F460847

General Info

Members Datasets Scaffolds Average Seq Length
536 162 1072 168

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0935463|Ga0501042_0935463_118_615
Length 157
Sequence MRVDLSTLALVAAAIVLAAIAYLKDPGLPLIGARNGLSFLWFVIPRLVPAVXVPQEVVSRHFGRQAGLRALVIATIAGAITPGGPMVSVPFMVAAGHSGAGLPALVAYMTSWSLFGLQRIIAWEAPLMGWKFVITRVVSTIAFPVLAGWLVATFYQE

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
103 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
104 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
108 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
109 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
110 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
111 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 11.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0935463 3300049578 Bacteria 631
2 Ga0068869_100037000 3300005334 Bacteria 3468
3 Ga0068869_100037618 3300005334 Bacteria 3442
4 Ga0070680_100049397 3300005336 Bacteria 3429
5 Ga0070689_100506997 3300005340 Unclassified 1034
6 Ga0070691_10002054 3300005341 Bacteria 8883
7 Ga0070692_10014445 3300005345 Bacteria 3710
8 Ga0070668_100739074 3300005347 Bacteria 870
9 Ga0070669_100047065 3300005353 Bacteria 3145
10 Ga0070669_100128934 3300005353 Bacteria 1938
11 Ga0070669_100409570 3300005353 Unclassified 1111
12 Ga0070675_100479766 3300005354 Bacteria 1118
13 Ga0070667_100847293 3300005367 Bacteria 850
14 Ga0070703_10002728 3300005406 Bacteria 5068
15 Ga0070703_10011506 3300005406 Bacteria 2500
16 Ga0070709_10083410 3300005434 Bacteria 2091
17 Ga0070705_100023670 3300005440 Bacteria 3303
18 Ga0070705_100166863 3300005440 Bacteria 1478
19 Ga0070694_100003138 3300005444 Bacteria 9843
20 Ga0070694_100150171 3300005444 Bacteria 1701
21 Ga0070708_100002970 3300005445 Bacteria 13176
22 Ga0070708_100003814 3300005445 Bacteria 11824
23 Ga0070708_100007414 3300005445 Bacteria 8778
24 Ga0070708_100025931 3300005445 Bacteria 5013
25 Ga0070708_100227116 3300005445 Bacteria 1751
26 Ga0070708_100324932 3300005445 Bacteria 1449
27 Ga0070708_100388152 3300005445 Bacteria 1317
28 Ga0070662_100449637 3300005457 Bacteria 1069
29 Ga0068867_100203250 3300005459 Unclassified 1587
30 Ga0068867_100446393 3300005459 Bacteria 1101
31 Ga0070706_100010004 3300005467 Bacteria 8808
32 Ga0070706_100018560 3300005467 Bacteria 6413
33 Ga0070706_100082268 3300005467 Bacteria 2982
34 Ga0070706_100175932 3300005467 Bacteria 1998
35 Ga0070706_100199035 3300005467 Unclassified 1871
36 Ga0070706_100379050 3300005467 Unclassified 1317
37 Ga0070706_100516997 3300005467 Unclassified 1110
38 Ga0070707_100004955 3300005468 Bacteria 12470
39 Ga0070707_100006005 3300005468 Bacteria 11331
40 Ga0070707_100011625 3300005468 Bacteria 8214
41 Ga0070707_100012067 3300005468 Bacteria 8065
42 Ga0070707_100032413 3300005468 Bacteria 4979
43 Ga0070707_100044212 3300005468 Bacteria 4263
44 Ga0070707_100065372 3300005468 Bacteria 3493
45 Ga0070707_100147066 3300005468 Bacteria 2293
46 Ga0070707_100218545 3300005468 Bacteria 1857
47 Ga0070707_100249296 3300005468 Bacteria 1728
48 Ga0070707_100340029 3300005468 Bacteria 1458
49 Ga0070707_100370009 3300005468 Unclassified 1392
50 Ga0070707_100666145 3300005468 Bacteria 1003
51 Ga0070698_100003435 3300005471 Bacteria 17414
52 Ga0070698_100007004 3300005471 Bacteria 12211
53 Ga0070698_100053717 3300005471 Bacteria 4093
54 Ga0070698_100077043 3300005471 Bacteria 3335
55 Ga0070698_100078727 3300005471 Bacteria 3294
56 Ga0070698_100163601 3300005471 Bacteria 2168
57 Ga0070698_100241225 3300005471 Unclassified 1740
58 Ga0070698_100843075 3300005471 Bacteria 861
59 Ga0070699_100003211 3300005518 Bacteria 14459
60 Ga0070699_100036954 3300005518 Bacteria 4225
61 Ga0070699_100042725 3300005518 Bacteria 3923
62 Ga0070699_100063128 3300005518 Bacteria 3211
63 Ga0070699_100110569 3300005518 Bacteria 2412
64 Ga0070699_100267101 3300005518 Unclassified 1531
65 Ga0070699_100565558 3300005518 Bacteria 1035
66 Ga0070699_100572544 3300005518 Bacteria 1029
67 Ga0070679_100971980 3300005530 Bacteria 793
68 Ga0070697_100005572 3300005536 Bacteria 9706
69 Ga0070697_100011134 3300005536 Bacteria 7029
70 Ga0070697_100042336 3300005536 Bacteria 3685
71 Ga0070697_100050409 3300005536 Bacteria 3379
72 Ga0070697_100066949 3300005536 Bacteria 2937
73 Ga0070697_100085903 3300005536 Bacteria 2596
74 Ga0070697_100112009 3300005536 Bacteria 2275
75 Ga0070697_100122221 3300005536 Bacteria 2178
76 Ga0070697_100267490 3300005536 Bacteria 1465
77 Ga0070695_100013504 3300005545 Bacteria 4909
78 Ga0070695_100020039 3300005545 Bacteria 4079
79 Ga0070695_100456924 3300005545 Bacteria 980
80 Ga0070695_100765746 3300005545 Bacteria 771
81 Ga0070696_100105234 3300005546 Bacteria 2027
82 Ga0070696_100139708 3300005546 Unclassified 1769
83 Ga0070696_100848347 3300005546 Bacteria 755
84 Ga0070704_100073689 3300005549 Bacteria 2488
85 Ga0070704_100132513 3300005549 Bacteria 1934
86 Ga0070704_100362048 3300005549 Bacteria 1227
