343 3300046531 Ga0495665_0041436 Ga0495665_0041436_93_827 244
344 3300046533 Ga0495640_0290921 Ga0495640_0290921_169_903 244
345 3300046542 Ga0495597_0028197 Ga0495597_0028197_505_1239 244
346 3300046648 Ga0495611_0036208 Ga0495611_0036208_202_936 244
347 3300046660 Ga0495625_0114518 Ga0495625_0114518_938_1672 244
348 3300046665 Ga0495661_0038058 Ga0495661_0038058_1342_2076 244
349 3300046680 Ga0495646_0006215 Ga0495646_0006215_2171_2905 244
350 3300046692 Ga0495671_0090180 Ga0495671_0090180_541_1275 244
351 3300046694 Ga0495649_0059006 Ga0495649_0059006_645_1379 244
352 3300047319 Ga0495674_0040984 Ga0495674_0040984_2556_3290 244
353 3300047321 Ga0495676_0053156 Ga0495676_0053156_776_1510 244
354 3300047446 Ga0495679_000197 Ga0495679_000197_48516_49250 244
355 3300047469 Ga0495673_0035604 Ga0495673_0035604_1464_2198 244
356 3300047472 Ga0495686_0014207 Ga0495686_0014207_4087_4821 244
357 3300048088 Ga0495602_0125109 Ga0495602_0125109_436_1170 244
358 3300048091 Ga0495626_0011828 Ga0495626_0011828_2098_2832 244
359 3300048905 Ga0496102_0071232 Ga0496102_0071232_1799_2533 244
360 3300048920 Ga0496117_0043730 Ga0496117_0043730_1471_2205 244
361 3300048924 Ga0496121_0027273 Ga0496121_0027273_289_1023 244
362 3300049459 Ga0495678_014628 Ga0495678_014628_2591_3325 244
363 3300049460 Ga0495682_0022130 Ga0495682_0022130_94_828 244
364 3300046462 Ga0495651_0130919 Ga0495651_0130919_242_979 245
365 3300046472 Ga0495580_0005093 Ga0495580_0005093_6174_6911 245
366 3300046526 Ga0495666_0008699 Ga0495666_0008699_4119_4856 245
367 3300046679 Ga0495623_0156979 Ga0495623_0156979_52_789 245
368 3300046680 Ga0495646_0081500 Ga0495646_0081500_904_1641 245
369 3300046690 Ga0495624_0003907 Ga0495624_0003907_4083_4820 245
370 3300047317 Ga0495604_0022542 Ga0495604_0022542_2995_3732 245
371 3300047319 Ga0495674_0045907 Ga0495674_0045907_1881_2618 245
372 3300047322 Ga0495680_0045003 Ga0495680_0045003_18_755 245
373 3300047444 Ga0495675_0009080 Ga0495675_0009080_69_806 245
374 3300047471 Ga0495684_0224320 Ga0495684_0224320_269_1006 245
375 3300048929 Ga0496126_0025394 Ga0496126_0025394_4110_4847 245
376 iso_pu_bacteria 2526164713 2527076428 245
377 iso_pu_bacteria 2738541296 2738824215 245
378 iso_pu_bacteria 2738541298 2738836910 245
379 iso_pu_bacteria 2738541306 2738878441 245
380 iso_pu_bacteria 2738543002 2739190185 245
381 iso_pu_bacteria 2738543008 2739225034 245
382 iso_pu_bacteria 2904483920 2904485755 245
383 iso_pu_bacteria 2919527303 2919532537 245
384 iso_pu_bacteria 2945934425 2945939309 245
385 iso_pu_bacteria 2990703756 2990706650 245
386 iso_pu_bacteria 641736151 642426526 245
387 iso_pu_bacteria 8055301274 8055306529 245
388 3300031548 Ga0307408_100014967 Ga0307408_1000149672 247
389 3300031911 Ga0307412_10028936 Ga0307412_100289362 247
390 3300046454 Ga0495592_0005446 Ga0495592_0005446_3937_4686 247
391 3300046454 Ga0495592_0167931 Ga0495592_0167931_152_901 247
392 3300046458 Ga0495591_002565 Ga0495591_002565_4701_5450 247
393 3300046459 Ga0495629_0010751 Ga0495629_0010751_1551_2300 247
394 3300046461 Ga0495641_0081856 Ga0495641_0081856_537_1286 247
395 3300046463 Ga0495653_0065195 Ga0495653_0065195_791_1540 247
396 3300046463 Ga0495653_0123093 Ga0495653_0123093_992_1741 247
397 3300046463 Ga0495653_0155120 Ga0495653_0155120_154_903 247
398 3300046472 Ga0495580_0017628 Ga0495580_0017628_269_1018 247
399 3300046472 Ga0495580_0037362 Ga0495580_0037362_1132_1881 247
