F460902

General Info

Members Datasets Scaffolds Average Seq Length
537 283 1074 195

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10852424|Ga0111539_108524242
Length 226
Sequence MAAIFHRACHSRVPVGVSWVEGNKILRREGREMPSTSTFRIPKAEVTGAYGALMKLFANKMLDGEFPDNGYVYFHNKPVLKAILSFERKVEKWDRLDEDLKSYAQLASAGVIGCSWCLDFGCFKAHNDGLDLDKVREVPRWRESDVFTPLERDVLEYAEAMTVTPPTVTDEMVAHLVAELGAPAVVELTQMVALENMRSRFNCAAGLQSQGYSDVCELPLAVPSHS

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
61 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
113 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
114 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
115 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
142 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
143 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
144 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
145 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
146 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
147 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
152 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
231 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
232 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
256 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
263 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
264 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
265 2643221561 Nocardioides sp. Root151 Isolate Unclassified
266 2643221615 Nocardioides sp. Root224 Isolate Unclassified
267 2643221641 Nocardioides sp. Root122 Isolate Unclassified
268 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
269 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
270 2643221696 Nocardioides sp. Root140 Isolate Unclassified
271 2643221711 Terrabacter sp. Root85 Isolate Unclassified
272 2738541305 Nocardioides sp. CF167 Isolate Unclassified
273 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
274 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
275 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
276 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
277 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
278 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
279 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
280 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
281 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
282 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
283 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.79
Metatranscriptomes 1.12
Isolates 4.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.95
Nodule 0.19
Rhizoplane 10.43
Rhizosphere 66.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10852424 3300009094 Bacteria 1060
2 JGI25406J46586_10015465 3300003203 Bacteria 3217
3 Ga0070658_11008428 3300005327 Bacteria 724
4 Ga0070666_10117069 3300005335 Bacteria 1846
5 Ga0068868_101348802 3300005338 Bacteria 664
6 Ga0070689_100603688 3300005340 Bacteria 951
7 Ga0070691_10525460 3300005341 Bacteria 688
8 Ga0070668_100057404 3300005347 Bacteria 3008
9 Ga0070674_100124694 3300005356 Bacteria 1911
10 Ga0070674_101061543 3300005356 Bacteria 713
11 Ga0070674_101140803 3300005356 Bacteria 690
12 Ga0070688_100266308 3300005365 Bacteria 1226
13 Ga0070659_100024214 3300005366 Bacteria 4652
14 Ga0070659_100224351 3300005366 Bacteria 1552
15 Ga0070659_100481653 3300005366 Bacteria 1056
16 Ga0070667_100173076 3300005367 Bacteria 1907
17 Ga0070709_10105035 3300005434 Bacteria 1888
18 Ga0070714_100766702 3300005435 Bacteria 933
19 Ga0070710_10013150 3300005437 Bacteria 4135
20 Ga0070701_10215159 3300005438 Bacteria 1143
21 Ga0070711_100036778 3300005439 Bacteria 3282
22 Ga0070700_100396399 3300005441 Bacteria 1036
23 Ga0070700_100463442 3300005441 Bacteria 967
24 Ga0070663_100329734 3300005455 Bacteria 1230
25 Ga0070663_101211091 3300005455 Bacteria 664
26 Ga0070685_10661048 3300005466 Bacteria 758
27 Ga0070707_100816234 3300005468 Bacteria 897
28 Ga0070698_100901087 3300005471 Bacteria 830
29 Ga0070679_100006635 3300005530 Bacteria 10790
30 Ga0070679_100822541 3300005530 Bacteria 872
31 Ga0070672_100237259 3300005543 Bacteria 1533
32 Ga0070696_100014304 3300005546 Bacteria 5321
33 Ga0070665_100963663 3300005548 Bacteria 865
34 Ga0068855_100227335 3300005563 Bacteria 2091
35 Ga0070664_100483918 3300005564 Bacteria 1139
36 Ga0070664_100929285 3300005564 Bacteria 816
37 Ga0068856_100656671 3300005614 Bacteria 1069
38 Ga0070702_100100285 3300005615 Bacteria 1775
39 Ga0070702_100118322 3300005615 Bacteria 1654
40 Ga0070702_100768165 3300005615 Bacteria 742
41 Ga0068852_100010849 3300005616 Bacteria 6828
42 Ga0068852_100317515 3300005616 Bacteria 1512
43 Ga0068852_101419901 3300005616 Bacteria 716
44 Ga0068861_101435142 3300005719 Bacteria 675
45 Ga0068860_100000578 3300005843 Bacteria 44029
46 Ga0068862_100412260 3300005844 Bacteria 1266
47 Ga0081455_10351727 3300005937 Bacteria 1039
48 Ga0081538_10138611 3300005981 Bacteria 1127
49 Ga0081539_10002358 3300005985 Bacteria 27118
50 Ga0081539_10003148 3300005985 Bacteria 20948
51 Ga0081539_10012325 3300005985 Bacteria 6609
52 Ga0081539_10021139 3300005985 Bacteria 4359
53 Ga0081539_10033886 3300005985 Bacteria 3100
