F460864

General Info

Members Datasets Scaffolds Average Seq Length
537 300 464 493

Family's Representative Sequence

Representative Sequence 3300003575|Ga0007409J51694_1030291|Ga0007409J51694_10302912
Length 509
Sequence MQSTISTFPPYLSLSVWLPILFGVIILAVGRDSRAGFTRVLSLVGAIVSFLPTIPLFTQFSNTAHGPQFVEKAAWIERFNIQYYLGIDGLSLWFVPLTAFITIIVVISAWQVIEERVAQYMGSFLLLSGLMIGVFVALDGLXFYFFFEATLIPMFIIIGVFGGPNRVYAAFKFFLYTFMGSLLTLIAIIYLYNKSGGSFDILTWHATKLTMKEQVLIFLAFLMAFAVKVPMWPVHTWLPDAHVEAPTGGSVVLAAIMLKLGGYGFLRFSLPIAPDASHYLAPLVIVLSLIAVIYIGLVAMVQADMKKLVAYSSIAHMGFVTLGFFIFNEIGVQGGIVQMISHGFVSGAMFLCIGVLYDRLHSRQIADYGGVVNVMPKFAAFSVLFAMANCGLPATSGFVGEFMVILGAVKFNFWTGFLAATALILGAAYSLWMVKRVVFGKIGNKHVAELTDLNGREFAMLGVLALLTIYMGLYPAPFTDTMQVSVADLLQHVSVSKLPAQAVATVAAH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
4 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
5 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
6 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
7 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
8 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
9 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
10 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
11 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
12 2643221556 Massilia sp. Root1485 Isolate Unclassified
13 2643221585 Pelomonas sp. Root662 Isolate Unclassified
14 2643221638 Duganella sp. Root336D2 Isolate Unclassified
15 2643221645 Massilia sp. Root351 Isolate Unclassified
16 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
17 2643221656 Pelomonas sp. Root405 Isolate Unclassified
18 2643221664 Massilia sp. Root418 Isolate Unclassified
19 2643221684 Massilia sp. Root133 Isolate Unclassified
20 2721755523 Delftia sp. HK171 Isolate Unclassified
21 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
22 2738541280 Massilia sp. GV090 Isolate Unclassified
23 2738541297 Duganella sp. GV083 Isolate Unclassified
24 2738541300 Massilia sp. GV016 Isolate Unclassified
25 2738541337 Pelomonas sp. BT06 Isolate Unclassified
26 2738541357 Duganella sp. GV053 Isolate Unclassified
27 2738543003 Duganella sp. GV066 Isolate Unclassified
28 2738543018 Massilia sp. GV045 Isolate Unclassified
29 2738543026 Duganella sp. GV089 Isolate Unclassified
30 2738543029 Duganella sp. GV039 Isolate Unclassified
31 2738543030 Massilia sp. GV097 Isolate Unclassified
32 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
33 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
34 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
35 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
36 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
37 2818991436 Collimonas arenae 515 Isolate Unclassified
38 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
39 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
40 2821131069 Duganella sp. 1224 Isolate Unclassified
41 2831864461 Roseateles noduli HZ7 Isolate Nodule
42 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
43 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
44 2842711865 Duganella sp. R-73148 Isolate Unclassified
45 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
46 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
47 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
48 2857553236 Duganella sp. R-74557 Isolate Unclassified
49 2857558681 Duganella sp. R-74565 Isolate Unclassified
50 2857564685 Duganella sp. R-74599 Isolate Unclassified
51 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
52 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
53 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
54 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
55 2885266251 Ralstonia sp. SET104 Isolate Nodule
56 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
57 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
58 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
59 2904424332 Duganella sp. 1411 Isolate Rhizosphere
60 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
61 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
62 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
63 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
64 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
65 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
66 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
67 2919476304 Duganella sp. 3397 Isolate Unclassified
68 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
69 2928058823 Ralstonia sp. 1138 Isolate Unclassified
70 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
71 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
72 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
73 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
74 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
75 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
76 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
77 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
78 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
79 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
80 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
81 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
82 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
83 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
84 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
85 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
86 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
87 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
88 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
90 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
91 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
92 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
93 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
94 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
95 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
96 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
97 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
98 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
99 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
100 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
101 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
102 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
103 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
104 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
105 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
106 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
107 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
108 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
132 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
142 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
143 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
146 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
147 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
175 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
193 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
194 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
195 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
196 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
197 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
198 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
199 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
209 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
223 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
264 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
267 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
268 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
269 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
270 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
289 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
292 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
297 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.1
Metatranscriptomes 1.3
Isolates 13.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.72