400 3300046473 Ga0495582_0011150 Ga0495582_0011150_281_1030 247
401 3300046476 Ga0495662_0007941 Ga0495662_0007941_3345_4094 247
402 3300046477 Ga0495664_0025783 Ga0495664_0025783_2448_3197 247
403 3300046500 Ga0495596_0006425 Ga0495596_0006425_621_1370 247
404 3300046507 Ga0495606_0069703 Ga0495606_0069703_1181_1930 247
405 3300046511 Ga0495608_0006593 Ga0495608_0006593_3365_4114 247
406 3300046514 Ga0495618_0004890 Ga0495618_0004890_3492_4241 247
407 3300046516 Ga0495628_0249827 Ga0495628_0249827_413_1162 247
408 3300046517 Ga0495630_0026072 Ga0495630_0026072_1551_2300 247
409 3300046524 Ga0495648_0043993 Ga0495648_0043993_1734_2483 247
410 3300046526 Ga0495666_0008602 Ga0495666_0008602_3921_4670 247
411 3300046529 Ga0495652_0024459 Ga0495652_0024459_285_1034 247
412 3300046529 Ga0495652_0164989 Ga0495652_0164989_504_1253 247
413 3300046531 Ga0495665_0015182 Ga0495665_0015182_534_1283 247
414 3300046533 Ga0495640_0004306 Ga0495640_0004306_6745_7494 247
415 3300046536 Ga0495587_0006914 Ga0495587_0006914_49_798 247
416 3300046557 Ga0495622_0000532 Ga0495622_0000532_2723_3472 247
417 3300046559 Ga0495667_0191593 Ga0495667_0191593_351_1100 247
418 3300046642 Ga0495634_0077964 Ga0495634_0077964_309_1058 247
419 3300046663 Ga0495635_0002797 Ga0495635_0002797_4659_5408 247
420 3300046665 Ga0495661_0008995 Ga0495661_0008995_4001_4750 247
421 3300046678 Ga0495599_0156404 Ga0495599_0156404_354_1103 247
422 3300046679 Ga0495623_0021995 Ga0495623_0021995_2750_3502 247
423 3300046679 Ga0495623_0022485 Ga0495623_0022485_3017_3766 247
424 3300046680 Ga0495646_0012179 Ga0495646_0012179_622_1371 247
425 3300046680 Ga0495646_0104855 Ga0495646_0104855_745_1494 247
426 3300046689 Ga0495613_0008358 Ga0495613_0008358_6889_7638 247
427 3300046794 Ga0495589_0002331 Ga0495589_0002331_9740_10489 247
428 3300046809 Ga0495600_0024067 Ga0495600_0024067_534_1283 247
429 3300047315 Ga0495581_0063067 Ga0495581_0063067_914_1663 247
430 3300047317 Ga0495604_0010038 Ga0495604_0010038_2868_3620 247
431 3300047317 Ga0495604_0056048 Ga0495604_0056048_2124_2873 247
432 3300047319 Ga0495674_0085240 Ga0495674_0085240_1551_2300 247
433 3300047321 Ga0495676_0050233 Ga0495676_0050233_174_923 247
434 3300047322 Ga0495680_0158778 Ga0495680_0158778_369_1118 247
435 3300047323 Ga0495683_0010092 Ga0495683_0010092_412_1161 247
436 3300047444 Ga0495675_0006400 Ga0495675_0006400_4461_5210 247
437 3300047444 Ga0495675_0048699 Ga0495675_0048699_1224_1976 247
438 3300047446 Ga0495679_002523 Ga0495679_002523_4398_5147 247
439 3300047469 Ga0495673_0050006 Ga0495673_0050006_485_1234 247
440 3300047673 Ga0495593_0003384 Ga0495593_0003384_4711_5460 247
441 3300048088 Ga0495602_0017527 Ga0495602_0017527_2297_3049 247
442 3300048088 Ga0495602_0026907 Ga0495602_0026907_4250_4999 247
443 3300048088 Ga0495602_0177971 Ga0495602_0177971_732_1481 247
444 3300048089 Ga0495614_0007131 Ga0495614_0007131_2621_3370 247
445 3300048906 Ga0496103_0021215 Ga0496103_0021215_633_1382 247
446 3300048920 Ga0496117_0010541 Ga0496117_0010541_4162_4911 247
447 3300048921 Ga0496118_0000721 Ga0496118_0000721_48765_49514 247
448 3300049460 Ga0495682_0053296 Ga0495682_0053296_483_1232 247
449 iso_pu_bacteria 2508501125 2509127695 247
450 iso_pu_bacteria 2513237151 2513962946 247
451 3300046516 Ga0495628_0445288 Ga0495628_0445288_39_800 248
452 3300046529 Ga0495652_0134157 Ga0495652_0134157_587_1357 248