87 Ga0070704_100958158 3300005549 Bacteria 772
88 Ga0070704_101450367 3300005549 Unclassified 630
89 Ga0070702_100092440 3300005615 Unclassified 1837
90 Ga0068859_100036539 3300005617 Bacteria 4931
91 Ga0068863_100015562 3300005841 Bacteria 7309
92 Ga0068860_100018418 3300005843 Bacteria 6792
93 Ga0068860_100032146 3300005843 Bacteria 5044
94 Ga0068860_100412647 3300005843 Unclassified 1337
95 Ga0068860_101044309 3300005843 Bacteria 836
96 Ga0068862_100041717 3300005844 Bacteria 3906
97 Ga0068862_100070778 3300005844 Bacteria 3012
98 Ga0068862_100137715 3300005844 Bacteria 2165
99 Ga0068862_100585835 3300005844 Bacteria 1069
100 Ga0081539_10000009 3300005985 Bacteria 509286
101 Ga0075432_10261213 3300006058 Bacteria 706
102 Ga0070715_10023150 3300006163 Bacteria 2431
103 Ga0070716_100037026 3300006173 Bacteria 2694
104 Ga0070716_100110501 3300006173 Bacteria 1703
105 Ga0070716_100402137 3300006173 Bacteria 985
106 Ga0070712_100003456 3300006175 Bacteria 9722
107 Ga0070712_100129968 3300006175 Bacteria 1907
108 Ga0075428_100007947 3300006844 Bacteria 11763
109 Ga0075428_100020121 3300006844 Bacteria 7390
110 Ga0075428_100095923 3300006844 Bacteria 3233
111 Ga0075428_100429221 3300006844 Unclassified 1416
112 Ga0075430_100005576 3300006846 Bacteria 10631
113 Ga0075430_100066253 3300006846 Bacteria 3033
114 Ga0075430_100076156 3300006846 Bacteria 2812
115 Ga0075430_100140980 3300006846 Bacteria 2008
116 Ga0075430_100600878 3300006846 Unclassified 908
117 Ga0075430_100736367 3300006846 Bacteria 813
118 Ga0075430_100926261 3300006846 Bacteria 718
119 Ga0075431_100002218 3300006847 Bacteria 18608
120 Ga0075431_100002669 3300006847 Bacteria 17286
121 Ga0075431_100019920 3300006847 Bacteria 6850
122 Ga0075431_100022635 3300006847 Bacteria 6424
123 Ga0075431_100024572 3300006847 Bacteria 6176
124 Ga0075431_100042721 3300006847 Bacteria 4676
125 Ga0075431_100056802 3300006847 Bacteria 4037
126 Ga0075431_100117217 3300006847 Bacteria 2748
127 Ga0075431_100169647 3300006847 Bacteria 2242
128 Ga0075431_100248265 3300006847 Bacteria 1809
129 Ga0075431_100354846 3300006847 Bacteria 1473
130 Ga0075431_101131651 3300006847 Bacteria 747
131 Ga0075433_10002272 3300006852 Bacteria 14614
132 Ga0075433_10003005 3300006852 Bacteria 12958
133 Ga0075433_10020140 3300006852 Bacteria 5571
134 Ga0075433_10041541 3300006852 Bacteria 3984
135 Ga0075433_10324284 3300006852 Bacteria 1362
136 Ga0075433_10661110 3300006852 Bacteria 916
137 Ga0075433_10684531 3300006852 Unclassified 899
138 Ga0075434_100005798 3300006871 Bacteria 11275
139 Ga0075434_100007086 3300006871 Bacteria 10353
140 Ga0075434_100032558 3300006871 Bacteria 5141
141 Ga0075434_100053034 3300006871 Bacteria 4030
142 Ga0075434_100095649 3300006871 Bacteria 2975
143 Ga0075434_100123333 3300006871 Bacteria 2607
144 Ga0075434_100975684 3300006871 Unclassified 861
145 Ga0075429_100028142 3300006880 Bacteria 4879
146 Ga0075429_100039724 3300006880 Bacteria 4095
147 Ga0075429_100040143 3300006880 Bacteria 4074
148 Ga0075429_100084262 3300006880 Bacteria 2771
149 Ga0075429_100127235 3300006880 Bacteria 2228
150 Ga0075429_100327423 3300006880 Bacteria 1341
151 Ga0075429_100810202 3300006880 Bacteria 820
152 Ga0075436_100010001 3300006914 Bacteria 6488
153 Ga0075436_100150130 3300006914 Unclassified 1640
154 Ga0075436_100224884 3300006914 Bacteria 1332
155 Ga0075436_100303068 3300006914 Unclassified 1145
156 Ga0075436_100754490 3300006914 Bacteria 723
157 Ga0097620_100036540 3300006931 Bacteria 4931
158 Ga0075435_100001263 3300007076 Bacteria 16223
159 Ga0075435_100006094 3300007076 Bacteria 8497
160 Ga0075435_100049786 3300007076 Bacteria 3370
161 Ga0075435_100139054 3300007076 Bacteria 2036
162 Ga0099794_10002527 3300007265 Bacteria 6763
163 Ga0099794_10013275 3300007265 Bacteria 3581
164 Ga0099794_10234837 3300007265 Bacteria 944
165 Ga0111539_10001824 3300009094 Bacteria 28361
166 Ga0111539_10007628 3300009094 Bacteria 13825
167 Ga0111539_10669426 3300009094 Unclassified 1209
168 Ga0114129_10001324 3300009147 Bacteria 33148
169 Ga0114129_10002094 3300009147 Bacteria 27441
170 Ga0114129_10002125 3300009147 Bacteria 27316
171 Ga0114129_10007569 3300009147 Bacteria 15469
172 Ga0114129_10043236 3300009147 Bacteria 6338
173 Ga0114129_10046854 3300009147 Bacteria 6076
174 Ga0114129_10087422 3300009147 Bacteria 4322
175 Ga0114129_10111170 3300009147 Bacteria 3781
176 Ga0114129_10118805 3300009147 Bacteria 3642
177 Ga0114129_10361295 3300009147 Bacteria 1921
178 Ga0114129_10368239 3300009147 Bacteria 1900
179 Ga0114129_10371182 3300009147 Bacteria 1891
180 Ga0114129_10648008 3300009147 Bacteria 1364
181 Ga0114129_10942119 3300009147 Bacteria 1091
182 Ga0114129_11278082 3300009147 Unclassified 910
183 Ga0105243_10379589 3300009148 Unclassified 1307
184 Ga0105241_10163748 3300009174 Bacteria 1831
185 Ga0105242_10011339 3300009176 Bacteria 6852
186 Ga0105242_10129269 3300009176 Bacteria 2178
187 Ga0105249_10127861 3300009553 Bacteria 2422