Nodule 2.42
Rhizoplane 1.68
Rhizosphere 52.7
Stem 0
Stem Tuber 0
Unclassified 20.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2988042 2162886007 Bacteria 3135
2 JGI25155J39150_1000393 3300002704 Bacteria 12298
3 JGI25155J39150_1000394 3300002704 Bacteria 12281
4 JGI25156J39149_1000539 3300002705 Bacteria 21759
5 JGI25156J39149_1007410 3300002705 Bacteria 2886
6 JGI25162J39368_1004799 3300002737 Bacteria 2952
7 JGI25154J39366_1000471 3300002738 Bacteria 21074
8 JGI25154J39366_1001331 3300002738 Bacteria 9086
9 JGI25154J39366_1001346 3300002738 Bacteria 9004
10 JGI25157J39369_1000359 3300002741 Bacteria 31770
11 JGI25152J39213_1000357 3300002773 Bacteria 28520
12 JGI25152J39213_1008780 3300002773 Bacteria 2470
13 JGI25150J39212_1002474 3300002774 Bacteria 4576
14 JGI25150J39212_1002693 3300002774 Bacteria 4330
15 JGI25159J45721_1000834 3300002987 Bacteria 13447
16 JGI25159J45721_1001302 3300002987 Bacteria 10528
17 JGI25159J45721_1003036 3300002987 Bacteria 6075
18 JGI25151J46595_10013227 3300003187 Bacteria 3722
19 JGI25151J46595_10013349 3300003187 Bacteria 3698
20 JGI25151J46595_10023698 3300003187 Bacteria 2522
21 JGI25151J46595_10042031 3300003187 Bacteria 1652
22 JGI25160J50197_1005594 3300003354 Bacteria 5205
23 JGI25161J50226_1000322 3300003374 Bacteria 26179
24 JGI25161J50226_1003674 3300003374 Bacteria 3434
25 Ga0007417J51691_1058351 3300003544 Bacteria 4356
26 Ga0007409J51694_1020585 3300003575 Bacteria 6160
27 Ga0007409J51694_1030291 3300003575 Bacteria 3274
28 Ga0007416J51690_1034843 3300003577 Bacteria 6530
29 Ga0032354_1056868 3300003693 Bacteria 5896
30 Ga0055538_1000155 3300003751 Bacteria 46426
31 Ga0055539_1000205 3300003752 Bacteria 46426
32 Ga0055533_1000207 3300003756 Bacteria 46426
33 Ga0055532_1000023 3300003758 Bacteria 248212
34 Ga0055525_1000001 3300003759 Bacteria 1016948
35 Ga0055525_1000284 3300003759 Bacteria 46426
36 Ga0055529_1000080 3300003763 Bacteria 148614
37 Ga0055526_1000137 3300003771 Bacteria 64902
38 Ga0055526_1000180 3300003771 Bacteria 55895
39 Ga0055526_1001704 3300003771 Bacteria 15350
40 Ga0055526_1011809 3300003771 Bacteria 3880
41 Ga0055537_1000012 3300003773 Bacteria 133761
42 Ga0055537_1007881 3300003773 Bacteria 2514
43 Ga0055524_1000021 3300003775 Bacteria 227578
44 Ga0055524_1000258 3300003775 Bacteria 53898
45 Ga0055536_1000020 3300003781 Bacteria 199649
46 Ga0055534_1000529 3300003784 Bacteria 20625
47 Ga0055534_1002536 3300003784 Bacteria 6268
48 Ga0055528_1000073 3300003790 Bacteria 77054
49 Ga0055528_1006103 3300003790 Bacteria 5505
50 Ga0055530_10004246 3300003791 Bacteria 7508
51 Ga0055530_10019014 3300003791 Bacteria 2094
52 Ga0055540_1000002 3300003792 Bacteria 436954
53 Ga0055531_10002602 3300003794 Bacteria 11955
54 Ga0055541_1000133 3300003841 Bacteria 46426
55 Ga0055543_1000538 3300004625 Bacteria 21337
56 Ga0065165_1000156 3300005262 Bacteria 119261
57 Ga0065165_1001776 3300005262 Bacteria 21337
58 Ga0065165_1005411 3300005262 Bacteria 7193
59 Ga0065714_10032348 3300005288 Bacteria 1760
60 Ga0065714_10076003 3300005288 Bacteria 2839
61 Ga0065704_10080256 3300005289 Bacteria 3979
62 Ga0068855_100004465 3300005563 Bacteria 17102
63 Ga0068855_100073072 3300005563 Bacteria 3985
64 Ga0068864_100047803 3300005618 Bacteria 3677
65 Ga0075367_10037878 3300006178 Bacteria 2804
66 Ga0075366_10000348 3300006195 Bacteria 21138
67 Ga0075370_10000386 3300006353 Bacteria 16251
68 Ga0075370_10002366 3300006353 Bacteria 8726
69 Ga0075370_10004983 3300006353 Bacteria 6531
70 Ga0079104_1000002 3300006946 Bacteria 514469
71 Ga0079104_1000017 3300006946 Bacteria 313784
72 Ga0099826_10000002 3300006948 Bacteria 1125830
73 Ga0099826_10000004 3300006948 Bacteria 802669
74 Ga0105244_10002910 3300009036 Bacteria 12645
75 Ga0105240_10005103 3300009093 Bacteria 19658
76 Ga0105240_10013785 3300009093 Bacteria 11074
77 Ga0105240_10059642 3300009093 Bacteria 4761
78 Ga0105243_10001518 3300009148 Bacteria 20292
79 Ga0105248_10000679 3300009177 Bacteria 38513
80 Ga0105239_10026742 3300010375 Bacteria 6351
81 Ga0157319_1000006 3300012497 Bacteria 361506
82 Ga0157373_10086989 3300013100 Bacteria 2202
83 Ga0157374_10154345 3300013296 Bacteria 2233
84 Ga0157378_10059823 3300013297 Bacteria 3400
85 Ga0163162_10122419 3300013306 Bacteria 2706
86 Ga0182008_10001210 3300014497 Bacteria 17771
87 Ga0182006_1000002 3300015261 Bacteria 887990
88 Ga0182006_1000026 3300015261 Bacteria 253543
89 Ga0182007_10000159 3300015262 Bacteria 46374
90 Ga0182005_1000002 3300015265 Bacteria 908499
91 Ga0182005_1000007 3300015265 Bacteria 490994
92 Ga0213872_10000028 3300021361 Bacteria 148766
93 Ga0213872_10000921 3300021361 Bacteria 20878
94 Ga0209435_100013 3300025206 Bacteria 366789
95 Ga0209435_100862 3300025206 Bacteria 4685
96 Ga0209436_100857 3300025208 Bacteria 12209
97 Ga0209436_107129 3300025208 Bacteria 2372
98 Ga0209784_100002 3300025224 Bacteria 1753105
99 Ga0209566_100003 3300025225 Bacteria 1753105
100 Ga0209674_100004 3300025226 Bacteria 1753105
101 Ga0209147_100030 3300025229 Bacteria 366789
102 Ga0209563_100006 3300025230 Bacteria 1753105
103 Ga0209563_100007 3300025230 Bacteria 1579402
104 Ga0209437_100265 3300025233 Bacteria 80495
105 Ga0209258_100205 3300025242 Bacteria 119727
106 Ga0207425_1000001 3300025245 Bacteria 2525432
107 Ga0207425_1000059 3300025245 Bacteria 146258
108 Ga0207425_1000143 3300025245 Bacteria 62334
109 Ga0209646_1000010 3300025246 Bacteria 573803
110 Ga0209646_1000034 3300025246 Bacteria 366789
111 Ga0209646_1000135 3300025246 Bacteria 124235
112 Ga0209026_1000022 3300025250 Bacteria 366789
113 Ga0209026_1002714 3300025250 Bacteria 6372
114 Ga0209677_100003 3300025253 Bacteria 1753105
115 Ga0209677_102467 3300025253 Bacteria 6934
116 Ga0209148_1001416 3300025254 Bacteria 12285
117 Ga0209759_1000018 3300025256 Bacteria 366789
118 Ga0209759_1000133 3300025256 Bacteria 126928
119 Ga0209129_1000001 3300025258 Bacteria 1452436
120 Ga0209565_1000057 3300025263 Bacteria 196908
121 Ga0209565_1000103 3300025263 Bacteria 127199
122 Ga0209565_1003973 3300025263 Bacteria 4618
123 Ga0209455_1000037 3300025272 Bacteria 464097
124 Ga0209673_1000051 3300025273 Bacteria 282161
125 Ga0209673_1010543 3300025273 Bacteria 3887
126 Ga0209673_1013180 3300025273 Bacteria 3281
127 Ga0209130_1000268 3300025284 Bacteria 65115
128 Ga0209130_1001032 3300025284 Bacteria 21351
129 Ga0209130_1003923 3300025284 Bacteria 5961
130 Ga0209675_1000027 3300025291 Bacteria 282175
131 Ga0209675_1001091 3300025291 Bacteria 16693
132 Ga0209675_1001094 3300025291 Bacteria 16654
133 Ga0209675_1002448 3300025291 Bacteria 9538
134 Ga0209675_1008313 3300025291 Bacteria 3836
135 Ga0209675_1009175 3300025291 Bacteria 3521
136 Ga0209676_1000066 3300025292 Bacteria 317897
137 Ga0209025_1000769 3300025294 Bacteria 53174
138 Ga0209025_1001052 3300025294 Bacteria 40294
139 Ga0209025_1001357 3300025294 Bacteria 32874
140 Ga0209025_1001845 3300025294 Bacteria 24883
141 Ga0209025_1002856 3300025294 Bacteria 17327
142 Ga0209564_1000003 3300025295 Bacteria 1585848
143 Ga0209564_1000009 3300025295 Bacteria 950196
144 Ga0209564_1000033 3300025295 Bacteria 446200
145 Ga0209564_1000094 3300025295 Bacteria 243176
146 Ga0209564_1002669 3300025295 Bacteria 13536
147 Ga0209564_1002778 3300025295 Bacteria 13094
148 Ga0209564_1005022 3300025295 Bacteria 7758
149 Ga0209564_1012823 3300025295 Bacteria 3617
150 Ga0209758_1000073 3300025297 Bacteria 276262
151 Ga0209758_1001766 3300025297 Bacteria 23985
152 Ga0209758_1009552 3300025297 Bacteria 5998
153 Ga0209050_1000046 3300025298 Bacteria 386466
154 Ga0209050_1002755 3300025298 Bacteria 14143
155 Ga0209256_1000011 3300025299 Bacteria 865309
156 Ga0209256_1000044 3300025299 Bacteria 337264
157 Ga0209256_1000139 3300025299 Bacteria 155515
158 Ga0209256_1001633 3300025299 Bacteria 21846
159 Ga0209256_1002336 3300025299 Bacteria 15823
160 Ga0209256_1003060 3300025299 Bacteria 12314
161 Ga0209256_1013855 3300025299 Bacteria 2958
162 Ga0207426_1001318 3300025302 Bacteria 21153
163 Ga0209051_1000024 3300025303 Bacteria 437007
164 Ga0209051_1012006 3300025303 Bacteria 4227