54 Ga0081539_10042298 3300005985 Bacteria 2656
55 Ga0081539_10148814 3300005985 Bacteria 1129
56 Ga0070717_10007807 3300006028 Bacteria 7961
57 Ga0070717_10864232 3300006028 Bacteria 823
58 Ga0075365_10008185 3300006038 Bacteria 5915
59 Ga0075365_10008445 3300006038 Bacteria 5849
60 Ga0075365_10017444 3300006038 Bacteria 4392
61 Ga0075365_10092041 3300006038 Bacteria 2067
62 Ga0075365_10129795 3300006038 Bacteria 1744
63 Ga0075365_10174186 3300006038 Bacteria 1502
64 Ga0075365_10211102 3300006038 Bacteria 1361
65 Ga0075365_10240491 3300006038 Bacteria 1271
66 Ga0075365_10245515 3300006038 Bacteria 1258
67 Ga0075365_10409356 3300006038 Bacteria 957
68 Ga0075368_10006230 3300006042 Bacteria 4156
69 Ga0075368_10006944 3300006042 Bacteria 3982
70 Ga0075368_10029371 3300006042 Bacteria 2126
71 Ga0075368_10102634 3300006042 Bacteria 1175
72 Ga0075368_10289380 3300006042 Bacteria 705
73 Ga0075363_100004260 3300006048 Bacteria 6221
74 Ga0075363_100005391 3300006048 Bacteria 5684
75 Ga0075363_100017399 3300006048 Bacteria 3565
76 Ga0075363_100031757 3300006048 Bacteria 2739
77 Ga0075363_100064733 3300006048 Bacteria 1975
78 Ga0075363_100139169 3300006048 Bacteria 1366
79 Ga0075363_100141810 3300006048 Bacteria 1353
80 Ga0075364_10019676 3300006051 Bacteria 4239
81 Ga0075364_10077251 3300006051 Bacteria 2198
82 Ga0075364_10077631 3300006051 Bacteria 2192
83 Ga0075364_10104078 3300006051 Bacteria 1891
84 Ga0075364_10118161 3300006051 Bacteria 1773
85 Ga0075364_10131230 3300006051 Bacteria 1681
86 Ga0075364_10135174 3300006051 Bacteria 1656
87 Ga0075364_10206843 3300006051 Bacteria 1331
88 Ga0075364_10375594 3300006051 Bacteria 969
89 Ga0070716_100201950 3300006173 Bacteria 1322
90 Ga0070712_100005049 3300006175 Bacteria 8174
91 Ga0075362_10026505 3300006177 Bacteria 2476
92 Ga0075367_10004333 3300006178 Bacteria 6908
93 Ga0075367_10040460 3300006178 Bacteria 2721
94 Ga0075367_10060500 3300006178 Bacteria 2258
95 Ga0075367_10064302 3300006178 Bacteria 2194
96 Ga0075367_10077584 3300006178 Bacteria 2006
97 Ga0075367_10124866 3300006178 Bacteria 1588
98 Ga0075370_10012188 3300006353 Bacteria 4537
99 Ga0075370_10014015 3300006353 Bacteria 4269
100 Ga0075370_10069580 3300006353 Bacteria 2012
101 Ga0075428_100100249 3300006844 Bacteria 3158
102 Ga0075431_100000549 3300006847 Bacteria 31563
103 Ga0075431_100264958 3300006847 Bacteria 1743
104 Ga0075431_100415149 3300006847 Bacteria 1346
105 Ga0075429_100000823 3300006880 Bacteria 24344
106 Ga0075429_100009377 3300006880 Bacteria 8498
107 Ga0105244_10011217 3300009036 Bacteria 5391
108 Ga0105244_10073589 3300009036 Bacteria 1701
109 Ga0105250_10355739 3300009092 Bacteria 642
110 Ga0111539_10098526 3300009094 Bacteria 3433
111 Ga0111539_10370904 3300009094 Bacteria 1666
112 Ga0111539_11339656 3300009094 Bacteria 831
113 Ga0105245_10564124 3300009098 Bacteria 1162
114 Ga0105245_10675514 3300009098 Bacteria 1064
115 Ga0105247_10914285 3300009101 Bacteria 679
116 Ga0114129_10250436 3300009147 Bacteria 2378
117 Ga0114129_11976798 3300009147 Bacteria 706
118 Ga0105243_10005171 3300009148 Bacteria 10218
119 Ga0105243_10125275 3300009148 Bacteria 2172
120 Ga0105243_10423630 3300009148 Bacteria 1242
121 Ga0105243_10675128 3300009148 Bacteria 1004
122 Ga0105241_10076729 3300009174 Bacteria 2607
123 Ga0105238_10217170 3300009551 Bacteria 1888
124 Ga0105249_10161867 3300009553 Bacteria 2163
125 Ga0105030_106252 3300009987 Bacteria 1011
126 Ga0105028_114200 3300009993 Bacteria 845
127 Ga0105239_10054436 3300010375 Bacteria 4389
128 Ga0105246_10012623 3300011119 Bacteria 5276
129 Ga0105246_10459747 3300011119 Bacteria 1072
130 Ga0105246_10770715 3300011119 Bacteria 850
131 Ga0157370_10429882 3300013104 Bacteria 1214
132 Ga0157370_10552567 3300013104 Bacteria 1055
133 Ga0157369_10447243 3300013105 Bacteria 1338
134 Ga0157369_10589172 3300013105 Bacteria 1148
135 Ga0157374_11324797 3300013296 Bacteria 742
136 Ga0163162_10091754 3300013306 Bacteria 3121
137 Ga0163162_10131049 3300013306 Bacteria 2616
138 Ga0157372_10578665 3300013307 Bacteria 1309
139 Ga0157372_10628658 3300013307 Bacteria 1251
140 Ga0157375_10550383 3300013308 Bacteria 1315
141 Ga0163163_10117190 3300014325 Bacteria 2695
142 Ga0157380_10248204 3300014326 Bacteria 1609
143 Ga0157380_10503846 3300014326 Bacteria 1177
144 Ga0157380_10754853 3300014326 Bacteria 985
145 Ga0157377_10518995 3300014745 Bacteria 836
146 Ga0157377_10560178 3300014745 Bacteria 809
147 Ga0157379_10828304 3300014968 Bacteria 875
148 Ga0163161_10102918 3300017792 Bacteria 2127
149 Ga0163161_10304605 3300017792 Bacteria 1256
150 Ga0197907_11115886 3300020069 Bacteria 2522
151 Ga0197907_11165220 3300020069 Bacteria 1467
152 Ga0206355_1284026 3300020076 Bacteria 786
153 Ga0206350_11435542 3300020080 Bacteria 1410
154 Ga0224712_10008174 3300022467 Bacteria 3086
155 Ga0224712_10072285 3300022467 Bacteria 1404
156 Ga0207425_1003629 3300025245 Bacteria 4872
157 Ga0209129_1000068 3300025258 Bacteria 217385
158 Ga0209025_1000045 3300025294 Bacteria 349118
159 Ga0209051_1006969 3300025303 Bacteria 6268
160 Ga0207697_10017392 3300025315 Bacteria 2955
161 Ga0207692_10102085 3300025898 Bacteria 1576
162 Ga0207680_10072695 3300025903 Bacteria 2136
163 Ga0207705_10800285 3300025909 Bacteria 732