188 Ga0105249_10183718 3300009553 Bacteria 2036
189 Ga0105249_10191135 3300009553 Bacteria 1998
190 Ga0105249_10237628 3300009553 Unclassified 1800
191 Ga0157373_10817059 3300013100 Bacteria 688
192 Ga0157371_10178900 3300013102 Bacteria 1517
193 Ga0157378_10120202 3300013297 Bacteria 2421
194 Ga0157378_10633903 3300013297 Bacteria 1083
195 Ga0163162_10122182 3300013306 Bacteria 2709
196 Ga0163162_12210272 3300013306 Unclassified 632
197 Ga0157372_11218330 3300013307 Bacteria 870
198 Ga0157375_10243021 3300013308 Bacteria 1960
199 Ga0157380_10170348 3300014326 Bacteria 1902
200 Ga0157380_10589868 3300014326 Bacteria 1097
201 Ga0157379_10872177 3300014968 Bacteria 852
202 Ga0163161_10112074 3300017792 Bacteria 2041
203 Ga0163161_10742785 3300017792 Archaea 820
204 Ga0207653_10011146 3300025885 Bacteria 2806
205 Ga0207653_10023191 3300025885 Bacteria 1976
206 Ga0207685_10038644 3300025905 Bacteria 1766
207 Ga0207645_10090327 3300025907 Bacteria 1969
208 Ga0207643_10339407 3300025908 Bacteria 941
209 Ga0207684_10001031 3300025910 Bacteria 31246
210 Ga0207684_10002789 3300025910 Bacteria 17357
211 Ga0207684_10004654 3300025910 Bacteria 12885
212 Ga0207684_10011210 3300025910 Bacteria 7851
213 Ga0207684_10019541 3300025910 Bacteria 5794
214 Ga0207684_10071381 3300025910 Bacteria 2950
215 Ga0207684_10111600 3300025910 Bacteria 2340
216 Ga0207684_10200722 3300025910 Bacteria 1720
217 Ga0207684_11028357 3300025910 Unclassified 688
218 Ga0207654_10169634 3300025911 Unclassified 1416
219 Ga0207654_10314985 3300025911 Bacteria 1068
220 Ga0207693_10018687 3300025915 Bacteria 5517
221 Ga0207693_10144655 3300025915 Bacteria 1870
222 Ga0207646_10001001 3300025922 Bacteria 36304
223 Ga0207646_10007703 3300025922 Bacteria 10897
224 Ga0207646_10015363 3300025922 Bacteria 7233
225 Ga0207646_10019522 3300025922 Bacteria 6298
226 Ga0207646_10040691 3300025922 Bacteria 4179
227 Ga0207646_10050601 3300025922 Bacteria 3717
228 Ga0207646_10064490 3300025922 Bacteria 3270
229 Ga0207646_10073300 3300025922 Bacteria 3059
230 Ga0207646_10103693 3300025922 Bacteria 2551
231 Ga0207646_10200691 3300025922 Bacteria 1801
232 Ga0207646_10313641 3300025922 Bacteria 1417
233 Ga0207681_10153975 3300025923 Bacteria 1726
234 Ga0207659_10146761 3300025926 Bacteria 1838
235 Ga0207706_10035360 3300025933 Bacteria 4443
236 Ga0207686_10065897 3300025934 Bacteria 2311
237 Ga0207709_10101061 3300025935 Bacteria 1907
238 Ga0207704_10683228 3300025938 Bacteria 848
239 Ga0207665_10001227 3300025939 Bacteria 17293
240 Ga0207665_10582095 3300025939 Bacteria 872
241 Ga0207689_10049065 3300025942 Bacteria 3483
242 Ga0207689_10054936 3300025942 Bacteria 3279
243 Ga0207712_10140581 3300025961 Unclassified 1852
244 Ga0207712_10267743 3300025961 Bacteria 1388
245 Ga0207712_10340829 3300025961 Bacteria 1243
246 Ga0207678_10552492 3300026067 Bacteria 1007
247 Ga0207708_10212603 3300026075 Bacteria 1547
248 Ga0207641_10352796 3300026088 Bacteria 1402
249 Ga0207641_10382759 3300026088 Unclassified 1348
250 Ga0207648_10090921 3300026089 Bacteria 2668
251 Ga0207648_10684538 3300026089 Bacteria 949
252 Ga0207674_10039811 3300026116 Bacteria 4871
253 Ga0207675_100421038 3300026118 Bacteria 1319
254 Ga0209968_1025882 3300027526 Archaea 968
255 Ga0209998_10017692 3300027717 Unclassified 1509
256 Ga0209974_10029137 3300027876 Bacteria 1829
257 Ga0207428_10059520 3300027907 Bacteria 3029
258 Ga0268265_10074683 3300028380 Bacteria 2653
259 Ga0268265_10412236 3300028380 Bacteria 1252
260 Ga0268264_10036411 3300028381 Bacteria 4054
261 Ga0268264_10054872 3300028381 Bacteria 3328
262 Ga0268264_10206472 3300028381 Bacteria 1800
263 Ga0268264_10292956 3300028381 Bacteria 1529
264 Ga0268264_10369948 3300028381 Bacteria 1370
265 Ga0307408_100023624 3300031548 Bacteria 4190
266 Ga0307408_100387439 3300031548 Bacteria 1196
267 Ga0307408_100641598 3300031548 Bacteria 948
268 Ga0307405_10875238 3300031731 Unclassified 758
269 Ga0307413_10906641 3300031824 Bacteria 749
270 Ga0307410_10166255 3300031852 Unclassified 1658
271 Ga0307406_10097264 3300031901 Bacteria 1996
272 Ga0307407_10760540 3300031903 Bacteria 734
273 Ga0307412_10160107 3300031911 Unclassified 1671
274 Ga0307409_100387953 3300031995 Bacteria 1330
275 Ga0307409_100430057 3300031995 Bacteria 1269
276 Ga0307409_101545423 3300031995 Unclassified 691
277 Ga0307416_100076747 3300032002 Bacteria 2802
278 Ga0307411_10413149 3300032005 Bacteria 1119
279 Ga0307415_100380851 3300032126 Bacteria 1198
280 Ga0373948_0021569 3300034817 Bacteria 1235
281 Ga0373949_0021742 3300035090 Bacteria 1474
282 Ga0373939_0446602 3300035114 Bacteria 544
283 Ga0395900_0461886 3300037418 Bacteria 1224
284 Ga0395901_0182669 3300038443 Bacteria 2200
285 Ga0395901_0331267 3300038443 Bacteria 1574
286 Ga0242420_015664 3300038996 Unclassified 1313
287 Ga0242420_036770 3300038996 Bacteria 926
288 Ga0242420_037432 3300038996 Bacteria 919
289 Ga0439450_027165 3300042008 Archaea 1266