165 Ga0209051_1018141 3300025303 Bacteria 3122
166 Ga0209257_1000728 3300025304 Bacteria 49918
167 Ga0209257_1000818 3300025304 Bacteria 45122
168 Ga0207655_1011204 3300025728 Bacteria 5358
169 Ga0207655_1011702 3300025728 Bacteria 5196
170 Ga0207684_10004749 3300025910 Bacteria 12735
171 Ga0207695_10001528 3300025913 Bacteria 38261
172 Ga0207695_10003759 3300025913 Bacteria 21064
173 Ga0207671_10006035 3300025914 Bacteria 10935
174 Ga0207644_10023292 3300025931 Bacteria 4240
175 Ga0207706_10055514 3300025933 Bacteria 3493
176 Ga0207709_10000015 3300025935 Bacteria 493221
177 Ga0207704_10046413 3300025938 Bacteria 2589
178 Ga0207667_10000438 3300025949 Bacteria 55784
179 Ga0207667_10047663 3300025949 Bacteria 4534
180 Ga0207667_10056662 3300025949 Bacteria 4116
181 Ga0207703_10068125 3300026035 Bacteria 2932
182 Ga0207648_10060930 3300026089 Bacteria 3290
183 Ga0207676_10037754 3300026095 Bacteria 3683
184 Ga0207674_10064444 3300026116 Bacteria 3696
185 Ga0209281_1000007 3300027111 Bacteria 938265
186 Ga0209281_1000042 3300027111 Bacteria 344748
187 Ga0209282_1000001 3300027666 Bacteria 2450367
188 Ga0209282_1000015 3300027666 Bacteria 206531
189 Ga0307517_10000964 3300028786 Bacteria 48825
190 Ga0307515_10041872 3300028794 Bacteria 7186
191 Ga0307512_10022542 3300030522 Bacteria 5653
192 Ga0265316_10000126 3300031344 Bacteria 83546
193 Ga0265316_10158227 3300031344 Bacteria 1695
194 Ga0307509_10005272 3300031507 Bacteria 18096
195 Ga0307509_10006664 3300031507 Bacteria 15413
196 Ga0307509_10086510 3300031507 Bacteria 3223
197 Ga0307509_10091912 3300031507 Bacteria 3104
198 Ga0307408_100000079 3300031548 Bacteria 108053
199 Ga0307508_10000078 3300031616 Bacteria 113416
200 Ga0307508_10006353 3300031616 Bacteria 11119
201 Ga0265314_10016544 3300031711 Bacteria 5819
202 Ga0307406_10000132 3300031901 Bacteria 44227
203 Ga0307414_10013250 3300032004 Bacteria 4904
204 Ga0373932_0013051 3300035112 Bacteria 2059
205 Ga0373931_0001953 3300035691 Bacteria 9048
206 Ga0395899_0000505 3300037312 Bacteria 43367
207 Ga0395899_0038375 3300037312 Bacteria 3587
208 Ga0395899_0103479 3300037312 Bacteria 2053
209 Ga0395899_0127592 3300037312 Bacteria 1818
210 Ga0395900_0000297 3300037418 Bacteria 74817
211 Ga0395900_0044860 3300037418 Bacteria 4553
212 Ga0395905_0001653 3300037471 Bacteria 26363
213 Ga0395905_0004037 3300037471 Bacteria 15407
214 Ga0395905_0074484 3300037471 Bacteria 3181
215 Ga0395905_0232152 3300037471 Bacteria 1725
216 Ga0395901_0000182 3300038443 Bacteria 81583
217 Ga0395901_0078271 3300038443 Bacteria 3452
218 Ga0395901_0081311 3300038443 Bacteria 3384
219 Ga0395901_0129258 3300038443 Bacteria 2654
220 Ga0400484_19906 3300038725 Bacteria 5913
221 Ga0400484_26293 3300038725 Bacteria 16892
222 Ga0400484_44991 3300038725 Bacteria 27897
223 Ga0400490_03296 3300038726 Bacteria 55719
224 Ga0400490_55744 3300038726 Bacteria 86921
225 Ga0400491_16052 3300038727 Bacteria 3113
226 Ga0400485_01922 3300038735 Bacteria 62762
227 Ga0400485_03136 3300038735 Bacteria 8368
228 Ga0400488_04923 3300038741 Bacteria 3120
229 Ga0400488_16137 3300038741 Bacteria 3140
230 Ga0400488_31560 3300038741 Bacteria 10023
231 Ga0400486_14729 3300038742 Bacteria 36919
232 Ga0400486_23232 3300038742 Bacteria 285561
233 Ga0400483_065870 3300039062 Bacteria 4068
234 Ga0400483_138399 3300039062 Bacteria 15797
235 Ga0400483_156941 3300039062 Bacteria 5009
236 Ga0400483_219403 3300039062 Bacteria 3970
237 Ga0400483_288616 3300039062 Bacteria 10547
238 Ga0400487_07448 3300039110 Bacteria 27649
239 Ga0400487_30781 3300039110 Bacteria 38939
240 Ga0400487_33302 3300039110 Bacteria 7747
241 Ga0400487_56221 3300039110 Bacteria 43693
242 Ga0436361_0420505 3300039447 Bacteria 103715
243 Ga0436361_0459873 3300039447 Bacteria 8469
244 Ga0436361_0651547 3300039447 Bacteria 1633
245 Ga0436361_0687444 3300039447 Bacteria 109830
246 Ga0436361_0979661 3300039447 Bacteria 3406
247 Ga0451577_0000058 3300042876 Bacteria 272673
248 Ga0466965_0001346 3300044683 Bacteria 9854
249 Ga0466965_0013274 3300044683 Bacteria 3885
250 Ga0453684_0000279 3300044712 Bacteria 220016
251 Ga0453684_0000386 3300044712 Bacteria 180948
252 Ga0451576_0001076 3300045051 Bacteria 50068
253 Ga0451576_0001134 3300045051 Bacteria 48176
254 Ga0495617_000037 3300046452 Bacteria 134553
255 Ga0495617_000039 3300046452 Bacteria 128069
256 Ga0495617_000940 3300046452 Bacteria 13541
257 Ga0495617_014576 3300046452 Bacteria 2672
258 Ga0495617_032316 3300046452 Bacteria 1757
259 Ga0495627_000008 3300046453 Bacteria 572150
260 Ga0495592_0040881 3300046454 Bacteria 3477
261 Ga0495590_0000001 3300046457 Bacteria 762984
262 Ga0495590_0000422 3300046457 Bacteria 21374
263 Ga0495591_020765 3300046458 Bacteria 2160
264 Ga0495629_0012328 3300046459 Bacteria 6190
265 Ga0495638_0000184 3300046460 Bacteria 95341
266 Ga0495653_0000409 3300046463 Bacteria 34377
267 Ga0495653_0058579 3300046463 Bacteria 2927
268 Ga0495650_0000048 3300046471 Bacteria 334427
269 Ga0495650_0000292 3300046471 Bacteria 92418
270 Ga0495650_0000503 3300046471 Bacteria 58702
271 Ga0495650_0000529 3300046471 Bacteria 55633
272 Ga0495650_0000753 3300046471 Bacteria 40457
273 Ga0495580_0060967 3300046472 Bacteria 2649
274 Ga0495582_0021879 3300046473 Bacteria 3498
275 Ga0495605_0000587 3300046474 Bacteria 29155
276 Ga0495605_0000652 3300046474 Bacteria 26506
277 Ga0495605_0005275 3300046474 Bacteria 7543
278 Ga0495584_0000006 3300046491 Bacteria 301775
279 Ga0495584_0000679 3300046491 Bacteria 22629
280 Ga0495585_0000061 3300046492 Bacteria 110727
281 Ga0495585_0000070 3300046492 Bacteria 106156
282 Ga0495585_0023881 3300046492 Bacteria 3507
283 Ga0495585_0024797 3300046492 Bacteria 3437
284 Ga0495594_0024880 3300046499 Bacteria 3217
285 Ga0495594_0025571 3300046499 Bacteria 3173
286 Ga0495594_0082461 3300046499 Bacteria 1796
287 Ga0495596_0001262 3300046500 Bacteria 14661
288 Ga0495596_0010511 3300046500 Bacteria 4026
289 Ga0495607_0018560 3300046501 Bacteria 4432
290 Ga0495607_0018900 3300046501 Bacteria 4383
291 Ga0495583_0000035 3300046506 Bacteria 246849
292 Ga0495583_0000119 3300046506 Bacteria 133447
293 Ga0495583_0000515 3300046506 Bacteria 55250
294 Ga0495583_0000941 3300046506 Bacteria 33886
295 Ga0495583_0001016 3300046506 Bacteria 32027
296 Ga0495583_0005988 3300046506 Bacteria 8069
297 Ga0495606_0000011 3300046507 Bacteria 296816
298 Ga0495606_0000064 3300046507 Bacteria 183631
299 Ga0495606_0001038 3300046507 Bacteria 40221
300 Ga0495606_0001094 3300046507 Bacteria 38841
301 Ga0495610_0000003 3300046512 Bacteria 1203910
302 Ga0495610_0000147 3300046512 Bacteria 77304
303 Ga0495616_0000827 3300046513 Bacteria 22588
304 Ga0495620_0025575 3300046515 Bacteria 2790
305 Ga0495631_0010370 3300046518 Bacteria 4612
306 Ga0495632_0000250 3300046519 Bacteria 53467
307 Ga0495632_0007241 3300046519 Bacteria 7003
308 Ga0495632_0027933 3300046519 Bacteria 2948
309 Ga0495637_0000004 3300046520 Bacteria 589740
310 Ga0495637_0020306 3300046520 Bacteria 3058
311 Ga0495643_0000369 3300046522 Bacteria 61039
312 Ga0495643_0000432 3300046522 Bacteria 54506
313 Ga0495644_0015636 3300046523 Bacteria 2908
314 Ga0495648_0000001 3300046524 Bacteria 696872
315 Ga0495648_0000096 3300046524 Bacteria 110227
316 Ga0495648_0002588 3300046524 Bacteria 16566
317 Ga0495648_0008671 3300046524 Bacteria 7971
318 Ga0495648_0020089 3300046524 Bacteria 4672
319 Ga0495648_0037042 3300046524 Bacteria 3139
320 Ga0495663_0008293 3300046525 Bacteria 2877
321 Ga0495666_0012017 3300046526 Bacteria 4321
322 Ga0495642_0000366 3300046528 Bacteria 24393
323 Ga0495652_0004595 3300046529 Bacteria 13160
324 Ga0495654_0000028 3300046530 Bacteria 223384
325 Ga0495654_0019361 3300046530 Bacteria 3560
326 Ga0495586_0010568 3300046535 Bacteria 4911
327 Ga0495609_0000202 3300046538 Bacteria 59327
328 Ga0495609_0000731 3300046538 Bacteria 24981
329 Ga0495609_0002565 3300046538 Bacteria 11083
330 Ga0495609_0002717 3300046538 Bacteria 10671
331 Ga0495609_0005004 3300046538 Bacteria 7088
332 Ga0495609_0017469 3300046538 Bacteria 3331
333 Ga0495621_0022026 3300046539 Bacteria 2107