164 Ga0207654_10039468 3300025911 Bacteria 2656
165 Ga0207707_10228413 3300025912 Bacteria 1619
166 Ga0207707_10326197 3300025912 Bacteria 1325
167 Ga0207707_10672866 3300025912 Bacteria 871
168 Ga0207693_10701614 3300025915 Bacteria 784
169 Ga0207652_10000596 3300025921 Bacteria 36173
170 Ga0207664_10085948 3300025929 Bacteria 2568
171 Ga0207690_10691413 3300025932 Bacteria 838
172 Ga0207709_10127360 3300025935 Bacteria 1729
173 Ga0207665_10159195 3300025939 Bacteria 1623
174 Ga0207691_10482067 3300025940 Bacteria 1054
175 Ga0207661_10044130 3300025944 Bacteria 3522
176 Ga0207661_10069476 3300025944 Bacteria 2872
177 Ga0207661_10837615 3300025944 Bacteria 847
178 Ga0207679_10009195 3300025945 Bacteria 6317
179 Ga0207667_10104345 3300025949 Bacteria 2924
180 Ga0207712_10149878 3300025961 Bacteria 1800
181 Ga0207668_10043271 3300025972 Bacteria 3055
182 Ga0207668_10443164 3300025972 Bacteria 1107
183 Ga0207658_10154816 3300025986 Bacteria 1872
184 Ga0207677_11038067 3300026023 Bacteria 745
185 Ga0207678_10001445 3300026067 Bacteria 21828
186 Ga0207678_10553937 3300026067 Bacteria 1006
187 Ga0207678_10576148 3300026067 Bacteria 986
188 Ga0207708_10647501 3300026075 Bacteria 899
189 Ga0207708_10685823 3300026075 Bacteria 875
190 Ga0207702_10381156 3300026078 Bacteria 1356
191 Ga0207702_10486895 3300026078 Bacteria 1201
192 Ga0207674_10293983 3300026116 Bacteria 1573
193 Ga0207675_100482849 3300026118 Bacteria 1232
194 Ga0207698_10001762 3300026142 Bacteria 12625
195 Ga0207698_10126040 3300026142 Bacteria 2178
196 Ga0209813_10001796 3300027866 Bacteria 4833
197 Ga0209813_10028717 3300027866 Bacteria 1624
198 Ga0209813_10058342 3300027866 Bacteria 1226
199 Ga0268266_10145175 3300028379 Bacteria 2132
200 Ga0268266_10461846 3300028379 Bacteria 1208
201 Ga0268264_10000226 3300028381 Bacteria 109817
202 Ga0307512_10053164 3300030522 Bacteria 3223
203 Ga0316177_1210231 3300030731 Bacteria 694
204 Ga0316180_1131519 3300030736 Bacteria 749
205 Ga0316183_1207072 3300030742 Bacteria 821
206 Ga0307513_10043631 3300031456 Bacteria 4922
207 Ga0307408_100374549 3300031548 Bacteria 1215
208 Ga0307514_10097404 3300031649 Bacteria 2122
209 Ga0307405_10137422 3300031731 Bacteria 1699
210 Ga0307405_10266539 3300031731 Bacteria 1282
211 Ga0307405_10429410 3300031731 Bacteria 1042
212 Ga0307410_10047018 3300031852 Bacteria 2882
213 Ga0307410_10324329 3300031852 Bacteria 1223
214 Ga0307410_10548656 3300031852 Bacteria 958
215 Ga0307406_10063874 3300031901 Bacteria 2387
216 Ga0307406_10070476 3300031901 Bacteria 2289
217 Ga0307406_10823530 3300031901 Bacteria 785
218 Ga0307407_10247373 3300031903 Bacteria 1220
219 Ga0307407_10305359 3300031903 Bacteria 1111
220 Ga0307407_10614878 3300031903 Bacteria 810
221 Ga0307412_10196199 3300031911 Bacteria 1530
222 Ga0307412_10502340 3300031911 Bacteria 1010
223 Ga0307409_100017364 3300031995 Bacteria 4793
224 Ga0307409_100139817 3300031995 Bacteria 2084
225 Ga0307409_100235247 3300031995 Bacteria 1664
226 Ga0307409_100325128 3300031995 Bacteria 1441
227 Ga0307409_100575171 3300031995 Bacteria 1110
228 Ga0307409_101074898 3300031995 Bacteria 825
229 Ga0307409_101123187 3300031995 Bacteria 808
230 Ga0307416_100022377 3300032002 Bacteria 4562
231 Ga0307416_100940031 3300032002 Bacteria 966
232 Ga0307416_101099697 3300032002 Bacteria 899
233 Ga0307416_101153325 3300032002 Bacteria 880
234 Ga0307414_10236631 3300032004 Bacteria 1509
235 Ga0307414_10823364 3300032004 Bacteria 848
236 Ga0307414_10863552 3300032004 Bacteria 828
237 Ga0307414_11183872 3300032004 Bacteria 707
238 Ga0307415_100047591 3300032126 Bacteria 2887
239 Ga0307415_100070557 3300032126 Bacteria 2454
240 Ga0307415_100106478 3300032126 Bacteria 2070
241 Ga0307415_100319259 3300032126 Bacteria 1294
242 Ga0307415_100659989 3300032126 Bacteria 939
243 Ga0307415_100695223 3300032126 Bacteria 917
244 Ga0307415_100698176 3300032126 Bacteria 915
245 Ga0307415_100860712 3300032126 Bacteria 832
246 Ga0373953_0305107 3300035117 Bacteria 695
247 Ga0373943_0140665 3300035170 Bacteria 1300
248 Ga0373931_0383399 3300035691 Bacteria 887
249 Ga0373947_0068945 3300035725 Bacteria 2164
250 Ga0373937_0070192 3300036401 Bacteria 3231
251 Ga0395899_0154627 3300037312 Bacteria 1624
252 Ga0395900_0040692 3300037418 Bacteria 4790
253 Ga0395900_0092063 3300037418 Bacteria 3115
254 Ga0395900_0101804 3300037418 Bacteria 2950
255 Ga0395900_0125305 3300037418 Bacteria 2635
256 Ga0395900_0290920 3300037418 Bacteria 1622
257 Ga0395900_0633096 3300037418 Bacteria 1008
258 Ga0395898_0100676 3300037466 Bacteria 2775
259 Ga0395898_0132691 3300037466 Bacteria 2385
260 Ga0395898_0570557 3300037466 Bacteria 1074
261 Ga0395898_0609265 3300037466 Bacteria 1035
262 Ga0395898_0633645 3300037466 Bacteria 1012
263 Ga0395905_0170198 3300037471 Bacteria 2046
264 Ga0395905_0299597 3300037471 Bacteria 1495
265 Ga0436364_0406268 3300037853 Bacteria 1218
266 Ga0395901_0129508 3300038443 Bacteria 2652
267 Ga0395901_0133749 3300038443 Bacteria 2606
268 Ga0395901_0166355 3300038443 Bacteria 2315
269 Ga0395901_0472328 3300038443 Bacteria 1280
270 Ga0436365_1024213 3300039437 Bacteria 1052
271 Ga0436363_1641931 3300039450 Bacteria 862
272 Ga0451793_1701285 3300041452 Bacteria 1436
273 Ga0451797_0815514 3300041453 Bacteria 964