290 Ga0439455_0005806 3300042012 Bacteria 2527
291 Ga0450898_087455 3300042134 Unclassified 640
292 Ga0439459_0067720 3300042438 Bacteria 820
293 Ga0451577_0004244 3300042876 Bacteria 15254
294 Ga0451577_0093620 3300042876 Bacteria 2683
295 Ga0451577_0388853 3300042876 Bacteria 1266
296 Ga0451577_0491001 3300042876 Bacteria 1115
297 Ga0453683_0031811 3300044673 Bacteria 3332
298 Ga0453683_0102678 3300044673 Bacteria 1795
299 Ga0453684_0129419 3300044712 Bacteria 3031
300 Ga0453684_1317706 3300044712 Bacteria 752
301 Ga0451576_0034695 3300045051 Bacteria 5357
302 Ga0451576_0036947 3300045051 Bacteria 5175
303 Ga0451576_0130495 3300045051 Bacteria 2619
304 Ga0451576_0269516 3300045051 Unclassified 1780
305 Ga0451576_0380063 3300045051 Bacteria 1480
306 Ga0451576_0525657 3300045051 Bacteria 1243
307 Ga0451576_1339001 3300045051 Bacteria 746
308 Ga0495580_0063496 3300046472 Bacteria 2590
309 Ga0495580_0351887 3300046472 Bacteria 998
310 Ga0495642_0207913 3300046528 Bacteria 854
311 Ga0495656_0044196 3300046615 Bacteria 1874
312 Ga0495669_0021028 3300046684 Bacteria 2829
313 Ga0495670_0277699 3300046691 Unclassified 896
314 Ga0495670_0319799 3300046691 Bacteria 833
315 Ga0501296_018336 3300049519 Unclassified 881
316 Ga0501033_0254387 3300049570 Bacteria 1244
317 Ga0501033_0292410 3300049570 Bacteria 1148
318 Ga0501033_0311253 3300049570 Bacteria 1107
319 Ga0501036_0026522 3300049572 Bacteria 4892
320 Ga0501036_0253503 3300049572 Bacteria 1474
321 Ga0501036_0308175 3300049572 Bacteria 1324
322 Ga0501036_0706455 3300049572 Unclassified 833
323 Ga0501036_0860050 3300049572 Bacteria 745
324 Ga0501037_0147422 3300049573 Bacteria 1683
325 Ga0501037_0464842 3300049573 Bacteria 862
326 Ga0501038_0034792 3300049574 Bacteria 4427
327 Ga0501038_0086944 3300049574 Bacteria 2626
328 Ga0501038_0149941 3300049574 Bacteria 1902
329 Ga0501038_0359580 3300049574 Bacteria 1132
330 Ga0501038_0745999 3300049574 Bacteria 731
331 Ga0501039_0093144 3300049575 Bacteria 2348
332 Ga0501039_0135542 3300049575 Bacteria 1933
333 Ga0501039_0277264 3300049575 Bacteria 1318
334 Ga0501039_0360430 3300049575 Bacteria 1142
335 Ga0501040_0001726 3300049576 Bacteria 14025
336 Ga0501040_0028869 3300049576 Bacteria 3741
337 Ga0501040_0050115 3300049576 Bacteria 2855
338 Ga0501040_0061184 3300049576 Bacteria 2589
339 Ga0501040_0082780 3300049576 Bacteria 2225
340 Ga0501040_0149793 3300049576 Bacteria 1646
341 Ga0501040_0189112 3300049576 Unclassified 1461
342 Ga0501040_0820111 3300049576 Bacteria 673
343 Ga0501041_0021253 3300049577 Bacteria 3888
344 Ga0501041_0031875 3300049577 Bacteria 3186
345 Ga0501041_0041475 3300049577 Bacteria 2796
346 Ga0501041_0124199 3300049577 Bacteria 1605
347 Ga0501041_0407425 3300049577 Unclassified 862
348 Ga0501042_0003689 3300049578 Bacteria 9666
349 Ga0501042_0080757 3300049578 Bacteria 2330
350 Ga0501042_0184087 3300049578 Bacteria 1507
351 Ga0501042_0388776 3300049578 Bacteria 1010
352 Ga0501042_0426671 3300049578 Unclassified 961
353 Ga0501042_0519036 3300049578 Bacteria 865
354 Ga0501043_0061768 3300049579 Bacteria 2942
355 Ga0501043_0262429 3300049579 Bacteria 1328
356 Ga0501043_1050805 3300049579 Bacteria 577
357 Ga0501046_0000274 3300049580 Bacteria 52364
358 Ga0501046_0006243 3300049580 Bacteria 10580
359 Ga0501046_0216819 3300049580 Unclassified 1419
360 Ga0501046_0223050 3300049580 Bacteria 1395
361 Ga0501046_0489940 3300049580 Bacteria 881
362 Ga0501048_0044808 3300049582 Bacteria 3161
363 Ga0501048_0094904 3300049582 Bacteria 2104
364 Ga0501048_0121223 3300049582 Bacteria 1848
365 Ga0501048_0464593 3300049582 Unclassified 907
366 Ga0501048_0563349 3300049582 Unclassified 818
367 Ga0501048_0742042 3300049582 Bacteria 705
368 Ga0501067_0010267 3300049583 Bacteria 5181
369 Ga0501068_0058920 3300049584 Bacteria 2331
370 Ga0501068_0184545 3300049584 Bacteria 1320
371 Ga0501068_0232177 3300049584 Unclassified 1173
372 Ga0501068_0289876 3300049584 Bacteria 1047
373 Ga0501069_0167633 3300049585 Bacteria 1266
374 Ga0501069_0683830 3300049585 Unclassified 618
375 Ga0501070_0198006 3300049586 Bacteria 1650
376 Ga0501071_0042929 3300049587 Bacteria 3241
377 Ga0501071_0396867 3300049587 Bacteria 1053
378 Ga0501071_0521090 3300049587 Bacteria 912
379 Ga0501071_0766545 3300049587 Bacteria 743
380 Ga0501071_1314571 3300049587 Bacteria 558
381 Ga0501072_0022887 3300049588 Bacteria 4849
382 Ga0501072_0023761 3300049588 Bacteria 4761
383 Ga0501072_0075655 3300049588 Bacteria 2663
384 Ga0501072_0097476 3300049588 Bacteria 2337
385 Ga0501072_0137395 3300049588 Bacteria 1949
386 Ga0501072_0191462 3300049588 Bacteria 1631
387 Ga0501072_0491634 3300049588 Bacteria 971
388 Ga0501072_0547750 3300049588 Unclassified 914
389 Ga0501073_0514234 3300049589 Bacteria 828
390 Ga0501073_0994648 3300049589 Bacteria 577
391 Ga0501074_0039743 3300049590 Bacteria 3407
392 Ga0501074_0049850 3300049590 Bacteria 3023
393 Ga0501074_0139965 3300049590 Bacteria 1731