334 Ga0495597_0000131 3300046542 Bacteria 68056
335 Ga0495597_0002776 3300046542 Bacteria 10780
336 Ga0495597_0002786 3300046542 Bacteria 10751
337 Ga0495597_0020531 3300046542 Bacteria 3075
338 Ga0495622_0000068 3300046557 Bacteria 90633
339 Ga0495622_0001604 3300046557 Bacteria 11162
340 Ga0495633_0000188 3300046558 Bacteria 80806
341 Ga0495633_0001853 3300046558 Bacteria 15530
342 Ga0495633_0004162 3300046558 Bacteria 9298
343 Ga0495633_0005179 3300046558 Bacteria 8060
344 Ga0495633_0008046 3300046558 Bacteria 5994
345 Ga0495633_0017755 3300046558 Bacteria 3628
346 Ga0495656_0005295 3300046615 Bacteria 4444
347 Ga0495668_0000048 3300046616 Bacteria 217867
348 Ga0495668_0000487 3300046616 Bacteria 49686
349 Ga0495668_0001049 3300046616 Bacteria 29314
350 Ga0495668_0001239 3300046616 Bacteria 25630
351 Ga0495668_0025583 3300046616 Bacteria 3353
352 Ga0495668_0036389 3300046616 Bacteria 2758
353 Ga0495611_0001880 3300046648 Bacteria 10002
354 Ga0495625_0000483 3300046660 Bacteria 59571
355 Ga0495625_0000935 3300046660 Bacteria 39254
356 Ga0495625_0001295 3300046660 Bacteria 31401
357 Ga0495625_0025570 3300046660 Bacteria 4476
358 Ga0495625_0037644 3300046660 Bacteria 3546
359 Ga0495625_0090535 3300046660 Bacteria 2115
360 Ga0495661_0000894 3300046665 Bacteria 27503
361 Ga0495661_0069759 3300046665 Bacteria 2058
362 Ga0495588_0000174 3300046674 Bacteria 81329
363 Ga0495588_0031759 3300046674 Bacteria 2659
364 Ga0495623_0065068 3300046679 Bacteria 2280
365 Ga0495669_0000174 3300046684 Bacteria 40779
366 Ga0495670_0018769 3300046691 Bacteria 3406
367 Ga0495671_0000001 3300046692 Bacteria 1169494
368 Ga0495671_0047245 3300046692 Bacteria 2151
369 Ga0495649_0000355 3300046694 Bacteria 39453
370 Ga0495649_0012058 3300046694 Bacteria 5044
371 Ga0495649_0019390 3300046694 Bacteria 3822
372 Ga0495589_0000693 3300046794 Bacteria 21927
373 Ga0495589_0000990 3300046794 Bacteria 17241
374 Ga0495600_0017295 3300046809 Bacteria 4584
375 Ga0495660_0000157 3300046810 Bacteria 73772
376 Ga0495660_0000219 3300046810 Bacteria 57585
377 Ga0495660_0001182 3300046810 Bacteria 18406
378 Ga0495660_0025073 3300046810 Bacteria 3389
379 Ga0495604_0044028 3300047317 Bacteria 3490
380 Ga0495636_0003704 3300047318 Bacteria 5944
381 Ga0495674_0005713 3300047319 Bacteria 11916
382 Ga0495672_0000097 3300047320 Bacteria 141608
383 Ga0495672_0000126 3300047320 Bacteria 117782
384 Ga0495672_0000187 3300047320 Bacteria 89789
385 Ga0495672_0000259 3300047320 Bacteria 73356
386 Ga0495672_0060621 3300047320 Bacteria 2184
387 Ga0495680_0008880 3300047322 Bacteria 9087
388 Ga0495683_0000041 3300047323 Bacteria 137557
389 Ga0495683_0000214 3300047323 Bacteria 54728
390 Ga0495683_0018185 3300047323 Bacteria 3635
391 Ga0495683_0024135 3300047323 Bacteria 3122
392 Ga0495683_0063640 3300047323 Bacteria 1822
393 Ga0495687_000002 3300047443 Bacteria 1085770
394 Ga0495687_000017 3300047443 Bacteria 350429
395 Ga0495687_000215 3300047443 Bacteria 82752
396 Ga0495687_000457 3300047443 Bacteria 49882
397 Ga0495687_000604 3300047443 Bacteria 41982
398 Ga0495687_000702 3300047443 Bacteria 37364
399 Ga0495687_003298 3300047443 Bacteria 11858
400 Ga0495687_016481 3300047443 Bacteria 3714
401 Ga0495675_0039694 3300047444 Bacteria 2998
402 Ga0495677_0000259 3300047445 Bacteria 23264
403 Ga0495677_0001656 3300047445 Bacteria 8951
404 Ga0495677_0011116 3300047445 Bacteria 3294
405 Ga0495679_002551 3300047446 Bacteria 9192
406 Ga0495679_010017 3300047446 Bacteria 3752
407 Ga0495685_000019 3300047447 Bacteria 73831
408 Ga0495685_012418 3300047447 Bacteria 2886
409 Ga0495673_0000003 3300047469 Bacteria 1491337
410 Ga0495673_0000097 3300047469 Bacteria 182247
411 Ga0495673_0000100 3300047469 Bacteria 173962
412 Ga0495681_0011078 3300047470 Bacteria 5404
413 Ga0495686_0000356 3300047472 Bacteria 74751
414 Ga0495686_0005033 3300047472 Bacteria 10612
415 Ga0495686_0062246 3300047472 Bacteria 2315
416 Ga0495686_0086174 3300047472 Bacteria 1911
417 Ga0495626_0000016 3300048091 Bacteria 232214
418 Ga0495626_0000026 3300048091 Bacteria 207698
419 Ga0495626_0000640 3300048091 Bacteria 33839
420 Ga0495626_0002931 3300048091 Bacteria 11353
421 Ga0495626_0017960 3300048091 Bacteria 3564
422 Ga0495626_0027674 3300048091 Bacteria 2754
423 Ga0496101_0023866 3300048904 Bacteria 4228
424 Ga0496102_0000306 3300048905 Bacteria 62296
425 Ga0496102_0001202 3300048905 Bacteria 23500
426 Ga0496102_0096594 3300048905 Bacteria 2739
427 Ga0496103_0006849 3300048906 Bacteria 6803
428 Ga0496106_0047926 3300048909 Bacteria 3217
429 Ga0496115_0001055 3300048918 Bacteria 19985
430 Ga0496116_0055464 3300048919 Bacteria 2603
431 Ga0496117_0000001 3300048920 Bacteria 2526244
432 Ga0496118_0000002 3300048921 Bacteria 1690764
433 Ga0496121_0030639 3300048924 Bacteria 4936
434 Ga0496121_0035856 3300048924 Bacteria 4433
435 Ga0496122_0031517 3300048925 Bacteria 4411
436 Ga0496123_0000255 3300048926 Bacteria 107869
437 Ga0496123_0002772 3300048926 Bacteria 20912
438 Ga0496123_0033450 3300048926 Bacteria 3700
439 Ga0496124_0072216 3300048927 Bacteria 2858
440 Ga0496125_0001533 3300048928 Bacteria 33123
441 Ga0496125_0003323 3300048928 Bacteria 19645
442 Ga0496125_0004349 3300048928 Bacteria 16435
443 Ga0496125_0014630 3300048928 Bacteria 7628
444 Ga0496126_0078309 3300048929 Bacteria 2929
445 Ga0501308_000158 3300049128 Bacteria 3578
446 Ga0495678_000128 3300049459 Bacteria 89099
447 Ga0495678_002888 3300049459 Bacteria 11064
448 Ga0495678_016339 3300049459 Bacteria 3396
449 Ga0495678_018196 3300049459 Bacteria 3164
450 Ga0495682_0000094 3300049460 Bacteria 78278
451 Ga0495682_0007646 3300049460 Bacteria 4288
452 Ga0501034_0000588 3300049571 Bacteria 57446
453 Ga0501269_000442 3300049766 Bacteria 9231
454 Ga0501279_001390 3300049775 Bacteria 3161
455 Ga0501035_0002348 3300049822 Bacteria 18642
456 nmdc:mga0k408_1305_c1 3300050493 Bacteria 13485
457 nmdc:mga0k408_2846_c1 3300050493 Bacteria 9181
458 nmdc:mga0k408_5262_c1 3300050493 Bacteria 6873
459 nmdc:mga07m45_61_c1 3300050496 Bacteria 42628
460 nmdc:mga07m45_89789_c1 3300050496 Bacteria 1760
461 Ga0500618_000108 3300053125 Bacteria 67640
462 Ga0500559_0000059 3300053136 Bacteria 87846
463 Ga0500622_0001474 3300053156 Bacteria 18744
464 Ga0587082_000253 3300059504 Bacteria 3897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003187 JGI25151J46595_10023698 JGI25151J46595_100236983 384
2 3300037471 Ga0395905_0232152 Ga0395905_0232152_16_1251 392
3 3300046810 Ga0495660_0025073 Ga0495660_0025073_1456_2706 401
4 3300046501 Ga0495607_0018900 Ga0495607_0018900_712_2187 454
5 3300046513 Ga0495616_0000827 Ga0495616_0000827_19313_20794 456
6 3300046538 Ga0495609_0000731 Ga0495609_0000731_19313_20794 456
7 3300046665 Ga0495661_0000894 Ga0495661_0000894_6736_8217 456
8 3300046794 Ga0495589_0000693 Ga0495589_0000693_1135_2616 456
9 3300047443 Ga0495687_000457 Ga0495687_000457_29089_30570 456
10 3300047445 Ga0495677_0000259 Ga0495677_0000259_19313_20794 456
11 3300047472 Ga0495686_0086174 Ga0495686_0086174_401_1852 458
12 3300003773 Ga0055537_1007881 Ga0055537_10078812 460
13 3300003784 Ga0055534_1002536 Ga0055534_10025361 460
14 3300025263 Ga0209565_1000103 Ga0209565_100010335 460
15 3300025273 Ga0209673_1010543 Ga0209673_10105432 460
16 3300025291 Ga0209675_1001091 Ga0209675_100109110 460
17 3300025294 Ga0209025_1001357 Ga0209025_100135725 460
18 3300025295 Ga0209564_1005022 Ga0209564_10050226 460
19 3300025297 Ga0209758_1009552 Ga0209758_10095522 460
20 3300025299 Ga0209256_1001633 Ga0209256_100163311 460
21 3300046500 Ga0495596_0001262 Ga0495596_0001262_5880_7310 460
22 3300046499 Ga0495594_0082461 Ga0495594_0082461_35_1474 461
23 3300046538 Ga0495609_0002565 Ga0495609_0002565_1195_2628 461
24 3300046542 Ga0495597_0002776 Ga0495597_0002776_1721_3154 461
25 3300046542 Ga0495597_0020531 Ga0495597_0020531_333_1781 461
26 3300047443 Ga0495687_000002 Ga0495687_000002_1056295_1057731 461
27 3300047443 Ga0495687_000017 Ga0495687_000017_1218_2666 461
28 3300048909 Ga0496106_0047926 Ga0496106_0047926_196_1632 461
29 3300003187 JGI25151J46595_10042031 JGI25151J46595_100420311 462