274 Ga0451795_0247030 3300041456 Bacteria 624
275 Ga0451795_1639384 3300041456 Bacteria 885
276 Ga0451798_0170431 3300041458 Bacteria 746
277 Ga0451837_0745280 3300041494 Bacteria 835
278 Ga0451847_0089042 3300041503 Bacteria 767
279 Ga0451843_1277382 3300041509 Bacteria 758
280 Ga0439442_026406 3300042002 Bacteria 1208
281 Ga0439442_057649 3300042002 Bacteria 822
282 Ga0439448_0144101 3300042005 Bacteria 825
283 Ga0439449_0028068 3300042007 Bacteria 2098
284 Ga0439452_039513 3300042010 Bacteria 1117
285 Ga0450903_001014 3300042138 Bacteria 5385
286 Ga0439458_0011676 3300042157 Bacteria 1965
287 Ga0439434_0052924 3300042435 Bacteria 1261
288 Ga0466965_0006751 3300044683 Bacteria 5236
289 Ga0466965_0100555 3300044683 Bacteria 1478
290 Ga0466965_0114196 3300044683 Bacteria 1390
291 Ga0466961_0176568 3300044693 Bacteria 1327
292 Ga0466963_0318845 3300044694 Bacteria 1094
293 Ga0466963_0637521 3300044694 Bacteria 752
294 Ga0466970_0066793 3300044765 Bacteria 1931
295 Ga0466970_0230982 3300044765 Bacteria 1034
296 Ga0466970_0343311 3300044765 Bacteria 846
297 Ga0466960_0103038 3300044901 Bacteria 1473
298 Ga0466960_0162716 3300044901 Bacteria 1199
299 Ga0466960_0229160 3300044901 Bacteria 1025
300 Ga0466960_0394092 3300044901 Bacteria 796
301 Ga0466959_0021275 3300045049 Bacteria 4783
302 Ga0466967_0009531 3300045976 Bacteria 7211
303 Ga0466967_0222068 3300045976 Bacteria 1796
304 Ga0466967_0254614 3300045976 Bacteria 1678
305 Ga0466967_1195984 3300045976 Bacteria 757
306 Ga0495651_0079276 3300046462 Bacteria 2482
307 Ga0495653_0258229 3300046463 Bacteria 1153
308 Ga0495608_0090605 3300046511 Bacteria 1978
309 Ga0495620_0057589 3300046515 Bacteria 1630
310 Ga0495628_0039956 3300046516 Bacteria 3751
311 Ga0495628_0541335 3300046516 Bacteria 837
312 Ga0495652_0090281 3300046529 Bacteria 2507
313 Ga0495665_0323996 3300046531 Bacteria 787
314 Ga0495640_0047762 3300046533 Bacteria 2961
315 Ga0495587_0352638 3300046536 Bacteria 820
316 Ga0495645_0138263 3300046543 Bacteria 1702
317 Ga0495645_0242896 3300046543 Bacteria 1201
318 Ga0495667_0006779 3300046559 Bacteria 7772
319 Ga0495634_0112485 3300046642 Bacteria 1750
320 Ga0495625_0054235 3300046660 Bacteria 2864
321 Ga0495635_0087546 3300046663 Bacteria 2131
322 Ga0495635_0237629 3300046663 Bacteria 1230
323 Ga0495657_0009464 3300046675 Bacteria 7378
324 Ga0495599_0316463 3300046678 Bacteria 940
325 Ga0495646_0033965 3300046680 Bacteria 3170
326 Ga0495658_0350441 3300046683 Bacteria 938
327 Ga0495613_0277262 3300046689 Bacteria 1165
328 Ga0495671_0122786 3300046692 Bacteria 1267
329 Ga0495600_0011655 3300046809 Bacteria 5483
330 Ga0495604_0015715 3300047317 Bacteria 6040
331 Ga0495674_0777977 3300047319 Bacteria 746
332 Ga0495676_0246464 3300047321 Bacteria 1221
333 Ga0495684_0017430 3300047471 Bacteria 5530
334 Ga0495602_0028993 3300048088 Bacteria 5284
335 Ga0496100_0143859 3300048903 Bacteria 1693
336 Ga0496100_0169267 3300048903 Bacteria 1572
337 Ga0496100_0477071 3300048903 Bacteria 959
338 Ga0496101_0005319 3300048904 Bacteria 8197
339 Ga0496101_0034064 3300048904 Bacteria 3596
340 Ga0496101_0101238 3300048904 Bacteria 2157
341 Ga0496102_0006313 3300048905 Bacteria 10105
342 Ga0496102_0009007 3300048905 Bacteria 8566
343 Ga0496102_0845401 3300048905 Bacteria 837
344 Ga0496102_0961509 3300048905 Bacteria 775
345 Ga0496102_1015507 3300048905 Bacteria 750
346 Ga0496102_1464242 3300048905 Bacteria 602
347 Ga0496103_0061989 3300048906 Bacteria 2327
348 Ga0496103_0230822 3300048906 Bacteria 1190
349 Ga0496104_0005944 3300048907 Bacteria 10685
350 Ga0496104_0009637 3300048907 Bacteria 8600
351 Ga0496104_0131379 3300048907 Bacteria 2405
352 Ga0496104_0213872 3300048907 Bacteria 1839
353 Ga0496105_0025655 3300048908 Bacteria 4799
354 Ga0496105_0032143 3300048908 Bacteria 4305
355 Ga0496105_0063708 3300048908 Bacteria 3041
356 Ga0496105_0329133 3300048908 Bacteria 1223
357 Ga0496106_0079782 3300048909 Bacteria 2513
358 Ga0496106_0100962 3300048909 Bacteria 2238
359 Ga0496107_0046251 3300048910 Bacteria 3132
360 Ga0496107_0121568 3300048910 Bacteria 1924
361 Ga0496107_0127675 3300048910 Bacteria 1876
362 Ga0496107_0165204 3300048910 Bacteria 1641
363 Ga0496108_0070593 3300048911 Bacteria 2948
364 Ga0496108_0194700 3300048911 Bacteria 1758
365 Ga0496108_0358112 3300048911 Bacteria 1273
366 Ga0496108_1097608 3300048911 Bacteria 676
367 Ga0496109_0128971 3300048912 Bacteria 2360
368 Ga0496109_0249084 3300048912 Bacteria 1673
369 Ga0496109_0291574 3300048912 Bacteria 1538
370 Ga0496109_0391360 3300048912 Bacteria 1313
371 Ga0496109_0414785 3300048912 Bacteria 1272
372 Ga0496110_0119353 3300048913 Bacteria 2375
373 Ga0496111_0021292 3300048914 Bacteria 4524
374 Ga0496111_0216281 3300048914 Bacteria 1423
375 Ga0496111_0465256 3300048914 Bacteria 932
376 Ga0496112_0004018 3300048915 Bacteria 12333
377 Ga0496113_0215582 3300048916 Bacteria 1529
378 Ga0496113_0252425 3300048916 Bacteria 1408
379 Ga0496114_0074405 3300048917 Bacteria 2859
380 Ga0496114_0074430 3300048917 Bacteria 2859
381 Ga0496114_0079511 3300048917 Bacteria 2767
382 Ga0496114_0083309 3300048917 Bacteria 2705
383 Ga0496114_0127421 3300048917 Bacteria 2195
384 Ga0496114_0377314 3300048917 Bacteria 1255