453 3300046531 Ga0495665_0129734 Ga0495665_0129734_103_873 248
454 3300046674 Ga0495588_0120029 Ga0495588_0120029_263_1033 248
455 3300047322 Ga0495680_0292468 Ga0495680_0292468_100_870 248
456 3300048929 Ga0496126_0003271 Ga0496126_0003271_16323_17090 248
457 3300001979 JGI24740J21852_10024657 JGI24740J21852_100246573 249
458 3300001989 JGI24739J22299_10017928 JGI24739J22299_100179282 249
459 3300001990 JGI24737J22298_10026455 JGI24737J22298_100264553 249
460 3300002067 JGI24735J21928_10008878 JGI24735J21928_100088782 249
461 3300002067 JGI24735J21928_10015716 JGI24735J21928_100157162 249
462 3300002075 JGI24738J21930_10004728 JGI24738J21930_100047282 249
463 3300002705 JGI25156J39149_1000507 JGI25156J39149_100050717 249
464 3300002705 JGI25156J39149_1000515 JGI25156J39149_100051519 249
465 3300002772 JGI25164J39214_1004661 JGI25164J39214_10046611 249
466 3300003214 JGI25165J46597_1001393 JGI25165J46597_10013933 249
467 3300003756 Ga0055533_1000064 Ga0055533_10000643 249
468 3300003756 Ga0055533_1000377 Ga0055533_10003773 249
469 3300003758 Ga0055532_1000013 Ga0055532_1000013366 249
470 3300003760 Ga0055527_1000010 Ga0055527_10000103 249
471 3300003761 Ga0055535_1000010 Ga0055535_1000010366 249
472 3300003762 Ga0055542_1000016 Ga0055542_1000016366 249
473 3300003763 Ga0055529_1000012 Ga0055529_1000012366 249
474 3300005455 Ga0070663_100078958 Ga0070663_1000789581 249
475 3300013105 Ga0157369_10048336 Ga0157369_100483362 249
476 3300014497 Ga0182008_10143902 Ga0182008_101439021 249
477 3300025226 Ga0209674_100011 Ga0209674_1000114 249
478 3300025226 Ga0209674_100048 Ga0209674_100048311 249
479 3300025228 Ga0209672_100002 Ga0209672_1000024 249
480 3300025229 Ga0209147_100003 Ga0209147_1000034 249
481 3300025230 Ga0209563_100615 Ga0209563_1006156 249
482 3300025231 Ga0207427_103533 Ga0207427_1035332 249
483 3300025242 Ga0209258_100042 Ga0209258_100042356 249
484 3300025254 Ga0209148_1000006 Ga0209148_10000064 249
485 3300025256 Ga0209759_1000032 Ga0209759_10000323 249
486 3300025256 Ga0209759_1000210 Ga0209759_10002104 249
487 3300025256 Ga0209759_1006775 Ga0209759_10067752 249
488 3300025261 Ga0209233_1000033 Ga0209233_1000033546 249
489 3300025272 Ga0209455_1000003 Ga0209455_10000034 249
490 3300025904 Ga0207647_10042202 Ga0207647_100422022 249
491 3300027312 Ga0209371_1005398 Ga0209371_10053982 249
492 3300030500 Ga0268256_1005231 Ga0268256_10052313 249
493 3300031911 Ga0307412_10000095 Ga0307412_1000009561 249
494 3300046454 Ga0495592_0045384 Ga0495592_0045384_192_941 249
495 3300046455 Ga0495603_0260471 Ga0495603_0260471_218_967 249
496 3300046457 Ga0495590_0007860 Ga0495590_0007860_2811_3560 249
497 3300046459 Ga0495629_0211165 Ga0495629_0211165_397_1146 249
498 3300046472 Ga0495580_0076708 Ga0495580_0076708_1334_2083 249
499 3300046473 Ga0495582_0005274 Ga0495582_0005274_4181_4930 249
500 3300046474 Ga0495605_0011891 Ga0495605_0011891_2918_3667 249
501 3300046477 Ga0495664_0062466 Ga0495664_0062466_1404_2153 249
502 3300046500 Ga0495596_0039943 Ga0495596_0039943_577_1326 249
503 3300046507 Ga0495606_0024717 Ga0495606_0024717_326_1075 249
504 3300046507 Ga0495606_0027242 Ga0495606_0027242_2437_3186 249
505 3300046512 Ga0495610_0002180 Ga0495610_0002180_4190_4939 249
506 3300046514 Ga0495618_0016927 Ga0495618_0016927_83_832 249
507 3300046515 Ga0495620_0074710 Ga0495620_0074710_293_1042 249
508 3300046516 Ga0495628_0043700 Ga0495628_0043700_288_1037 249