30 3300003781 Ga0055536_1000020 Ga0055536_100002024 462
31 3300025291 Ga0209675_1001094 Ga0209675_100109410 462
32 3300025292 Ga0209676_1000066 Ga0209676_100006639 462
33 3300025294 Ga0209025_1001052 Ga0209025_10010522 462
34 3300025295 Ga0209564_1012823 Ga0209564_10128231 462
35 3300046535 Ga0495586_0010568 Ga0495586_0010568_1291_2787 462
36 3300046679 Ga0495623_0065068 Ga0495623_0065068_141_1637 462
37 3300013296 Ga0157374_10154345 Ga0157374_101543452 463
38 3300013297 Ga0157378_10059823 Ga0157378_100598232 463
39 3300025933 Ga0207706_10055514 Ga0207706_100555142 463
40 3300046474 Ga0495605_0000652 Ga0495605_0000652_74_1600 463
41 3300046674 Ga0495588_0000174 Ga0495588_0000174_42976_44502 463
42 3300046794 Ga0495589_0000990 Ga0495589_0000990_1693_3219 463
43 3300046810 Ga0495660_0000157 Ga0495660_0000157_43823_45349 463
44 3300047443 Ga0495687_000215 Ga0495687_000215_1647_3173 463
45 3300048091 Ga0495626_0000016 Ga0495626_0000016_222205_223731 463
46 3300048091 Ga0495626_0017960 Ga0495626_0017960_965_2467 463
47 3300048926 Ga0496123_0002772 Ga0496123_0002772_55_1578 463
48 3300049128 Ga0501308_000158 Ga0501308_000158_1943_3466 463
49 3300049766 Ga0501269_000442 Ga0501269_000442_1421_2857 463
50 iso_pu_bacteria 2839138175 2839139930 463
51 3300031548 Ga0307408_100000079 Ga0307408_10000007946 464
52 3300031901 Ga0307406_10000132 Ga0307406_100001328 464
53 3300048918 Ga0496115_0001055 Ga0496115_0001055_5564_7069 465
54 3300025294 Ga0209025_1000769 Ga0209025_100076913 466
55 3300046810 Ga0495660_0001182 Ga0495660_0001182_15901_17346 466
56 3300049571 Ga0501034_0000588 Ga0501034_0000588_54805_56271 466
57 3300025295 Ga0209564_1002778 Ga0209564_100277810 467
58 3300039447 Ga0436361_0979661 Ga0436361_0979661_664_2211 468
59 iso_pu_bacteria 2904439833 2904441526 468
60 iso_pu_bacteria 2904530477 2904531544 468
61 iso_pu_bacteria 2904584206 2904586819 468
62 iso_pu_bacteria 2904589729 2904593148 468
63 iso_pu_bacteria 2904601388 2904603006 468
64 iso_pu_bacteria 2919079590 2919083973 468
65 3300003751 Ga0055538_1000155 Ga0055538_100015544 469
66 3300003752 Ga0055539_1000205 Ga0055539_100020544 469
67 3300003756 Ga0055533_1000207 Ga0055533_100020744 469
68 3300003759 Ga0055525_1000284 Ga0055525_100028444 469
69 3300003841 Ga0055541_1000133 Ga0055541_10001335 469
70 3300005563 Ga0068855_100004465 Ga0068855_10000446511 469
71 3300009093 Ga0105240_10013785 Ga0105240_100137855 469
72 3300010375 Ga0105239_10026742 Ga0105239_100267425 469
73 3300025224 Ga0209784_100002 Ga0209784_1000021158 469
74 3300025225 Ga0209566_100003 Ga0209566_1000031158 469
75 3300025226 Ga0209674_100004 Ga0209674_1000041158 469
76 3300025230 Ga0209563_100006 Ga0209563_1000061158 469
77 3300025253 Ga0209677_100003 Ga0209677_1000031158 469
78 3300025910 Ga0207684_10004749 Ga0207684_1000474912 469
79 3300025913 Ga0207695_10003759 Ga0207695_1000375912 469
80 3300025914 Ga0207671_10006035 Ga0207671_100060359 469
81 3300025949 Ga0207667_10000438 Ga0207667_1000043845 469
82 3300037312 Ga0395899_0038375 Ga0395899_0038375_689_2170 469
83 3300039447 Ga0436361_0459873 Ga0436361_0459873_5105_6595 469
84 3300044683 Ga0466965_0013274 Ga0466965_0013274_1921_3405 469
85 iso_pu_bacteria 2596583598 2597030031 469
86 iso_pu_bacteria 2599185178 2599443888 469
87 iso_pu_bacteria 2885266251 2885267228 469
88 iso_pu_bacteria 2900577576 2900582618 469
89 iso_pu_bacteria 2923510766 2923510940 469
90 iso_pu_bacteria 2928058823 2928062169 469
91 3300046524 Ga0495648_0008671 Ga0495648_0008671_982_2478 470
92 iso_pu_bacteria 2738541337 2739057825 470
93 iso_pu_bacteria 2831864461 2831870040 470
94 iso_pu_bacteria 2886848708 2886850140 470
95 iso_pu_bacteria 2643221544 2643745459 471
96 iso_pu_bacteria 2643221585 2643935859 471
97 iso_pu_bacteria 2643221656 2644317642 471
98 3300031344 Ga0265316_10158227 Ga0265316_101582271 472
99 3300038725 Ga0400484_19906 Ga0400484_19906_3373_4887 472
100 3300038725 Ga0400484_26293 Ga0400484_26293_1075_2589 472
101 3300038725 Ga0400484_44991 Ga0400484_44991_1620_3134 472
102 3300038726 Ga0400490_03296 Ga0400490_03296_23643_25154 472
103 3300038726 Ga0400490_55744 Ga0400490_55744_5787_7298 472
104 3300038727 Ga0400491_16052 Ga0400491_16052_35_1549 472
105 3300038735 Ga0400485_01922 Ga0400485_01922_3802_5313 472
106 3300038735 Ga0400485_03136 Ga0400485_03136_798_2309 472
107 3300038741 Ga0400488_04923 Ga0400488_04923_1590_3104 472
108 3300038741 Ga0400488_16137 Ga0400488_16137_995_2503 472
109 3300038741 Ga0400488_31560 Ga0400488_31560_2214_3725 472
110 3300038742 Ga0400486_14729 Ga0400486_14729_3893_5404 472
111 3300038742 Ga0400486_23232 Ga0400486_23232_101880_103391 472
112 3300039062 Ga0400483_065870 Ga0400483_065870_946_2457 472
113 3300039062 Ga0400483_138399 Ga0400483_138399_13193_14704 472
114 3300039062 Ga0400483_156941 Ga0400483_156941_3374_4885 472
115 3300039062 Ga0400483_219403 Ga0400483_219403_1601_3112 472
116 3300039062 Ga0400483_288616 Ga0400483_288616_3431_4942 472
117 3300039110 Ga0400487_07448 Ga0400487_07448_21176_22687 472
118 3300039110 Ga0400487_30781 Ga0400487_30781_1629_3143 472
119 3300039110 Ga0400487_33302 Ga0400487_33302_211_1722 472
120 3300039110 Ga0400487_56221 Ga0400487_56221_35394_36905 472
121 3300045051 Ga0451576_0001076 Ga0451576_0001076_11591_13069 472
122 iso_pu_bacteria 2643221654 2644304362 472
123 iso_pu_bacteria 2721755523 2722882324 472
124 iso_pu_bacteria 2842718218 2842719108 472
125 iso_pu_bacteria 2974320154 2974324253 472
126 3300002704 JGI25155J39150_1000393 JGI25155J39150_10003931 473
127 3300002705 JGI25156J39149_1000539 JGI25156J39149_100053914 473
128 3300002737 JGI25162J39368_1004799 JGI25162J39368_10047992 473
129 3300002738 JGI25154J39366_1001346 JGI25154J39366_10013461 473
130 3300002741 JGI25157J39369_1000359 JGI25157J39369_100035923 473
131 3300003187 JGI25151J46595_10013349 JGI25151J46595_100133492 473
132 3300003758 Ga0055532_1000023 Ga0055532_1000023214 473
133 3300003775 Ga0055524_1000258 Ga0055524_100025810 473
134 3300003791 Ga0055530_10004246 Ga0055530_100042461 473
135 3300003792 Ga0055540_1000002 Ga0055540_1000002350 473
136 3300003794 Ga0055531_10002602 Ga0055531_100026029 473
137 3300005563 Ga0068855_100073072 Ga0068855_1000730722 473
138 3300006948 Ga0099826_10000004 Ga0099826_10000004575 473
139 3300009093 Ga0105240_10005103 Ga0105240_100051037 473
140 3300012497 Ga0157319_1000006 Ga0157319_100000658 473
141 3300013100 Ga0157373_10086989 Ga0157373_100869892 473
142 3300025206 Ga0209435_100013 Ga0209435_100013326 473
143 3300025229 Ga0209147_100030 Ga0209147_10003030 473
144 3300025233 Ga0209437_100265 Ga0209437_10026544 473
145 3300025242 Ga0209258_100205 Ga0209258_10020529 473
146 3300025246 Ga0209646_1000034 Ga0209646_1000034326 473
147 3300025250 Ga0209026_1000022 Ga0209026_1000022326 473
148 3300025256 Ga0209759_1000018 Ga0209759_1000018326 473
149 3300025291 Ga0209675_1008313 Ga0209675_10083132 473
150 3300025291 Ga0209675_1009175 Ga0209675_10091752 473
151 3300025294 Ga0209025_1002856 Ga0209025_100285618 473
152 3300025295 Ga0209564_1000003 Ga0209564_10000031278 473
153 3300025298 Ga0209050_1002755 Ga0209050_10027551 473
154 3300025299 Ga0209256_1000011 Ga0209256_1000011535 473
155 3300025303 Ga0209051_1000024 Ga0209051_1000024352 473
156 3300025303 Ga0209051_1012006 Ga0209051_10120062 473
157 3300025304 Ga0209257_1000818 Ga0209257_10008184 473
158 3300025913 Ga0207695_10001528 Ga0207695_100015284 473
159 3300025938 Ga0207704_10046413 Ga0207704_100464132 473
160 3300025949 Ga0207667_10047663 Ga0207667_100476632 473
161 3300026035 Ga0207703_10068125 Ga0207703_100681252 473
162 3300027666 Ga0209282_1000015 Ga0209282_100001581 473
163 3300037471 Ga0395905_0001653 Ga0395905_0001653_23137_24666 473
164 3300044712 Ga0453684_0000386 Ga0453684_0000386_135300_136781 473
165 3300048928 Ga0496125_0003323 Ga0496125_0003323_6954_8447 473
166 3300050493 nmdc:mga0k408_5262_c1 nmdc:mga0k408_5262_c1_452_1924 473
167 3300002704 JGI25155J39150_1000394 JGI25155J39150_100039410 474
168 3300002705 JGI25156J39149_1007410 JGI25156J39149_10074102 474
169 3300002738 JGI25154J39366_1001331 JGI25154J39366_10013317 474