385 Ga0496114_0535770 3300048917 Bacteria 1035
386 Ga0496119_0015617 3300048922 Bacteria 5830
387 Ga0496119_0054591 3300048922 Bacteria 2432
388 Ga0496121_0076943 3300048924 Bacteria 2659
389 Ga0496122_0213673 3300048925 Bacteria 1114
390 Ga0496124_0222593 3300048927 Bacteria 1418
391 Ga0496124_0248342 3300048927 Bacteria 1318
392 Ga0496124_0330990 3300048927 Bacteria 1086
393 Ga0496125_0017445 3300048928 Bacteria 6843
394 Ga0501295_042958 3300049518 Bacteria 944
395 Ga0501031_0147576 3300049568 Bacteria 1537
396 Ga0501033_0000653 3300049570 Bacteria 32031
397 Ga0501034_0013729 3300049571 Bacteria 8332
398 Ga0501034_0020124 3300049571 Bacteria 6813
399 Ga0501034_0548290 3300049571 Bacteria 1066
400 Ga0501036_0026528 3300049572 Bacteria 4891
401 Ga0501036_0230028 3300049572 Bacteria 1556
402 Ga0501037_0049627 3300049573 Bacteria 3073
403 Ga0501038_0000471 3300049574 Bacteria 35396
404 Ga0501039_0101270 3300049575 Bacteria 2248
405 Ga0501039_0213793 3300049575 Bacteria 1516
406 Ga0501039_0279918 3300049575 Bacteria 1311
407 Ga0501042_0050927 3300049578 Bacteria 2954
408 Ga0501042_0206683 3300049578 Bacteria 1416
409 Ga0501042_0796294 3300049578 Bacteria 688
410 Ga0501043_0414515 3300049579 Bacteria 1016
411 Ga0501043_0687271 3300049579 Bacteria 748
412 Ga0501043_0777484 3300049579 Bacteria 694
413 Ga0501046_0006182 3300049580 Bacteria 10633
414 Ga0501047_0004082 3300049581 Bacteria 13735
415 Ga0501048_0292625 3300049582 Bacteria 1158
416 Ga0501048_0500238 3300049582 Bacteria 871
417 Ga0501067_0066331 3300049583 Bacteria 1998
418 Ga0501067_0123919 3300049583 Bacteria 1438
419 Ga0501067_0180198 3300049583 Bacteria 1177
420 Ga0501067_0318385 3300049583 Bacteria 866
421 Ga0501068_0035552 3300049584 Bacteria 2974
422 Ga0501068_0153362 3300049584 Bacteria 1449
423 Ga0501069_0012245 3300049585 Bacteria 4558
424 Ga0501069_0037990 3300049585 Bacteria 2657
425 Ga0501069_0114081 3300049585 Bacteria 1541
426 Ga0501069_0163284 3300049585 Bacteria 1283
427 Ga0501069_0188438 3300049585 Bacteria 1193
428 Ga0501070_0012570 3300049586 Bacteria 7141
429 Ga0501070_0013880 3300049586 Bacteria 6784
430 Ga0501070_0438282 3300049586 Bacteria 1054
431 Ga0501071_0183130 3300049587 Bacteria 1570
432 Ga0501071_0221310 3300049587 Bacteria 1424
433 Ga0501072_0041623 3300049588 Bacteria 3609
434 Ga0501072_0108940 3300049588 Bacteria 2204
435 Ga0501072_0117102 3300049588 Bacteria 2122
436 Ga0501072_0952425 3300049588 Bacteria 670
437 Ga0501073_0031886 3300049589 Bacteria 3760
438 Ga0501073_0160536 3300049589 Bacteria 1557
439 Ga0501074_0042386 3300049590 Bacteria 3293
440 Ga0501074_0116797 3300049590 Bacteria 1909
441 Ga0501074_0242576 3300049590 Bacteria 1282
442 Ga0501075_0164287 3300049591 Bacteria 1694
443 Ga0501075_0982517 3300049591 Bacteria 641
444 Ga0501199_011675 3300049650 Bacteria 952
445 Ga0501249_084704 3300049679 Bacteria 748
446 Ga0501245_071441 3300049708 Bacteria 654
447 Ga0501079_0203968 3300049741 Bacteria 1545
448 Ga0501079_0457224 3300049741 Bacteria 1003
449 Ga0501080_0054936 3300049742 Bacteria 3708
450 Ga0501080_0256722 3300049742 Bacteria 1593
451 Ga0501081_0679373 3300049743 Bacteria 773
452 Ga0501083_0134497 3300049744 Bacteria 1620
453 Ga0501270_049850 3300049767 Bacteria 755
454 Ga0501044_0053689 3300049823 Bacteria 4145
455 Ga0501045_0123845 3300049824 Bacteria 1920
456 Ga0501045_0140483 3300049824 Bacteria 1796
457 nmdc:mga03683_6999_c1 3300050489 Bacteria 3891
458 nmdc:mga03n38_170185_c1 3300050490 Bacteria 1109
459 nmdc:mga03n38_187390_c1 3300050490 Bacteria 1064
460 nmdc:mga03n38_190945_c1 3300050490 Bacteria 1055
461 nmdc:mga03n38_91431_c1 3300050490 Bacteria 1450
462 nmdc:mga00v17_129216_c1 3300050491 Bacteria 1613
463 nmdc:mga00v17_14879_c1 3300050491 Bacteria 4353
464 nmdc:mga00v17_176477_c1 3300050491 Bacteria 1378
465 nmdc:mga00v17_199947_c1 3300050491 Bacteria 1292
466 nmdc:mga00v17_24296_c1 3300050491 Bacteria 3514
467 nmdc:mga00v17_55635_c1 3300050491 Bacteria 2417
468 nmdc:mga00v17_56786_c1 3300050491 Bacteria 2394
469 nmdc:mga00v17_568112_c1 3300050491 Bacteria 733
470 nmdc:mga00v17_61409_c1 3300050491 Bacteria 2310
471 nmdc:mga0yw44_129773_c1 3300050492 Bacteria 1631
472 nmdc:mga0yw44_129836_c1 3300050492 Bacteria 1630
473 nmdc:mga0yw44_183528_c1 3300050492 Bacteria 1378
474 nmdc:mga0yw44_18482_c1 3300050492 Bacteria 3820
475 nmdc:mga0yw44_207691_c1 3300050492 Bacteria 1295
476 nmdc:mga0yw44_265264_c1 3300050492 Bacteria 1145
477 nmdc:mga0yw44_493331_c1 3300050492 Bacteria 831
478 nmdc:mga0yw44_61951_c1 3300050492 Bacteria 2296
479 nmdc:mga0yw44_7386_c1 3300050492 Bacteria 5403
480 nmdc:mga0yw44_826735_c1 3300050492 Bacteria 629
481 nmdc:mga0yw44_97308_c1 3300050492 Bacteria 1869
482 nmdc:mga06z11_244445_c1 3300050494 Bacteria 1055
483 nmdc:mga06z11_260578_c1 3300050494 Bacteria 1023
484 nmdc:mga06z11_378134_c1 3300050494 Bacteria 851
485 nmdc:mga06z11_42398_c1 3300050494 Bacteria 2283
486 nmdc:mga04h51_36527_c1 3300050495 Bacteria 1581
487 nmdc:mga04h51_6070_c1 3300050495 Bacteria 3114
488 nmdc:mga04h51_7032_c1 3300050495 Bacteria 2950
489 nmdc:mga07m45_11731_c1 3300050496 Bacteria 4611
490 nmdc:mga07m45_54887_c1 3300050496 Bacteria 2251
491 nmdc:mga07m45_67673_c1 3300050496 Bacteria 2030
492 nmdc:mga07m45_83004_c1 3300050496 Bacteria 1830