394 Ga0501074_0143224 3300049590 Bacteria 1709
395 Ga0501074_0363194 3300049590 Bacteria 1027
396 Ga0501074_0505738 3300049590 Bacteria 856
397 Ga0501075_0003597 3300049591 Bacteria 10389
398 Ga0501075_0018880 3300049591 Bacteria 4997
399 Ga0501075_0025618 3300049591 Bacteria 4333
400 Ga0501075_0052623 3300049591 Bacteria 3061
401 Ga0501075_0078706 3300049591 Bacteria 2495
402 Ga0501075_0126500 3300049591 Bacteria 1946
403 Ga0501075_0306871 3300049591 Bacteria 1209
404 Ga0501075_0348113 3300049591 Unclassified 1129
405 Ga0501076_0012092 3300049592 Bacteria 6450
406 Ga0501076_0013776 3300049592 Bacteria 6068
407 Ga0501076_0046699 3300049592 Bacteria 3422
408 Ga0501076_0085985 3300049592 Bacteria 2527
409 Ga0501076_0116593 3300049592 Bacteria 2161
410 Ga0501076_0129490 3300049592 Bacteria 2046
411 Ga0501076_0690720 3300049592 Bacteria 842
412 Ga0501077_0007378 3300049593 Bacteria 6777
413 Ga0501077_0041921 3300049593 Bacteria 2913
414 Ga0501077_0048196 3300049593 Bacteria 2706
415 Ga0501077_0080829 3300049593 Bacteria 2059
416 Ga0501077_0087175 3300049593 Unclassified 1979
417 Ga0501077_0279506 3300049593 Unclassified 1062
418 Ga0501079_0002813 3300049741 Bacteria 12689
419 Ga0501079_0004192 3300049741 Bacteria 10689
420 Ga0501079_0012523 3300049741 Bacteria 6473
421 Ga0501079_0044572 3300049741 Bacteria 3422
422 Ga0501079_0104864 3300049741 Bacteria 2193
423 Ga0501079_0147659 3300049741 Bacteria 1833
424 Ga0501079_0354123 3300049741 Bacteria 1150
425 Ga0501079_1001848 3300049741 Bacteria 658
426 Ga0501080_0079494 3300049742 Bacteria 3049
427 Ga0501080_0156344 3300049742 Bacteria 2106
428 Ga0501080_0458244 3300049742 Bacteria 1142
429 Ga0501080_1072039 3300049742 Bacteria 696
430 Ga0501081_0013847 3300049743 Bacteria 5307
431 Ga0501081_0015185 3300049743 Bacteria 5080
432 Ga0501081_0057852 3300049743 Bacteria 2681
433 Ga0501081_0065818 3300049743 Bacteria 2519
434 Ga0501081_0067719 3300049743 Bacteria 2485
435 Ga0501081_0079947 3300049743 Bacteria 2287
436 Ga0501081_0139263 3300049743 Bacteria 1738
437 Ga0501081_0252672 3300049743 Bacteria 1287
438 Ga0501081_0267440 3300049743 Bacteria 1250
439 Ga0501081_0351981 3300049743 Unclassified 1085
440 Ga0501081_0573097 3300049743 Unclassified 844
441 Ga0501083_0257098 3300049744 Unclassified 1136
442 Ga0501035_0214079 3300049822 Bacteria 1648
443 Ga0501035_0243996 3300049822 Bacteria 1527
444 Ga0501035_1137633 3300049822 Bacteria 608
445 Ga0501044_0538637 3300049823 Bacteria 1066
446 Ga0501045_0001377 3300049824 Bacteria 16198
447 Ga0501045_0053182 3300049824 Bacteria 2959
448 Ga0501045_0114765 3300049824 Bacteria 1998
449 Ga0501045_0188872 3300049824 Bacteria 1535
450 Ga0501045_0235099 3300049824 Bacteria 1364
451 nmdc:mga05p37_11269_c1 3300050507 Bacteria 10634
452 nmdc:mga05p37_1139571_c1 3300050507 Bacteria 812
453 nmdc:mga05p37_122943_c1 3300050507 Bacteria 3188
454 nmdc:mga05p37_159800_c1 3300050507 Bacteria 2752
455 nmdc:mga05p37_1687_c1 3300050507 Bacteria 25692
456 nmdc:mga05p37_1804993_c1 3300050507 Unclassified 590
457 nmdc:mga05p37_24888_c2 3300050507 Bacteria 6691
458 nmdc:mga05p37_35926_c1 3300050507 Bacteria 6080
459 nmdc:mga05p37_37833_c1 3300050507 Bacteria 5918
460 nmdc:mga05p37_413_c1 3300050507 Bacteria 46142
461 nmdc:mga05p37_523398_c1 3300050507 Bacteria 1356
462 nmdc:mga05p37_554713_c1 3300050507 Unclassified 1307
463 nmdc:mga05p37_578727_c1 3300050507 Bacteria 1272
464 nmdc:mga05p37_66921_c1 3300050507 Bacteria 4420
465 nmdc:mga05p37_67826_c1 3300050507 Bacteria 4388
466 nmdc:mga05p37_87525_c1 3300050507 Bacteria 3839
467 nmdc:mga09592_129012_c1 3300050508 Bacteria 2175
468 nmdc:mga09592_191940_c1 3300050508 Bacteria 1768
469 nmdc:mga09592_2297_c1 3300050508 Bacteria 15410
470 nmdc:mga09592_40347_c1 3300050508 Bacteria 3921
471 nmdc:mga09592_50898_c1 3300050508 Bacteria 3493
472 nmdc:mga09592_7709_c1 3300050508 Bacteria 8748
473 nmdc:mga09592_79812_c1 3300050508 Bacteria 2786
474 nmdc:mga0qj67_11088_c1 3300050509 Bacteria 6750
475 nmdc:mga0qj67_264542_c1 3300050509 Unclassified 1395
476 nmdc:mga0qj67_279827_c1 3300050509 Bacteria 1352
477 nmdc:mga06r32_154061_c1 3300050510 Bacteria 2278
478 nmdc:mga06r32_16239_c1 3300050510 Bacteria 6781
479 nmdc:mga06r32_19870_c1 3300050510 Bacteria 6173
480 nmdc:mga06r32_199138_c1 3300050510 Unclassified 1991
481 nmdc:mga06r32_20881_c1 3300050510 Bacteria 6036
482 nmdc:mga06r32_275752_c1 3300050510 Bacteria 1669
483 nmdc:mga06r32_401404_c1 3300050510 Bacteria 1353
484 nmdc:mga06r32_435981_c1 3300050510 Bacteria 1291
485 nmdc:mga06r32_44620_c1 3300050510 Bacteria 4222
486 nmdc:mga06r32_6620_c1 3300050510 Bacteria 10413
487 nmdc:mga08y16_431319_c1 3300050511 Bacteria 1346
488 nmdc:mga08y16_99432_c1 3300050511 Bacteria 3029
489 nmdc:mga0n895_1086942_c1 3300050512 Bacteria 778
490 nmdc:mga0n895_127_c1 3300050512 Bacteria 45097
491 nmdc:mga0n895_2666_c1 3300050512 Bacteria 14083
492 nmdc:mga0n895_28908_c1 3300050512 Bacteria 5279
493 nmdc:mga0n895_395467_c1 3300050512 Bacteria 1398