170 3300003544 Ga0007417J51691_1058351 Ga0007417J51691_10583512 474
171 3300003575 Ga0007409J51694_1020585 Ga0007409J51694_10205852 474
172 3300003577 Ga0007416J51690_1034843 Ga0007416J51690_10348432 474
173 3300003693 Ga0032354_1056868 Ga0032354_10568684 474
174 3300006946 Ga0079104_1000017 Ga0079104_100001795 474
175 3300009093 Ga0105240_10059642 Ga0105240_100596421 474
176 3300013306 Ga0163162_10122419 Ga0163162_101224192 474
177 3300021361 Ga0213872_10000921 Ga0213872_100009218 474
178 3300025206 Ga0209435_100862 Ga0209435_1008621 474
179 3300025246 Ga0209646_1000135 Ga0209646_1000135100 474
180 3300025250 Ga0209026_1002714 Ga0209026_10027146 474
181 3300025256 Ga0209759_1000133 Ga0209759_1000133100 474
182 3300025728 Ga0207655_1011702 Ga0207655_10117022 474
183 3300027111 Ga0209281_1000042 Ga0209281_1000042252 474
184 3300038443 Ga0395901_0081311 Ga0395901_0081311_290_1780 474
185 3300039447 Ga0436361_0651547 Ga0436361_0651547_108_1601 474
186 3300039447 Ga0436361_0687444 Ga0436361_0687444_13956_15458 474
187 3300044683 Ga0466965_0001346 Ga0466965_0001346_861_2351 474
188 3300046471 Ga0495650_0000048 Ga0495650_0000048_79917_81389 474
189 3300046529 Ga0495652_0004595 Ga0495652_0004595_10463_11953 474
190 3300046558 Ga0495633_0008046 Ga0495633_0008046_4131_5633 474
191 3300047472 Ga0495686_0062246 Ga0495686_0062246_103_1584 474
192 3300048924 Ga0496121_0030639 Ga0496121_0030639_3074_4564 474
193 3300048924 Ga0496121_0035856 Ga0496121_0035856_1196_2686 474
194 3300048928 Ga0496125_0001533 Ga0496125_0001533_9308_10798 474
195 3300049459 Ga0495678_002888 Ga0495678_002888_8714_10186 474
196 3300050493 nmdc:mga0k408_1305_c1 nmdc:mga0k408_1305_c1_10638_12119 474
197 iso_pu_bacteria 2511231003 2511250889 474
198 iso_pu_bacteria 2511231026 2511385536 474
199 iso_pu_bacteria 2521172590 2521557734 474
200 iso_pu_bacteria 2548876994 2550692655 474
201 iso_pu_bacteria 2734482258 2735817357 474
202 iso_pu_bacteria 2765235838 2765570094 474
203 iso_pu_bacteria 2808606386 2808981620 474
204 iso_pu_bacteria 2808606415 2809129203 474
205 iso_pu_bacteria 2808606419 2809148823 474
206 iso_pu_bacteria 2818991436 2819540672 474
207 iso_pu_bacteria 2818991445 2819591586 474
208 iso_pu_bacteria 2818991449 2819615133 474
209 iso_pu_bacteria 2839094727 2839096966 474
210 iso_pu_bacteria 2852618963 2852621361 474
211 iso_pu_bacteria 2884811622 2884812847 474
212 iso_pu_bacteria 2884836552 2884837396 474
213 iso_pu_bacteria 2884852848 2884853687 474
214 iso_pu_bacteria 2896154374 2896155196 474
215 iso_pu_bacteria 2919046199 2919050831 474
216 iso_pu_bacteria 2919476304 2919478571 474
217 iso_pu_bacteria 2928130867 2928130911 474
218 3300002773 JGI25152J39213_1000357 JGI25152J39213_10003572 475
219 3300002773 JGI25152J39213_1008780 JGI25152J39213_10087802 475
220 3300002774 JGI25150J39212_1002474 JGI25150J39212_10024742 475
221 3300002774 JGI25150J39212_1002693 JGI25150J39212_10026932 475
222 3300002987 JGI25159J45721_1000834 JGI25159J45721_100083417 475
223 3300002987 JGI25159J45721_1001302 JGI25159J45721_10013023 475
224 3300002987 JGI25159J45721_1003036 JGI25159J45721_10030365 475
225 3300003187 JGI25151J46595_10013227 JGI25151J46595_100132274 475
226 3300003354 JGI25160J50197_1005594 JGI25160J50197_10055943 475
227 3300003374 JGI25161J50226_1000322 JGI25161J50226_10003221 475
228 3300003374 JGI25161J50226_1003674 JGI25161J50226_10036741 475
229 3300003771 Ga0055526_1000180 Ga0055526_10001801 475
230 3300003771 Ga0055526_1001704 Ga0055526_100170412 475
231 3300003771 Ga0055526_1011809 Ga0055526_10118092 475
232 3300003773 Ga0055537_1000012 Ga0055537_10000125 475
233 3300003775 Ga0055524_1000021 Ga0055524_1000021124 475
234 3300003784 Ga0055534_1000529 Ga0055534_100052918 475
235 3300003790 Ga0055528_1000073 Ga0055528_100007367 475
236 3300003790 Ga0055528_1006103 Ga0055528_10061034 475
237 3300003791 Ga0055530_10019014 Ga0055530_100190142 475
238 3300004625 Ga0055543_1000538 Ga0055543_100053826 475
239 3300005262 Ga0065165_1000156 Ga0065165_1000156104 475
240 3300005262 Ga0065165_1001776 Ga0065165_10017761 475
241 3300005288 Ga0065714_10076003 Ga0065714_100760032 475
242 3300005618 Ga0068864_100047803 Ga0068864_1000478032 475
243 3300006178 Ga0075367_10037878 Ga0075367_100378782 475
244 3300006195 Ga0075366_10000348 Ga0075366_100003488 475
245 3300006353 Ga0075370_10000386 Ga0075370_100003865 475
246 3300006353 Ga0075370_10002366 Ga0075370_100023669 475
247 3300006353 Ga0075370_10004983 Ga0075370_100049832 475
248 3300006948 Ga0099826_10000002 Ga0099826_100000021047 475
249 3300009036 Ga0105244_10002910 Ga0105244_100029107 475
250 3300014497 Ga0182008_10001210 Ga0182008_1000121012 475
251 3300015261 Ga0182006_1000002 Ga0182006_1000002442 475
252 3300015261 Ga0182006_1000026 Ga0182006_100002685 475
253 3300015262 Ga0182007_10000159 Ga0182007_1000015933 475
254 3300015265 Ga0182005_1000002 Ga0182005_1000002651 475
255 3300015265 Ga0182005_1000007 Ga0182005_1000007294 475
256 3300021361 Ga0213872_10000028 Ga0213872_1000002811 475
257 3300025208 Ga0209436_100857 Ga0209436_10085710 475
258 3300025208 Ga0209436_107129 Ga0209436_1071292 475
259 3300025245 Ga0207425_1000001 Ga0207425_10000011518 475
260 3300025245 Ga0207425_1000059 Ga0207425_10000593 475
261 3300025245 Ga0207425_1000143 Ga0207425_100014353 475
262 3300025258 Ga0209129_1000001 Ga0209129_1000001695 475
263 3300025263 Ga0209565_1000057 Ga0209565_10000578 475
264 3300025263 Ga0209565_1003973 Ga0209565_10039731 475
265 3300025273 Ga0209673_1000051 Ga0209673_1000051280 475
266 3300025273 Ga0209673_1013180 Ga0209673_10131802 475
267 3300025284 Ga0209130_1000268 Ga0209130_100026853 475
268 3300025284 Ga0209130_1001032 Ga0209130_10010321 475
269 3300025284 Ga0209130_1003923 Ga0209130_10039237 475
270 3300025291 Ga0209675_1000027 Ga0209675_1000027280 475
271 3300025291 Ga0209675_1002448 Ga0209675_10024485 475
272 3300025294 Ga0209025_1001845 Ga0209025_100184514 475
273 3300025295 Ga0209564_1000009 Ga0209564_1000009350 475
274 3300025295 Ga0209564_1000094 Ga0209564_10000947 475
275 3300025295 Ga0209564_1002669 Ga0209564_10026692 475
276 3300025297 Ga0209758_1000073 Ga0209758_1000073244 475
277 3300025297 Ga0209758_1001766 Ga0209758_100176623 475
278 3300025298 Ga0209050_1000046 Ga0209050_1000046345 475
279 3300025299 Ga0209256_1000044 Ga0209256_1000044209 475
280 3300025299 Ga0209256_1000139 Ga0209256_10001397 475
281 3300025299 Ga0209256_1002336 Ga0209256_100233621 475
282 3300025299 Ga0209256_1003060 Ga0209256_10030602 475
283 3300025299 Ga0209256_1013855 Ga0209256_10138552 475
284 3300025302 Ga0207426_1001318 Ga0207426_10013189 475
285 3300025303 Ga0209051_1018141 Ga0209051_10181411 475
286 3300025304 Ga0209257_1000728 Ga0209257_100072837 475
287 3300025728 Ga0207655_1011204 Ga0207655_10112044 475
288 3300025931 Ga0207644_10023292 Ga0207644_100232922 475
289 3300026089 Ga0207648_10060930 Ga0207648_100609302 475
290 3300026095 Ga0207676_10037754 Ga0207676_100377542 475
291 3300027666 Ga0209282_1000001 Ga0209282_1000001115 475
292 3300028786 Ga0307517_10000964 Ga0307517_1000096420 475
293 3300028794 Ga0307515_10041872 Ga0307515_100418722 475
294 3300030522 Ga0307512_10022542 Ga0307512_100225422 475
295 3300031507 Ga0307509_10005272 Ga0307509_100052729 475
296 3300031507 Ga0307509_10006664 Ga0307509_100066648 475
297 3300031507 Ga0307509_10086510 Ga0307509_100865102 475
298 3300031507 Ga0307509_10091912 Ga0307509_100919122 475
299 3300031616 Ga0307508_10000078 Ga0307508_1000007865 475
300 3300031616 Ga0307508_10006353 Ga0307508_100063536 475
301 3300032004 Ga0307414_10013250 Ga0307414_100132504 475
302 3300035112 Ga0373932_0013051 Ga0373932_0013051_553_2034 475
303 3300035691 Ga0373931_0001953 Ga0373931_0001953_974_2455 475
304 3300037312 Ga0395899_0103479 Ga0395899_0103479_455_1960 475
305 3300037471 Ga0395905_0004037 Ga0395905_0004037_1931_3409 475
306 3300037471 Ga0395905_0074484 Ga0395905_0074484_403_1908 475
307 3300039447 Ga0436361_0420505 Ga0436361_0420505_1358_2863 475
308 3300046452 Ga0495617_000037 Ga0495617_000037_7099_8610 475