493 nmdc:mga05p37_176809_c1 3300050507 Bacteria 2600
494 nmdc:mga05p37_332266_c1 3300050507 Bacteria 1795
495 nmdc:mga09592_216_c1 3300050508 Bacteria 41559
496 nmdc:mga09592_24874_c1 3300050508 Bacteria 4952
497 nmdc:mga0qj67_363_c1 3300050509 Bacteria 31290
498 nmdc:mga06r32_1194432_c1 3300050510 Bacteria 707
499 nmdc:mga06r32_401641_c1 3300050510 Bacteria 1352
500 nmdc:mga06r32_452_c1 3300050510 Bacteria 34936
501 nmdc:mga08y16_565030_c1 3300050511 Bacteria 1150
502 Ga0495619_0023977 3300053085 Bacteria 3913
503 Ga0495619_0055764 3300053085 Bacteria 2618
504 Ga0495619_0226134 3300053085 Bacteria 1296
505 Ga0500644_0000192 3300053088 Bacteria 37965
506 Ga0500556_0002184 3300053104 Bacteria 6587
507 Ga0500593_002842 3300053117 Bacteria 6425
508 Ga0500594_0187720 3300053118 Bacteria 676
509 Ga0500616_0004085 3300053153 Bacteria 10600
510 Ga0500616_0114482 3300053153 Bacteria 1298
511 Ga0500630_125256 3300053159 Bacteria 1131
512 Ga0501084_1131735 3300054114 Bacteria 657
513 Ga0590075_011768 3300059424 Bacteria 2119
514 Ga0501082_0214110 3300060353 Bacteria 1676
515 Ga0501082_0953244 3300060353 Bacteria 750
516 2558905569 2558860112 Bacteria 9931328
517 2585305469 2582581313 Bacteria 10042643
518 2623586287 2622736626 Bacteria 7181580
519 2643824790 2643221561 Bacteria 4984412
520 2644093213 2643221615 Bacteria 5487866
521 2644229591 2643221641 Bacteria 4490190
522 2644322824 2643221657 Bacteria 5490246
523 2644505964 2643221690 Bacteria 4654705
524 2644536041 2643221696 Bacteria 5431823
525 2644608645 2643221711 Bacteria 4865335
526 2738868910 2738541305 Bacteria 4910150
527 2753267771 2751185782 Bacteria 11227053
528 2808872276 2808606365 Bacteria 4301966
529 2812330371 2811994874 Bacteria 5367947
530 2831935940 2831935698 Bacteria 5963223
531 2837184593 2837183177 Bacteria 4637169
532 2844851083 2844849076 Bacteria 4091819
533 2884796932 2884791551 Bacteria 8511252
534 2915769765 2915768154 Bacteria 8424322
535 2939649182 2939647034 Bacteria 4681660
536 2946027143 2946024296 Bacteria 3508095
537 8055412521 8055412473 Bacteria 6257500
538 Ga0111539_10852424
539 JGI25406J46586_10015465
540 Ga0070658_11008428
541 Ga0070666_10117069
542 Ga0068868_101348802
543 Ga0070689_100603688
544 Ga0070691_10525460
545 Ga0070668_100057404
546 Ga0070674_100124694
547 Ga0070674_101061543
548 Ga0070674_101140803
549 Ga0070688_100266308
550 Ga0070659_100024214
551 Ga0070659_100224351
552 Ga0070659_100481653
553 Ga0070667_100173076
554 Ga0070709_10105035
555 Ga0070714_100766702
556 Ga0070710_10013150
557 Ga0070701_10215159
558 Ga0070711_100036778
559 Ga0070700_100396399
560 Ga0070700_100463442
561 Ga0070663_100329734
562 Ga0070663_101211091
563 Ga0070685_10661048
564 Ga0070707_100816234
565 Ga0070698_100901087
566 Ga0070679_100006635
567 Ga0070679_100822541
568 Ga0070672_100237259
569 Ga0070696_100014304
570 Ga0070665_100963663
571 Ga0068855_100227335
572 Ga0070664_100483918
573 Ga0070664_100929285
574 Ga0068856_100656671
575 Ga0070702_100100285
576 Ga0070702_100118322
577 Ga0070702_100768165
578 Ga0068852_100010849
579 Ga0068852_100317515
580 Ga0068852_101419901
581 Ga0068861_101435142
582 Ga0068860_100000578
583 Ga0068862_100412260
584 Ga0081455_10351727
585 Ga0081538_10138611
586 Ga0081539_10002358
587 Ga0081539_10003148
588 Ga0081539_10012325
589 Ga0081539_10021139
590 Ga0081539_10033886
591 Ga0081539_10042298
592 Ga0081539_10148814
593 Ga0070717_10007807
594 Ga0070717_10864232
595 Ga0075365_10008185
596 Ga0075365_10008445
597 Ga0075365_10017444
598 Ga0075365_10092041
599 Ga0075365_10129795
600 Ga0075365_10174186
601 Ga0075365_10211102
602 Ga0075365_10240491
603 Ga0075365_10245515
604 Ga0075365_10409356
605 Ga0075368_10006230
606 Ga0075368_10006944
607 Ga0075368_10029371
608 Ga0075368_10102634
609 Ga0075368_10289380
610 Ga0075363_100004260
611 Ga0075363_100005391
612 Ga0075363_100017399
613 Ga0075363_100031757
614 Ga0075363_100064733
615 Ga0075363_100139169
616 Ga0075363_100141810
617 Ga0075364_10019676
618 Ga0075364_10077251
619 Ga0075364_10077631
620 Ga0075364_10104078
621 Ga0075364_10118161
622 Ga0075364_10131230
623 Ga0075364_10135174
624 Ga0075364_10206843
625 Ga0075364_10375594
626 Ga0070716_100201950
627 Ga0070712_100005049
628 Ga0075362_10026505
629 Ga0075367_10004333
630 Ga0075367_10040460
631 Ga0075367_10060500
632 Ga0075367_10064302
633 Ga0075367_10077584
634 Ga0075367_10124866
635 Ga0075370_10012188
636 Ga0075370_10014015
637 Ga0075370_10069580
638 Ga0075428_100100249
639 Ga0075431_100000549
640 Ga0075431_100264958
641 Ga0075431_100415149
642 Ga0075429_100000823
643 Ga0075429_100009377
644 Ga0105244_10011217
645 Ga0105244_10073589
646 Ga0105250_10355739
647 Ga0111539_10098526
648 Ga0111539_10370904
649 Ga0111539_11339656
650 Ga0105245_10564124
651 Ga0105245_10675514
652 Ga0105247_10914285
653 Ga0114129_10250436
654 Ga0114129_11976798
655 Ga0105243_10005171
656 Ga0105243_10125275
657 Ga0105243_10423630
658 Ga0105243_10675128
659 Ga0105241_10076729
660 Ga0105238_10217170
661 Ga0105249_10161867
662 Ga0105030_106252
663 Ga0105028_114200
664 Ga0105239_10054436
665 Ga0105246_10012623
666 Ga0105246_10459747
667 Ga0105246_10770715
668 Ga0157370_10429882
669 Ga0157370_10552567
670 Ga0157369_10447243
671 Ga0157369_10589172