494 nmdc:mga0n895_411987_c1 3300050512 Bacteria 1366
495 nmdc:mga0n895_484706_c1 3300050512 Bacteria 1247
496 nmdc:mga0n895_65413_c1 3300050512 Bacteria 3599
497 nmdc:mga0rr50_206362_c1 3300050513 Unclassified 1617
498 nmdc:mga0rr50_362784_c1 3300050513 Bacteria 1220
499 nmdc:mga0rr50_4243_c1 3300050513 Bacteria 8387
500 nmdc:mga0rr50_643_c1 3300050513 Bacteria 18770
501 nmdc:mga0rr50_943269_c1 3300050513 Unclassified 736
502 nmdc:mga0rr50_9479_c1 3300050513 Bacteria 6123
503 nmdc:mga08x19_186163_c1 3300050514 Bacteria 1419
504 nmdc:mga08x19_193924_c1 3300050514 Unclassified 1391
505 nmdc:mga08x19_432581_c1 3300050514 Bacteria 925
506 nmdc:mga08x19_5677_c1 3300050514 Bacteria 7375
507 nmdc:mga08x19_594375_c1 3300050514 Bacteria 784
508 nmdc:mga08x19_88709_c1 3300050514 Bacteria 2039
509 nmdc:mga0a205_12592_c1 3300050515 Bacteria 7827
510 nmdc:mga0a205_433_c1 3300050515 Bacteria 32195
511 nmdc:mga0a205_60004_c1 3300050515 Bacteria 3674
512 nmdc:mga0a205_70222_c1 3300050515 Bacteria 3381
513 nmdc:mga0a205_9500_c1 3300050515 Bacteria 8897
514 Ga0501084_0046740 3300054114 Bacteria 3626
515 Ga0501084_0063276 3300054114 Bacteria 3097
516 Ga0501084_0096169 3300054114 Bacteria 2487
517 Ga0501084_0141899 3300054114 Unclassified 2023
518 Ga0501084_0210973 3300054114 Bacteria 1638
519 Ga0501084_0227852 3300054114 Bacteria 1573
520 Ga0501084_0368071 3300054114 Bacteria 1214
521 Ga0590075_014255 3300059424 Bacteria 1943
522 Ga0501082_0000462 3300060353 Bacteria 35910
523 Ga0501082_0026867 3300060353 Bacteria 4959
524 Ga0501082_0045724 3300060353 Bacteria 3775
525 Ga0501082_0060091 3300060353 Bacteria 3274
526 Ga0501082_0111418 3300060353 Bacteria 2369
527 Ga0501082_0264469 3300060353 Bacteria 1496
528 Ga0501082_0507462 3300060353 Unclassified 1054
529 Ga0501082_0661153 3300060353 Bacteria 914
530 Ga0501082_0907365 3300060353 Bacteria 771
531 Ga0501082_0933235 3300060353 Bacteria 759
532 Ga0501082_1493651 3300060353 Bacteria 590
533 Ga0530510_0000836 3300061734 Bacteria 20248
534 Ga0530510_0050016 3300061734 Bacteria 3019
535 Ga0530510_0199816 3300061734 Bacteria 1484
536 Ga0530510_0838557 3300061734 Bacteria 702
537 Ga0501042_0935463
538 Ga0068869_100037000
539 Ga0068869_100037618
540 Ga0070680_100049397
541 Ga0070689_100506997
542 Ga0070691_10002054
543 Ga0070692_10014445
544 Ga0070668_100739074
545 Ga0070669_100047065
546 Ga0070669_100128934
547 Ga0070669_100409570
548 Ga0070675_100479766
549 Ga0070667_100847293
550 Ga0070703_10002728
551 Ga0070703_10011506
552 Ga0070709_10083410
553 Ga0070705_100023670
554 Ga0070705_100166863
555 Ga0070694_100003138
556 Ga0070694_100150171
557 Ga0070708_100002970
558 Ga0070708_100003814
559 Ga0070708_100007414
560 Ga0070708_100025931
561 Ga0070708_100227116
562 Ga0070708_100324932
563 Ga0070708_100388152
564 Ga0070662_100449637
565 Ga0068867_100203250
566 Ga0068867_100446393
567 Ga0070706_100010004
568 Ga0070706_100018560
569 Ga0070706_100082268
570 Ga0070706_100175932
571 Ga0070706_100199035
572 Ga0070706_100379050
573 Ga0070706_100516997
574 Ga0070707_100004955
575 Ga0070707_100006005
576 Ga0070707_100011625
577 Ga0070707_100012067
578 Ga0070707_100032413
579 Ga0070707_100044212
580 Ga0070707_100065372
581 Ga0070707_100147066
582 Ga0070707_100218545
583 Ga0070707_100249296
584 Ga0070707_100340029
585 Ga0070707_100370009
586 Ga0070707_100666145
587 Ga0070698_100003435
588 Ga0070698_100007004
589 Ga0070698_100053717
590 Ga0070698_100077043
591 Ga0070698_100078727
592 Ga0070698_100163601
593 Ga0070698_100241225
594 Ga0070698_100843075
595 Ga0070699_100003211
596 Ga0070699_100036954
597 Ga0070699_100042725
598 Ga0070699_100063128
599 Ga0070699_100110569
600 Ga0070699_100267101
601 Ga0070699_100565558
602 Ga0070699_100572544
603 Ga0070679_100971980
604 Ga0070697_100005572
605 Ga0070697_100011134
606 Ga0070697_100042336
607 Ga0070697_100050409
608 Ga0070697_100066949
609 Ga0070697_100085903
610 Ga0070697_100112009
611 Ga0070697_100122221
612 Ga0070697_100267490
613 Ga0070695_100013504
614 Ga0070695_100020039
615 Ga0070695_100456924
616 Ga0070695_100765746
617 Ga0070696_100105234
618 Ga0070696_100139708
619 Ga0070696_100848347
620 Ga0070704_100073689
621 Ga0070704_100132513
622 Ga0070704_100362048
623 Ga0070704_100958158
624 Ga0070704_101450367
625 Ga0070702_100092440
626 Ga0068859_100036539
627 Ga0068863_100015562
628 Ga0068860_100018418
629 Ga0068860_100032146
630 Ga0068860_100412647
631 Ga0068860_101044309
632 Ga0068862_100041717
633 Ga0068862_100070778
634 Ga0068862_100137715
635 Ga0068862_100585835
636 Ga0081539_10000009
637 Ga0075432_10261213
638 Ga0070715_10023150
639 Ga0070716_100037026
640 Ga0070716_100110501
641 Ga0070716_100402137
642 Ga0070712_100003456
643 Ga0070712_100129968
644 Ga0075428_100007947
645 Ga0075428_100020121
646 Ga0075428_100095923
647 Ga0075428_100429221
648 Ga0075430_100005576
649 Ga0075430_100066253
650 Ga0075430_100076156
651 Ga0075430_100140980
652 Ga0075430_100600878
653 Ga0075430_100736367