309 3300046452 Ga0495617_032316 Ga0495617_032316_247_1743 475
310 3300046453 Ga0495627_000008 Ga0495627_000008_510883_512382 475
311 3300046454 Ga0495592_0040881 Ga0495592_0040881_785_2266 475
312 3300046463 Ga0495653_0000409 Ga0495653_0000409_31760_33265 475
313 3300046471 Ga0495650_0000503 Ga0495650_0000503_119_1630 475
314 3300046474 Ga0495605_0005275 Ga0495605_0005275_5691_7175 475
315 3300046491 Ga0495584_0000679 Ga0495584_0000679_3113_4597 475
316 3300046499 Ga0495594_0024880 Ga0495594_0024880_125_1627 475
317 3300046499 Ga0495594_0025571 Ga0495594_0025571_158_1657 475
318 3300046506 Ga0495583_0000035 Ga0495583_0000035_158894_160378 475
319 3300046506 Ga0495583_0001016 Ga0495583_0001016_29440_30939 475
320 3300046506 Ga0495583_0005988 Ga0495583_0005988_5493_7001 475
321 3300046507 Ga0495606_0000011 Ga0495606_0000011_30331_31830 475
322 3300046507 Ga0495606_0000064 Ga0495606_0000064_175082_176581 475
323 3300046512 Ga0495610_0000003 Ga0495610_0000003_423270_424781 475
324 3300046522 Ga0495643_0000432 Ga0495643_0000432_51712_53214 475
325 3300046524 Ga0495648_0002588 Ga0495648_0002588_8292_9776 475
326 3300046525 Ga0495663_0008293 Ga0495663_0008293_381_1886 475
327 3300046530 Ga0495654_0000028 Ga0495654_0000028_123323_124816 475
328 3300046530 Ga0495654_0019361 Ga0495654_0019361_974_2476 475
329 3300046538 Ga0495609_0000202 Ga0495609_0000202_21802_23310 475
330 3300046538 Ga0495609_0005004 Ga0495609_0005004_3235_4719 475
331 3300046539 Ga0495621_0022026 Ga0495621_0022026_267_1757 475
332 3300046558 Ga0495633_0004162 Ga0495633_0004162_1121_2605 475
333 3300046558 Ga0495633_0005179 Ga0495633_0005179_6474_7958 475
334 3300046616 Ga0495668_0000048 Ga0495668_0000048_10230_11741 475
335 3300046616 Ga0495668_0001049 Ga0495668_0001049_22515_24017 475
336 3300046616 Ga0495668_0001239 Ga0495668_0001239_16719_18218 475
337 3300046616 Ga0495668_0025583 Ga0495668_0025583_831_2339 475
338 3300046660 Ga0495625_0037644 Ga0495625_0037644_276_1784 475
339 3300046660 Ga0495625_0090535 Ga0495625_0090535_347_1831 475
340 3300046674 Ga0495588_0031759 Ga0495588_0031759_1099_2601 475
341 3300046684 Ga0495669_0000174 Ga0495669_0000174_38206_39708 475
342 3300046692 Ga0495671_0000001 Ga0495671_0000001_251407_252915 475
343 3300046692 Ga0495671_0047245 Ga0495671_0047245_523_2007 475
344 3300046694 Ga0495649_0012058 Ga0495649_0012058_2321_3829 475
345 3300046809 Ga0495600_0017295 Ga0495600_0017295_120_1631 475
346 3300046810 Ga0495660_0000219 Ga0495660_0000219_55960_57456 475
347 3300047318 Ga0495636_0003704 Ga0495636_0003704_1475_2959 475
348 3300047320 Ga0495672_0000259 Ga0495672_0000259_55624_57108 475
349 3300047320 Ga0495672_0060621 Ga0495672_0060621_53_1537 475
350 3300047322 Ga0495680_0008880 Ga0495680_0008880_995_2497 475
351 3300047323 Ga0495683_0018185 Ga0495683_0018185_826_2310 475
352 3300047443 Ga0495687_000604 Ga0495687_000604_37310_38818 475
353 3300047443 Ga0495687_000702 Ga0495687_000702_5692_7176 475
354 3300047443 Ga0495687_003298 Ga0495687_003298_8983_10461 475
355 3300047443 Ga0495687_016481 Ga0495687_016481_288_1796 475
356 3300047445 Ga0495677_0001656 Ga0495677_0001656_2861_4369 475
357 3300047447 Ga0495685_000019 Ga0495685_000019_20989_22473 475
358 3300047447 Ga0495685_012418 Ga0495685_012418_184_1692 475
359 3300047469 Ga0495673_0000003 Ga0495673_0000003_1488630_1490129 475
360 3300047469 Ga0495673_0000100 Ga0495673_0000100_165366_166877 475
361 3300047470 Ga0495681_0011078 Ga0495681_0011078_844_2352 475
362 3300048091 Ga0495626_0000640 Ga0495626_0000640_1033_2544 475
363 3300048091 Ga0495626_0002931 Ga0495626_0002931_6423_7919 475
364 3300048906 Ga0496103_0006849 Ga0496103_0006849_1059_2558 475
365 3300048919 Ga0496116_0055464 Ga0496116_0055464_447_1946 475
366 3300048920 Ga0496117_0000001 Ga0496117_0000001_1602775_1604274 475
367 3300048921 Ga0496118_0000002 Ga0496118_0000002_1602775_1604274 475
368 3300048925 Ga0496122_0031517 Ga0496122_0031517_1772_3271 475
369 3300048926 Ga0496123_0033450 Ga0496123_0033450_1057_2556 475
370 3300048927 Ga0496124_0072216 Ga0496124_0072216_813_2312 475
371 3300048928 Ga0496125_0014630 Ga0496125_0014630_928_2427 475
372 3300048929 Ga0496126_0078309 Ga0496126_0078309_127_1626 475
373 3300049459 Ga0495678_000128 Ga0495678_000128_23919_25418 475
374 3300049459 Ga0495678_016339 Ga0495678_016339_1021_2508 475
375 3300049460 Ga0495682_0000094 Ga0495682_0000094_75620_77104 475
376 3300049460 Ga0495682_0007646 Ga0495682_0007646_148_1632 475
377 3300049775 Ga0501279_001390 Ga0501279_001390_1624_3132 475
378 3300050493 nmdc:mga0k408_2846_c1 nmdc:mga0k408_2846_c1_480_1958 475
379 3300050496 nmdc:mga07m45_61_c1 nmdc:mga07m45_61_c1_33044_34522 475
380 3300050496 nmdc:mga07m45_89789_c1 nmdc:mga07m45_89789_c1_246_1724 475
381 3300053125 Ga0500618_000108 Ga0500618_000108_1039_2532 475
382 3300053136 Ga0500559_0000059 Ga0500559_0000059_27971_29452 475
383 3300053156 Ga0500622_0001474 Ga0500622_0001474_8032_9513 475
384 iso_pu_bacteria 2551306416 2553002849 475
385 iso_pu_bacteria 2600255292 2601667527 475
386 iso_pu_bacteria 2643221554 2643787148 475
387 iso_pu_bacteria 2643221638 2644215765 475
388 iso_pu_bacteria 2643221645 2644254242 475
389 iso_pu_bacteria 2643221664 2644358093 475
390 iso_pu_bacteria 2738541280 2738741061 475
391 iso_pu_bacteria 2738541297 2738829395 475
392 iso_pu_bacteria 2738541300 2738845520 475
393 iso_pu_bacteria 2738541357 2739153191 475
394 iso_pu_bacteria 2738543003 2739195111 475
395 iso_pu_bacteria 2738543018 2739276575 475
396 iso_pu_bacteria 2738543026 2739321587 475
397 iso_pu_bacteria 2738543029 2739339857 475
398 iso_pu_bacteria 2738543030 2739345619 475
399 iso_pu_bacteria 2821131069 2821131422 475
400 iso_pu_bacteria 2857547612 2857551751 475
401 iso_pu_bacteria 2857553236 2857554309 475
402 iso_pu_bacteria 2857564685 2857564909 475
403 iso_pu_bacteria 2885080285 2885085591 475
404 iso_pu_bacteria 2904424332 2904426202 475
405 iso_pu_bacteria 2932410948 2932411138 475
406 iso_pu_bacteria 2932416698 2932419295 475
407 2162886007 SwRhRL2b_contig_2988042 SwRhRL2b_0877.00007570 476
408 3300002738 JGI25154J39366_1000471 JGI25154J39366_10004716 476
409 3300003575 Ga0007409J51694_1030291 Ga0007409J51694_10302912 476
410 3300003759 Ga0055525_1000001 Ga0055525_1000001352 476
411 3300003763 Ga0055529_1000080 Ga0055529_100008027 476
412 3300003771 Ga0055526_1000137 Ga0055526_10001371 476
413 3300005262 Ga0065165_1005411 Ga0065165_10054116 476
414 3300005288 Ga0065714_10032348 Ga0065714_100323482 476
415 3300005289 Ga0065704_10080256 Ga0065704_100802562 476
416 3300006946 Ga0079104_1000002 Ga0079104_1000002229 476
417 3300009148 Ga0105243_10001518 Ga0105243_1000151817 476
418 3300009177 Ga0105248_10000679 Ga0105248_1000067924 476
419 3300025230 Ga0209563_100007 Ga0209563_100007745 476
420 3300025246 Ga0209646_1000010 Ga0209646_1000010221 476
421 3300025253 Ga0209677_102467 Ga0209677_1024676 476
422 3300025254 Ga0209148_1001416 Ga0209148_10014167 476
423 3300025272 Ga0209455_1000037 Ga0209455_1000037120 476
424 3300025295 Ga0209564_1000033 Ga0209564_1000033269 476
425 3300025935 Ga0207709_10000015 Ga0207709_10000015224 476
426 3300025949 Ga0207667_10056662 Ga0207667_100566623 476
427 3300026116 Ga0207674_10064444 Ga0207674_100644443 476
428 3300027111 Ga0209281_1000007 Ga0209281_1000007447 476
429 3300031344 Ga0265316_10000126 Ga0265316_1000012626 476
430 3300031711 Ga0265314_10016544 Ga0265314_100165442 476
431 3300037312 Ga0395899_0000505 Ga0395899_0000505_22726_24225 476
432 3300037312 Ga0395899_0127592 Ga0395899_0127592_152_1678 476
433 3300037418 Ga0395900_0000297 Ga0395900_0000297_71140_72666 476
434 3300037418 Ga0395900_0044860 Ga0395900_0044860_1399_2925 476
435 3300038443 Ga0395901_0000182 Ga0395901_0000182_8860_10386 476
436 3300038443 Ga0395901_0078271 Ga0395901_0078271_195_1724 476
437 3300038443 Ga0395901_0129258 Ga0395901_0129258_191_1717 476
438 3300042876 Ga0451577_0000058 Ga0451577_0000058_75048_76523 476
439 3300044712 Ga0453684_0000279 Ga0453684_0000279_171708_173183 476
440 3300045051 Ga0451576_0001134 Ga0451576_0001134_15306_16781 476
441 3300046452 Ga0495617_000039 Ga0495617_000039_10263_11771 476