672 Ga0157374_11324797
673 Ga0163162_10091754
674 Ga0163162_10131049
675 Ga0157372_10578665
676 Ga0157372_10628658
677 Ga0157375_10550383
678 Ga0163163_10117190
679 Ga0157380_10248204
680 Ga0157380_10503846
681 Ga0157380_10754853
682 Ga0157377_10518995
683 Ga0157377_10560178
684 Ga0157379_10828304
685 Ga0163161_10102918
686 Ga0163161_10304605
687 Ga0197907_11115886
688 Ga0197907_11165220
689 Ga0206355_1284026
690 Ga0206350_11435542
691 Ga0224712_10008174
692 Ga0224712_10072285
693 Ga0207425_1003629
694 Ga0209129_1000068
695 Ga0209025_1000045
696 Ga0209051_1006969
697 Ga0207697_10017392
698 Ga0207692_10102085
699 Ga0207680_10072695
700 Ga0207705_10800285
701 Ga0207654_10039468
702 Ga0207707_10228413
703 Ga0207707_10326197
704 Ga0207707_10672866
705 Ga0207693_10701614
706 Ga0207652_10000596
707 Ga0207664_10085948
708 Ga0207690_10691413
709 Ga0207709_10127360
710 Ga0207665_10159195
711 Ga0207691_10482067
712 Ga0207661_10044130
713 Ga0207661_10069476
714 Ga0207661_10837615
715 Ga0207679_10009195
716 Ga0207667_10104345
717 Ga0207712_10149878
718 Ga0207668_10043271
719 Ga0207668_10443164
720 Ga0207658_10154816
721 Ga0207677_11038067
722 Ga0207678_10001445
723 Ga0207678_10553937
724 Ga0207678_10576148
725 Ga0207708_10647501
726 Ga0207708_10685823
727 Ga0207702_10381156
728 Ga0207702_10486895
729 Ga0207674_10293983
730 Ga0207675_100482849
731 Ga0207698_10001762
732 Ga0207698_10126040
733 Ga0209813_10001796
734 Ga0209813_10028717
735 Ga0209813_10058342
736 Ga0268266_10145175
737 Ga0268266_10461846
738 Ga0268264_10000226
739 Ga0307512_10053164
740 Ga0316177_1210231
741 Ga0316180_1131519
742 Ga0316183_1207072
743 Ga0307513_10043631
744 Ga0307408_100374549
745 Ga0307514_10097404
746 Ga0307405_10137422
747 Ga0307405_10266539
748 Ga0307405_10429410
749 Ga0307410_10047018
750 Ga0307410_10324329
751 Ga0307410_10548656
752 Ga0307406_10063874
753 Ga0307406_10070476
754 Ga0307406_10823530
755 Ga0307407_10247373
756 Ga0307407_10305359
757 Ga0307407_10614878
758 Ga0307412_10196199
759 Ga0307412_10502340
760 Ga0307409_100017364
761 Ga0307409_100139817
762 Ga0307409_100235247
763 Ga0307409_100325128
764 Ga0307409_100575171
765 Ga0307409_101074898
766 Ga0307409_101123187
767 Ga0307416_100022377
768 Ga0307416_100940031
769 Ga0307416_101099697
770 Ga0307416_101153325
771 Ga0307414_10236631
772 Ga0307414_10823364
773 Ga0307414_10863552
774 Ga0307414_11183872
775 Ga0307415_100047591
776 Ga0307415_100070557
777 Ga0307415_100106478
778 Ga0307415_100319259
779 Ga0307415_100659989
780 Ga0307415_100695223
781 Ga0307415_100698176
782 Ga0307415_100860712
783 Ga0373953_0305107
784 Ga0373943_0140665
785 Ga0373931_0383399
786 Ga0373947_0068945
787 Ga0373937_0070192
788 Ga0395899_0154627
789 Ga0395900_0040692
790 Ga0395900_0092063
791 Ga0395900_0101804
792 Ga0395900_0125305
793 Ga0395900_0290920
794 Ga0395900_0633096
795 Ga0395898_0100676
796 Ga0395898_0132691
797 Ga0395898_0570557
798 Ga0395898_0609265
799 Ga0395898_0633645
800 Ga0395905_0170198
801 Ga0395905_0299597
802 Ga0436364_0406268
803 Ga0395901_0129508
804 Ga0395901_0133749
805 Ga0395901_0166355
806 Ga0395901_0472328
807 Ga0436365_1024213
808 Ga0436363_1641931
809 Ga0451793_1701285
810 Ga0451797_0815514
811 Ga0451795_0247030
812 Ga0451795_1639384
813 Ga0451798_0170431
814 Ga0451837_0745280
815 Ga0451847_0089042
816 Ga0451843_1277382
817 Ga0439442_026406
818 Ga0439442_057649
819 Ga0439448_0144101
820 Ga0439449_0028068
821 Ga0439452_039513
822 Ga0450903_001014
823 Ga0439458_0011676
824 Ga0439434_0052924
825 Ga0466965_0006751
826 Ga0466965_0100555
827 Ga0466965_0114196
828 Ga0466961_0176568
829 Ga0466963_0318845
830 Ga0466963_0637521
831 Ga0466970_0066793
832 Ga0466970_0230982
833 Ga0466970_0343311
834 Ga0466960_0103038
835 Ga0466960_0162716
836 Ga0466960_0229160
837 Ga0466960_0394092
838 Ga0466959_0021275
839 Ga0466967_0009531
840 Ga0466967_0222068
841 Ga0466967_0254614
842 Ga0466967_1195984
843 Ga0495651_0079276
844 Ga0495653_0258229
845 Ga0495608_0090605
846 Ga0495620_0057589
847 Ga0495628_0039956
848 Ga0495628_0541335
849 Ga0495652_0090281
850 Ga0495665_0323996
851 Ga0495640_0047762
852 Ga0495587_0352638
853 Ga0495645_0138263
854 Ga0495645_0242896
855 Ga0495667_0006779
856 Ga0495634_0112485
857 Ga0495625_0054235
858 Ga0495635_0087546
859 Ga0495635_0237629
860 Ga0495657_0009464
861 Ga0495599_0316463
862 Ga0495646_0033965
863 Ga0495658_0350441
864 Ga0495613_0277262
865 Ga0495671_0122786
866 Ga0495600_0011655
867 Ga0495604_0015715
868 Ga0495674_0777977
869 Ga0495676_0246464
870 Ga0495684_0017430
871 Ga0495602_0028993
872 Ga0496100_0143859
873 Ga0496100_0169267
874 Ga0496100_0477071
875 Ga0496101_0005319
876 Ga0496101_0034064
877 Ga0496101_0101238
878 Ga0496102_0006313
879 Ga0496102_0009007
880 Ga0496102_0845401
881 Ga0496102_0961509
882 Ga0496102_1015507
883 Ga0496102_1464242
884 Ga0496103_0061989
885 Ga0496103_0230822
886 Ga0496104_0005944
887 Ga0496104_0009637
888 Ga0496104_0131379
889 Ga0496104_0213872
890 Ga0496105_0025655
891 Ga0496105_0032143
892 Ga0496105_0063708
893 Ga0496105_0329133
894 Ga0496106_0079782
895 Ga0496106_0100962
896 Ga0496107_0046251
897 Ga0496107_0121568
898 Ga0496107_0127675
899 Ga0496107_0165204
900 Ga0496108_0070593
901 Ga0496108_0194700
902 Ga0496108_0358112