654 Ga0075430_100926261
655 Ga0075431_100002218
656 Ga0075431_100002669
657 Ga0075431_100019920
658 Ga0075431_100022635
659 Ga0075431_100024572
660 Ga0075431_100042721
661 Ga0075431_100056802
662 Ga0075431_100117217
663 Ga0075431_100169647
664 Ga0075431_100248265
665 Ga0075431_100354846
666 Ga0075431_101131651
667 Ga0075433_10002272
668 Ga0075433_10003005
669 Ga0075433_10020140
670 Ga0075433_10041541
671 Ga0075433_10324284
672 Ga0075433_10661110
673 Ga0075433_10684531
674 Ga0075434_100005798
675 Ga0075434_100007086
676 Ga0075434_100032558
677 Ga0075434_100053034
678 Ga0075434_100095649
679 Ga0075434_100123333
680 Ga0075434_100975684
681 Ga0075429_100028142
682 Ga0075429_100039724
683 Ga0075429_100040143
684 Ga0075429_100084262
685 Ga0075429_100127235
686 Ga0075429_100327423
687 Ga0075429_100810202
688 Ga0075436_100010001
689 Ga0075436_100150130
690 Ga0075436_100224884
691 Ga0075436_100303068
692 Ga0075436_100754490
693 Ga0097620_100036540
694 Ga0075435_100001263
695 Ga0075435_100006094
696 Ga0075435_100049786
697 Ga0075435_100139054
698 Ga0099794_10002527
699 Ga0099794_10013275
700 Ga0099794_10234837
701 Ga0111539_10001824
702 Ga0111539_10007628
703 Ga0111539_10669426
704 Ga0114129_10001324
705 Ga0114129_10002094
706 Ga0114129_10002125
707 Ga0114129_10007569
708 Ga0114129_10043236
709 Ga0114129_10046854
710 Ga0114129_10087422
711 Ga0114129_10111170
712 Ga0114129_10118805
713 Ga0114129_10361295
714 Ga0114129_10368239
715 Ga0114129_10371182
716 Ga0114129_10648008
717 Ga0114129_10942119
718 Ga0114129_11278082
719 Ga0105243_10379589
720 Ga0105241_10163748
721 Ga0105242_10011339
722 Ga0105242_10129269
723 Ga0105249_10127861
724 Ga0105249_10183718
725 Ga0105249_10191135
726 Ga0105249_10237628
727 Ga0157373_10817059
728 Ga0157371_10178900
729 Ga0157378_10120202
730 Ga0157378_10633903
731 Ga0163162_10122182
732 Ga0163162_12210272
733 Ga0157372_11218330
734 Ga0157375_10243021
735 Ga0157380_10170348
736 Ga0157380_10589868
737 Ga0157379_10872177
738 Ga0163161_10112074
739 Ga0163161_10742785
740 Ga0207653_10011146
741 Ga0207653_10023191
742 Ga0207685_10038644
743 Ga0207645_10090327
744 Ga0207643_10339407
745 Ga0207684_10001031
746 Ga0207684_10002789
747 Ga0207684_10004654
748 Ga0207684_10011210
749 Ga0207684_10019541
750 Ga0207684_10071381
751 Ga0207684_10111600
752 Ga0207684_10200722
753 Ga0207684_11028357
754 Ga0207654_10169634
755 Ga0207654_10314985
756 Ga0207693_10018687
757 Ga0207693_10144655
758 Ga0207646_10001001
759 Ga0207646_10007703
760 Ga0207646_10015363
761 Ga0207646_10019522
762 Ga0207646_10040691
763 Ga0207646_10050601
764 Ga0207646_10064490
765 Ga0207646_10073300
766 Ga0207646_10103693
767 Ga0207646_10200691
768 Ga0207646_10313641
769 Ga0207681_10153975
770 Ga0207659_10146761
771 Ga0207706_10035360
772 Ga0207686_10065897
773 Ga0207709_10101061
774 Ga0207704_10683228
775 Ga0207665_10001227
776 Ga0207665_10582095
777 Ga0207689_10049065
778 Ga0207689_10054936
779 Ga0207712_10140581
780 Ga0207712_10267743
781 Ga0207712_10340829
782 Ga0207678_10552492
783 Ga0207708_10212603
784 Ga0207641_10352796
785 Ga0207641_10382759
786 Ga0207648_10090921
787 Ga0207648_10684538
788 Ga0207674_10039811
789 Ga0207675_100421038
790 Ga0209968_1025882
791 Ga0209998_10017692
792 Ga0209974_10029137
793 Ga0207428_10059520
794 Ga0268265_10074683
795 Ga0268265_10412236
796 Ga0268264_10036411
797 Ga0268264_10054872
798 Ga0268264_10206472
799 Ga0268264_10292956
800 Ga0268264_10369948
801 Ga0307408_100023624
802 Ga0307408_100387439
803 Ga0307408_100641598
804 Ga0307405_10875238
805 Ga0307413_10906641
806 Ga0307410_10166255
807 Ga0307406_10097264
808 Ga0307407_10760540
809 Ga0307412_10160107
810 Ga0307409_100387953
811 Ga0307409_100430057
812 Ga0307409_101545423
813 Ga0307416_100076747
814 Ga0307411_10413149
815 Ga0307415_100380851
816 Ga0373948_0021569
817 Ga0373949_0021742
818 Ga0373939_0446602
819 Ga0395900_0461886
820 Ga0395901_0182669
821 Ga0395901_0331267
822 Ga0242420_015664
823 Ga0242420_036770
824 Ga0242420_037432
825 Ga0439450_027165
826 Ga0439455_0005806
827 Ga0450898_087455
828 Ga0439459_0067720
829 Ga0451577_0004244
830 Ga0451577_0093620
831 Ga0451577_0388853
832 Ga0451577_0491001
833 Ga0453683_0031811
834 Ga0453683_0102678
835 Ga0453684_0129419
836 Ga0453684_1317706
837 Ga0451576_0034695
838 Ga0451576_0036947
839 Ga0451576_0130495
840 Ga0451576_0269516
841 Ga0451576_0380063
842 Ga0451576_0525657
843 Ga0451576_1339001
844 Ga0495580_0063496
845 Ga0495580_0351887
846 Ga0495642_0207913
847 Ga0495656_0044196
848 Ga0495669_0021028
849 Ga0495670_0277699
850 Ga0495670_0319799
851 Ga0501296_018336
852 Ga0501033_0254387
853 Ga0501033_0292410
854 Ga0501033_0311253
855 Ga0501036_0026522
856 Ga0501036_0253503
857 Ga0501036_0308175
858 Ga0501036_0706455
859 Ga0501036_0860050
860 Ga0501037_0147422
861 Ga0501037_0464842
862 Ga0501038_0034792
863 Ga0501038_0086944
864 Ga0501038_0149941
865 Ga0501038_0359580
866 Ga0501038_0745999
867 Ga0501039_0093144
868 Ga0501039_0135542