442 3300046452 Ga0495617_000940 Ga0495617_000940_8558_10045 476
443 3300046452 Ga0495617_014576 Ga0495617_014576_1155_2657 476
444 3300046457 Ga0495590_0000001 Ga0495590_0000001_759096_760598 476
445 3300046457 Ga0495590_0000422 Ga0495590_0000422_18552_20078 476
446 3300046458 Ga0495591_020765 Ga0495591_020765_597_2102 476
447 3300046459 Ga0495629_0012328 Ga0495629_0012328_1066_2571 476
448 3300046460 Ga0495638_0000184 Ga0495638_0000184_92688_94190 476
449 3300046463 Ga0495653_0058579 Ga0495653_0058579_167_1690 476
450 3300046471 Ga0495650_0000292 Ga0495650_0000292_89532_91037 476
451 3300046471 Ga0495650_0000529 Ga0495650_0000529_51838_53337 476
452 3300046471 Ga0495650_0000753 Ga0495650_0000753_1096_2598 476
453 3300046472 Ga0495580_0060967 Ga0495580_0060967_381_1904 476
454 3300046473 Ga0495582_0021879 Ga0495582_0021879_1037_2560 476
455 3300046474 Ga0495605_0000587 Ga0495605_0000587_1296_2804 476
456 3300046491 Ga0495584_0000006 Ga0495584_0000006_8179_9666 476
457 3300046492 Ga0495585_0000061 Ga0495585_0000061_1695_3182 476
458 3300046492 Ga0495585_0000070 Ga0495585_0000070_103363_104865 476
459 3300046492 Ga0495585_0023881 Ga0495585_0023881_1037_2539 476
460 3300046492 Ga0495585_0024797 Ga0495585_0024797_205_1704 476
461 3300046500 Ga0495596_0010511 Ga0495596_0010511_1217_2719 476
462 3300046501 Ga0495607_0018560 Ga0495607_0018560_1271_2776 476
463 3300046506 Ga0495583_0000119 Ga0495583_0000119_1095_2597 476
464 3300046506 Ga0495583_0000515 Ga0495583_0000515_16958_18451 476
465 3300046506 Ga0495583_0000941 Ga0495583_0000941_11914_13416 476
466 3300046507 Ga0495606_0001038 Ga0495606_0001038_1272_2771 476
467 3300046507 Ga0495606_0001094 Ga0495606_0001094_113_1624 476
468 3300046512 Ga0495610_0000147 Ga0495610_0000147_3588_5093 476
469 3300046515 Ga0495620_0025575 Ga0495620_0025575_134_1633 476
470 3300046518 Ga0495631_0010370 Ga0495631_0010370_1431_2936 476
471 3300046519 Ga0495632_0000250 Ga0495632_0000250_10368_11876 476
472 3300046519 Ga0495632_0007241 Ga0495632_0007241_707_2209 476
473 3300046519 Ga0495632_0027933 Ga0495632_0027933_1162_2667 476
474 3300046520 Ga0495637_0000004 Ga0495637_0000004_393986_395491 476
475 3300046520 Ga0495637_0020306 Ga0495637_0020306_514_2016 476
476 3300046522 Ga0495643_0000369 Ga0495643_0000369_59318_60820 476
477 3300046523 Ga0495644_0015636 Ga0495644_0015636_677_2185 476
478 3300046524 Ga0495648_0000001 Ga0495648_0000001_10390_11892 476
479 3300046524 Ga0495648_0000096 Ga0495648_0000096_107546_109033 476
480 3300046524 Ga0495648_0020089 Ga0495648_0020089_1707_3209 476
481 3300046524 Ga0495648_0037042 Ga0495648_0037042_801_2300 476
482 3300046526 Ga0495666_0012017 Ga0495666_0012017_1073_2596 476
483 3300046528 Ga0495642_0000366 Ga0495642_0000366_15426_16934 476
484 3300046538 Ga0495609_0002717 Ga0495609_0002717_1244_2746 476
485 3300046538 Ga0495609_0017469 Ga0495609_0017469_1292_2797 476
486 3300046542 Ga0495597_0000131 Ga0495597_0000131_66446_67948 476
487 3300046542 Ga0495597_0002786 Ga0495597_0002786_1194_2696 476
488 3300046557 Ga0495622_0000068 Ga0495622_0000068_79256_80755 476
489 3300046557 Ga0495622_0001604 Ga0495622_0001604_8549_10051 476
490 3300046558 Ga0495633_0000188 Ga0495633_0000188_78335_79837 476
491 3300046558 Ga0495633_0001853 Ga0495633_0001853_1221_2723 476
492 3300046558 Ga0495633_0017755 Ga0495633_0017755_452_1954 476
493 3300046615 Ga0495656_0005295 Ga0495656_0005295_1263_2765 476
494 3300046616 Ga0495668_0000487 Ga0495668_0000487_46799_48301 476
495 3300046616 Ga0495668_0036389 Ga0495668_0036389_1236_2741 476
496 3300046648 Ga0495611_0001880 Ga0495611_0001880_7901_9406 476
497 3300046660 Ga0495625_0000483 Ga0495625_0000483_115_1617 476
498 3300046660 Ga0495625_0000935 Ga0495625_0000935_36654_38156 476
499 3300046660 Ga0495625_0001295 Ga0495625_0001295_1030_2529 476
500 3300046660 Ga0495625_0025570 Ga0495625_0025570_67_1569 476
501 3300046665 Ga0495661_0069759 Ga0495661_0069759_327_1832 476
502 3300046691 Ga0495670_0018769 Ga0495670_0018769_1085_2587 476
503 3300046694 Ga0495649_0000355 Ga0495649_0000355_35841_37346 476
504 3300046694 Ga0495649_0019390 Ga0495649_0019390_1097_2605 476
505 3300047317 Ga0495604_0044028 Ga0495604_0044028_822_2345 476
506 3300047319 Ga0495674_0005713 Ga0495674_0005713_9378_10883 476
507 3300047320 Ga0495672_0000097 Ga0495672_0000097_47682_49181 476
508 3300047320 Ga0495672_0000126 Ga0495672_0000126_97850_99355 476
509 3300047320 Ga0495672_0000187 Ga0495672_0000187_1148_2650 476
510 3300047323 Ga0495683_0000041 Ga0495683_0000041_1025_2527 476
511 3300047323 Ga0495683_0000214 Ga0495683_0000214_50911_52416 476
512 3300047323 Ga0495683_0024135 Ga0495683_0024135_1279_2784 476
513 3300047323 Ga0495683_0063640 Ga0495683_0063640_304_1806 476
514 3300047444 Ga0495675_0039694 Ga0495675_0039694_460_1983 476
515 3300047445 Ga0495677_0011116 Ga0495677_0011116_1015_2520 476
516 3300047446 Ga0495679_002551 Ga0495679_002551_2884_4389 476
517 3300047446 Ga0495679_010017 Ga0495679_010017_926_2431 476
518 3300047469 Ga0495673_0000097 Ga0495673_0000097_7078_8580 476
519 3300047472 Ga0495686_0000356 Ga0495686_0000356_71951_73453 476
520 3300047472 Ga0495686_0005033 Ga0495686_0005033_7425_8930 476
521 3300048091 Ga0495626_0000026 Ga0495626_0000026_35702_37225 476
522 3300048091 Ga0495626_0027674 Ga0495626_0027674_687_2192 476
523 3300048904 Ga0496101_0023866 Ga0496101_0023866_1051_2556 476
524 3300048905 Ga0496102_0000306 Ga0496102_0000306_1706_3214 476
525 3300048905 Ga0496102_0001202 Ga0496102_0001202_10774_12276 476
526 3300048905 Ga0496102_0096594 Ga0496102_0096594_1191_2699 476
527 3300048926 Ga0496123_0000255 Ga0496123_0000255_105036_106541 476
528 3300048928 Ga0496125_0004349 Ga0496125_0004349_12568_14073 476
529 3300049459 Ga0495678_018196 Ga0495678_018196_1548_3050 476
530 3300049822 Ga0501035_0002348 Ga0501035_0002348_1213_2739 476
531 3300059504 Ga0587082_000253 Ga0587082_000253_212_1741 476
532 iso_pu_bacteria 2643221556 2643802180 476
533 iso_pu_bacteria 2643221684 2644475689 476
534 iso_pu_bacteria 2808606418 2809145245 476
535 iso_pu_bacteria 2842711865 2842714224 476
536 iso_pu_bacteria 2857558681 2857559918 476
537 iso_pu_bacteria 8047673197 8047673968 476

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

137

426

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8beh-assembly1.cif.gz_M cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane tip) 0.9538 251 469
8e73-assembly1.cif.gz_4M vigna radiata supercomplex i+iii2 (full bridge) 0.9422 4 473
7ar7-assembly1.cif.gz_M cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.938 4 473
8e73-assembly1.cif.gz_4M vigna radiata supercomplex i+iii2 (full bridge) 0.9288 4 473
8beh-assembly1.cif.gz_M cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane tip) 0.9253 251 469
ID Description Score Start End Superfamily
af_M1FQK6_1_136_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9361 7 125 1.20.1070.10
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9306 1 125 1.20.1070.10
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.883 1 125 1.20.1070.10
af_P0AFE8_1_132_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8556 4 125 1.20.1070.10
af_M1FQK6_1_136_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8121 7 125 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A520FU04-F1-model_v4 NADH-quinone oxidoreductase subunit M (EC 1.6.5.11) 0.9754 1 125 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A3B1CNN1-F1-model_v4 NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3) 0.9671 262 468 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A7Y2PBL1-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.961 258 468 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A532F0S2-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.9576 263 468 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A536AAM8-F1-model_v4 NADH-quinone oxidoreductase subunit M (EC 1.6.5.-) 0.9575 232 471 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039

Feature Viewer

pLDDT pTM Quality
79.7 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map