903 Ga0496108_1097608
904 Ga0496109_0128971
905 Ga0496109_0249084
906 Ga0496109_0291574
907 Ga0496109_0391360
908 Ga0496109_0414785
909 Ga0496110_0119353
910 Ga0496111_0021292
911 Ga0496111_0216281
912 Ga0496111_0465256
913 Ga0496112_0004018
914 Ga0496113_0215582
915 Ga0496113_0252425
916 Ga0496114_0074405
917 Ga0496114_0074430
918 Ga0496114_0079511
919 Ga0496114_0083309
920 Ga0496114_0127421
921 Ga0496114_0377314
922 Ga0496114_0535770
923 Ga0496119_0015617
924 Ga0496119_0054591
925 Ga0496121_0076943
926 Ga0496122_0213673
927 Ga0496124_0222593
928 Ga0496124_0248342
929 Ga0496124_0330990
930 Ga0496125_0017445
931 Ga0501295_042958
932 Ga0501031_0147576
933 Ga0501033_0000653
934 Ga0501034_0013729
935 Ga0501034_0020124
936 Ga0501034_0548290
937 Ga0501036_0026528
938 Ga0501036_0230028
939 Ga0501037_0049627
940 Ga0501038_0000471
941 Ga0501039_0101270
942 Ga0501039_0213793
943 Ga0501039_0279918
944 Ga0501042_0050927
945 Ga0501042_0206683
946 Ga0501042_0796294
947 Ga0501043_0414515
948 Ga0501043_0687271
949 Ga0501043_0777484
950 Ga0501046_0006182
951 Ga0501047_0004082
952 Ga0501048_0292625
953 Ga0501048_0500238
954 Ga0501067_0066331
955 Ga0501067_0123919
956 Ga0501067_0180198
957 Ga0501067_0318385
958 Ga0501068_0035552
959 Ga0501068_0153362
960 Ga0501069_0012245
961 Ga0501069_0037990
962 Ga0501069_0114081
963 Ga0501069_0163284
964 Ga0501069_0188438
965 Ga0501070_0012570
966 Ga0501070_0013880
967 Ga0501070_0438282
968 Ga0501071_0183130
969 Ga0501071_0221310
970 Ga0501072_0041623
971 Ga0501072_0108940
972 Ga0501072_0117102
973 Ga0501072_0952425
974 Ga0501073_0031886
975 Ga0501073_0160536
976 Ga0501074_0042386
977 Ga0501074_0116797
978 Ga0501074_0242576
979 Ga0501075_0164287
980 Ga0501075_0982517
981 Ga0501199_011675
982 Ga0501249_084704
983 Ga0501245_071441
984 Ga0501079_0203968
985 Ga0501079_0457224
986 Ga0501080_0054936
987 Ga0501080_0256722
988 Ga0501081_0679373
989 Ga0501083_0134497
990 Ga0501270_049850
991 Ga0501044_0053689
992 Ga0501045_0123845
993 Ga0501045_0140483
994 nmdc:mga03683_6999_c1
995 nmdc:mga03n38_170185_c1
996 nmdc:mga03n38_187390_c1
997 nmdc:mga03n38_190945_c1
998 nmdc:mga03n38_91431_c1
999 nmdc:mga00v17_129216_c1
1000 nmdc:mga00v17_14879_c1
1001 nmdc:mga00v17_176477_c1
1002 nmdc:mga00v17_199947_c1
1003 nmdc:mga00v17_24296_c1
1004 nmdc:mga00v17_55635_c1
1005 nmdc:mga00v17_56786_c1
1006 nmdc:mga00v17_568112_c1
1007 nmdc:mga00v17_61409_c1
1008 nmdc:mga0yw44_129773_c1
1009 nmdc:mga0yw44_129836_c1
1010 nmdc:mga0yw44_183528_c1
1011 nmdc:mga0yw44_18482_c1
1012 nmdc:mga0yw44_207691_c1
1013 nmdc:mga0yw44_265264_c1
1014 nmdc:mga0yw44_493331_c1
1015 nmdc:mga0yw44_61951_c1
1016 nmdc:mga0yw44_7386_c1
1017 nmdc:mga0yw44_826735_c1
1018 nmdc:mga0yw44_97308_c1
1019 nmdc:mga06z11_244445_c1
1020 nmdc:mga06z11_260578_c1
1021 nmdc:mga06z11_378134_c1
1022 nmdc:mga06z11_42398_c1
1023 nmdc:mga04h51_36527_c1
1024 nmdc:mga04h51_6070_c1
1025 nmdc:mga04h51_7032_c1
1026 nmdc:mga07m45_11731_c1
1027 nmdc:mga07m45_54887_c1
1028 nmdc:mga07m45_67673_c1
1029 nmdc:mga07m45_83004_c1
1030 nmdc:mga05p37_176809_c1
1031 nmdc:mga05p37_332266_c1
1032 nmdc:mga09592_216_c1
1033 nmdc:mga09592_24874_c1
1034 nmdc:mga0qj67_363_c1
1035 nmdc:mga06r32_1194432_c1
1036 nmdc:mga06r32_401641_c1
1037 nmdc:mga06r32_452_c1
1038 nmdc:mga08y16_565030_c1
1039 Ga0495619_0023977
1040 Ga0495619_0055764
1041 Ga0495619_0226134
1042 Ga0500644_0000192
1043 Ga0500556_0002184
1044 Ga0500593_002842
1045 Ga0500594_0187720
1046 Ga0500616_0004085
1047 Ga0500616_0114482
1048 Ga0500630_125256
1049 Ga0501084_1131735
1050 Ga0590075_011768
1051 Ga0501082_0214110
1052 Ga0501082_0953244
1053 2558905569
1054 2585305469
1055 2623586287
1056 2643824790
1057 2644093213
1058 2644229591
1059 2644322824
1060 2644505964
1061 2644536041
1062 2644608645
1063 2738868910
1064 2753267771
1065 2808872276
1066 2812330371
1067 2831935940
1068 2837184593
1069 2844851083
1070 2884796932
1071 2915769765
1072 2939649182
1073 2946027143
1074 8055412521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

77

160

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9169 38 174
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8944 41 172
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.8832 38 175
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.882 41 172
6ohi-assembly1.cif.gz_B crystal structure of the debrominase bmp8 (apo) 0.8632 20 180
ID Description Score Start End Superfamily
af_O53377_388_550_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9358 18 177 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9155 38 174 1.20.1290.10
af_O53377_388_550_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.914 18 177 1.20.1290.10
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8879 37 178 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.885 47 175 1.20.1290.10
ID Description Score Start End GO Terms
AF-K8XN06-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9988 1 189 GO:0051920
AF-N1MD04-F1-model_v4 deleted 0.998 1 189
AF-A0A6J4Q8I4-F1-model_v4 Carboxymuconolactone decarboxylase 0.9922 51 192 GO:0016020
GO:0051920
AF-A0A402DVB0-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9908 1 189 GO:0051920
AF-A0A4Q8BDN7-F1-model_v4 Alkylhydroperoxidase family enzyme 0.9892 5 190 GO:0051920

Map