869 Ga0501039_0277264
870 Ga0501039_0360430
871 Ga0501040_0001726
872 Ga0501040_0028869
873 Ga0501040_0050115
874 Ga0501040_0061184
875 Ga0501040_0082780
876 Ga0501040_0149793
877 Ga0501040_0189112
878 Ga0501040_0820111
879 Ga0501041_0021253
880 Ga0501041_0031875
881 Ga0501041_0041475
882 Ga0501041_0124199
883 Ga0501041_0407425
884 Ga0501042_0003689
885 Ga0501042_0080757
886 Ga0501042_0184087
887 Ga0501042_0388776
888 Ga0501042_0426671
889 Ga0501042_0519036
890 Ga0501043_0061768
891 Ga0501043_0262429
892 Ga0501043_1050805
893 Ga0501046_0000274
894 Ga0501046_0006243
895 Ga0501046_0216819
896 Ga0501046_0223050
897 Ga0501046_0489940
898 Ga0501048_0044808
899 Ga0501048_0094904
900 Ga0501048_0121223
901 Ga0501048_0464593
902 Ga0501048_0563349
903 Ga0501048_0742042
904 Ga0501067_0010267
905 Ga0501068_0058920
906 Ga0501068_0184545
907 Ga0501068_0232177
908 Ga0501068_0289876
909 Ga0501069_0167633
910 Ga0501069_0683830
911 Ga0501070_0198006
912 Ga0501071_0042929
913 Ga0501071_0396867
914 Ga0501071_0521090
915 Ga0501071_0766545
916 Ga0501071_1314571
917 Ga0501072_0022887
918 Ga0501072_0023761
919 Ga0501072_0075655
920 Ga0501072_0097476
921 Ga0501072_0137395
922 Ga0501072_0191462
923 Ga0501072_0491634
924 Ga0501072_0547750
925 Ga0501073_0514234
926 Ga0501073_0994648
927 Ga0501074_0039743
928 Ga0501074_0049850
929 Ga0501074_0139965
930 Ga0501074_0143224
931 Ga0501074_0363194
932 Ga0501074_0505738
933 Ga0501075_0003597
934 Ga0501075_0018880
935 Ga0501075_0025618
936 Ga0501075_0052623
937 Ga0501075_0078706
938 Ga0501075_0126500
939 Ga0501075_0306871
940 Ga0501075_0348113
941 Ga0501076_0012092
942 Ga0501076_0013776
943 Ga0501076_0046699
944 Ga0501076_0085985
945 Ga0501076_0116593
946 Ga0501076_0129490
947 Ga0501076_0690720
948 Ga0501077_0007378
949 Ga0501077_0041921
950 Ga0501077_0048196
951 Ga0501077_0080829
952 Ga0501077_0087175
953 Ga0501077_0279506
954 Ga0501079_0002813
955 Ga0501079_0004192
956 Ga0501079_0012523
957 Ga0501079_0044572
958 Ga0501079_0104864
959 Ga0501079_0147659
960 Ga0501079_0354123
961 Ga0501079_1001848
962 Ga0501080_0079494
963 Ga0501080_0156344
964 Ga0501080_0458244
965 Ga0501080_1072039
966 Ga0501081_0013847
967 Ga0501081_0015185
968 Ga0501081_0057852
969 Ga0501081_0065818
970 Ga0501081_0067719
971 Ga0501081_0079947
972 Ga0501081_0139263
973 Ga0501081_0252672
974 Ga0501081_0267440
975 Ga0501081_0351981
976 Ga0501081_0573097
977 Ga0501083_0257098
978 Ga0501035_0214079
979 Ga0501035_0243996
980 Ga0501035_1137633
981 Ga0501044_0538637
982 Ga0501045_0001377
983 Ga0501045_0053182
984 Ga0501045_0114765
985 Ga0501045_0188872
986 Ga0501045_0235099
987 nmdc:mga05p37_11269_c1
988 nmdc:mga05p37_1139571_c1
989 nmdc:mga05p37_122943_c1
990 nmdc:mga05p37_159800_c1
991 nmdc:mga05p37_1687_c1
992 nmdc:mga05p37_1804993_c1
993 nmdc:mga05p37_24888_c2
994 nmdc:mga05p37_35926_c1
995 nmdc:mga05p37_37833_c1
996 nmdc:mga05p37_413_c1
997 nmdc:mga05p37_523398_c1
998 nmdc:mga05p37_554713_c1
999 nmdc:mga05p37_578727_c1
1000 nmdc:mga05p37_66921_c1
1001 nmdc:mga05p37_67826_c1
1002 nmdc:mga05p37_87525_c1
1003 nmdc:mga09592_129012_c1
1004 nmdc:mga09592_191940_c1
1005 nmdc:mga09592_2297_c1
1006 nmdc:mga09592_40347_c1
1007 nmdc:mga09592_50898_c1
1008 nmdc:mga09592_7709_c1
1009 nmdc:mga09592_79812_c1
1010 nmdc:mga0qj67_11088_c1
1011 nmdc:mga0qj67_264542_c1
1012 nmdc:mga0qj67_279827_c1
1013 nmdc:mga06r32_154061_c1
1014 nmdc:mga06r32_16239_c1
1015 nmdc:mga06r32_19870_c1
1016 nmdc:mga06r32_199138_c1
1017 nmdc:mga06r32_20881_c1
1018 nmdc:mga06r32_275752_c1
1019 nmdc:mga06r32_401404_c1
1020 nmdc:mga06r32_435981_c1
1021 nmdc:mga06r32_44620_c1
1022 nmdc:mga06r32_6620_c1
1023 nmdc:mga08y16_431319_c1
1024 nmdc:mga08y16_99432_c1
1025 nmdc:mga0n895_1086942_c1
1026 nmdc:mga0n895_127_c1
1027 nmdc:mga0n895_2666_c1
1028 nmdc:mga0n895_28908_c1
1029 nmdc:mga0n895_395467_c1
1030 nmdc:mga0n895_411987_c1
1031 nmdc:mga0n895_484706_c1
1032 nmdc:mga0n895_65413_c1
1033 nmdc:mga0rr50_206362_c1
1034 nmdc:mga0rr50_362784_c1
1035 nmdc:mga0rr50_4243_c1
1036 nmdc:mga0rr50_643_c1
1037 nmdc:mga0rr50_943269_c1
1038 nmdc:mga0rr50_9479_c1
1039 nmdc:mga08x19_186163_c1
1040 nmdc:mga08x19_193924_c1
1041 nmdc:mga08x19_432581_c1
1042 nmdc:mga08x19_5677_c1
1043 nmdc:mga08x19_594375_c1
1044 nmdc:mga08x19_88709_c1
1045 nmdc:mga0a205_12592_c1
1046 nmdc:mga0a205_433_c1
1047 nmdc:mga0a205_60004_c1
1048 nmdc:mga0a205_70222_c1
1049 nmdc:mga0a205_9500_c1
1050 Ga0501084_0046740
1051 Ga0501084_0063276
1052 Ga0501084_0096169
1053 Ga0501084_0141899
1054 Ga0501084_0210973
1055 Ga0501084_0227852
1056 Ga0501084_0368071
1057 Ga0590075_014255
1058 Ga0501082_0000462
1059 Ga0501082_0026867
1060 Ga0501082_0045724
1061 Ga0501082_0060091
1062 Ga0501082_0111418
1063 Ga0501082_0264469
1064 Ga0501082_0507462
1065 Ga0501082_0661153
1066 Ga0501082_0907365
1067 Ga0501082_0933235
1068 Ga0501082_1493651
1069 Ga0530510_0000836
1070 Ga0530510_0050016
1071 Ga0530510_0199816
1072 Ga0530510_0838557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map