509 3300046526 Ga0495666_0011270 Ga0495666_0011270_3662_4411 249
510 3300046528 Ga0495642_0050227 Ga0495642_0050227_872_1621 249
511 3300046529 Ga0495652_0084368 Ga0495652_0084368_48_797 249
512 3300046531 Ga0495665_0030427 Ga0495665_0030427_702_1451 249
513 3300046533 Ga0495640_0081785 Ga0495640_0081785_175_924 249
514 3300046535 Ga0495586_0013497 Ga0495586_0013497_212_961 249
515 3300046642 Ga0495634_0025540 Ga0495634_0025540_1110_1859 249
516 3300046663 Ga0495635_0008015 Ga0495635_0008015_4315_5064 249
517 3300046675 Ga0495657_0016932 Ga0495657_0016932_764_1513 249
518 3300046679 Ga0495623_0242063 Ga0495623_0242063_187_936 249
519 3300046680 Ga0495646_0025699 Ga0495646_0025699_493_1242 249
520 3300046690 Ga0495624_0043025 Ga0495624_0043025_1638_2387 249
521 3300046694 Ga0495649_0009995 Ga0495649_0009995_3096_3845 249
522 3300046794 Ga0495589_0151510 Ga0495589_0151510_243_992 249
523 3300046809 Ga0495600_0027494 Ga0495600_0027494_2530_3279 249
524 3300047315 Ga0495581_0021875 Ga0495581_0021875_2709_3458 249
525 3300047319 Ga0495674_0103575 Ga0495674_0103575_275_1024 249
526 3300047322 Ga0495680_0498827 Ga0495680_0498827_48_797 249
527 3300047323 Ga0495683_0001457 Ga0495683_0001457_10824_11573 249
528 3300047323 Ga0495683_0004426 Ga0495683_0004426_2007_2756 249
529 3300047443 Ga0495687_005848 Ga0495687_005848_1495_2244 249
530 3300047443 Ga0495687_136491 Ga0495687_136491_68_817 249
531 3300047673 Ga0495593_0030056 Ga0495593_0030056_970_1719 249
532 3300048088 Ga0495602_0048216 Ga0495602_0048216_2281_3030 249
533 3300048089 Ga0495614_0044439 Ga0495614_0044439_187_936 249
534 3300048091 Ga0495626_0010962 Ga0495626_0010962_3737_4486 249
535 3300048091 Ga0495626_0012277 Ga0495626_0012277_2285_3034 249
536 3300048920 Ga0496117_0118451 Ga0496117_0118451_503_1252 249
537 3300048921 Ga0496118_0020234 Ga0496118_0020234_1535_2284 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

51

196

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9436 12 223
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9432 10 223
8g3l-assembly1.cif.gz_B bceab-s nucleotide free bces state 2 0.9385 12 220
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9351 10 222
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9342 10 223
ID Description Score Start End Superfamily
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9625 10 222 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9457 8 224 3.40.50.300
af_Q2G167_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9453 12 224 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9432 10 223 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9421 10 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382TKE5-F1-model_v4 ABC transporter domain-containing protein 0.9688 37 222 GO:0005524
GO:0016887
AF-A0A7V9TM51-F1-model_v4 ABC transporter ATP-binding protein 0.9663 27 222 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A0P6XHT0-F1-model_v4 ABC transporter ATP-binding protein 0.9639 13 224 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2P9ANQ0-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD (EC 3.6.3.-) 0.9611 6 223 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A5J6V1L1-F1-model_v4 ABC transporter ATP-binding protein 0.9578 7 222 GO:0003677
GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
87.7 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map