F460807

General Info

Members Datasets Scaffolds Average Seq Length
536 311 1072 142

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10450107|Ga0307509_104501072
Length 172
Sequence MRVAGELLRGTGGTGEALPNSSHRNDLLRPMTAIWKQPVSVEILTAIHVNTTVPLLGIEFLEVGDDFIRARCPVDARTKQPAGILHGGISVVLAETLGSCGAAFAAPEGHRAVGLDINANHLRSVSEGWVTGVAKPFHVGRTTHVWQIELSNEKGQLTCVSRITMAILIPSA

Samples

Sample ID Description Type Environment
1 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
87 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
88 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
182 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
199 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
200 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
201 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
202 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
203 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
206 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
207 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
208 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
209 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
212 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
213 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
214 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
215 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
276 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
277 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
287 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
288 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
289 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
290 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
291 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
292 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
293 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
294 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
295 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
296 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
297 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
298 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
299 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
303 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
307 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
308 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
309 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
310 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
311 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.37
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.04
Nodule 0.37
Rhizoplane 4.48
Rhizosphere 50.37
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307509_10450107 3300031507 Bacteria 982
2 JGI24739J22299_10040550 3300001989 Bacteria 1553
3 JGI25152J39213_1020632 3300002773 Bacteria 1173
4 JGI25150J39212_1001870 3300002774 Bacteria 5551
5 JGI25150J39212_1034983 3300002774 Bacteria 673
6 JGI25159J45721_1003487 3300002987 Bacteria 5547
7 JGI25159J45721_1005654 3300002987 Bacteria 3888
8 JGI25151J46595_10010978 3300003187 Bacteria 4185
9 JGI25153J46596_10003806 3300003215 Bacteria 8322
10 JGI25153J46596_10015208 3300003215 Bacteria 3150
11 rootH1_10019653 3300003316 Bacteria 2027
12 rootH2_10011974 3300003320 Bacteria 4747
13 rootH2_10043127 3300003320 Bacteria 1495
14 rootL2_10183268 3300003322 Bacteria 2237
15 rootH1_10025650 3300003323 Bacteria 3954
16 JGI25160J50197_1003119 3300003354 Bacteria 7542
17 JGI25160J50197_1015383 3300003354 Bacteria 2513
18 JGI25161J50226_1008350 3300003374 Bacteria 1605
19 JGI25161J50226_1009830 3300003374 Bacteria 1326
20 JGI26138J51218_103059 3300003504 Bacteria 707
21 Ga0006562J51391_1177735 3300003578 Bacteria 4280
22 Ga0006562J51391_1177736 3300003578 Bacteria 1800
23 Ga0055527_1024836 3300003760 Bacteria 609
24 Ga0055535_1000133 3300003761 Bacteria 79386
25 Ga0055542_1000003 3300003762 Bacteria 582721
26 Ga0055526_1004193 3300003771 Bacteria 8759
27 Ga0055526_1004531 3300003771 Bacteria 8307
28 Ga0055537_1000206 3300003773 Bacteria 44166
29 Ga0055537_1001556 3300003773 Bacteria 8758
30 Ga0055537_1010692 3300003773 Bacteria 1917
31 Ga0055524_1002799 3300003775 Bacteria 8759
32 Ga0055524_1003036 3300003775 Bacteria 8307
33 Ga0055536_1008634 3300003781 Bacteria 4342
34 Ga0055536_1014382 3300003781 Bacteria 2783
35 Ga0055534_1000197 3300003784 Bacteria 44166
36 Ga0055534_1000772 3300003784 Bacteria 15091
37 Ga0055534_1004057 3300003784 Bacteria 4379
38 Ga0055534_1004524 3300003784 Bacteria 4001
39 Ga0055528_1000352 3300003790 Bacteria 37775
40 Ga0055528_1003236 3300003790 Bacteria 8307
41 Ga0055528_1023008 3300003790 Bacteria 1917
42 Ga0055528_1026257 3300003790 Bacteria 1680
43 Ga0055530_10000593 3300003791 Bacteria 31324
44 Ga0055530_10004662 3300003791 Bacteria 6957
45 Ga0055540_1007677 3300003792 Bacteria 4021
46 Ga0055540_1050125 3300003792 Bacteria 864
47 Ga0055531_10011731 3300003794 Bacteria 4193
48 Ga0055531_10015071 3300003794 Bacteria 3433
49 Ga0055543_1001224 3300004625 Bacteria 10755
50 Ga0065165_1001795 3300005262 Bacteria 21152
51 Ga0065165_1011981 3300005262 Bacteria 3564
52 Ga0065165_1062499 3300005262 Bacteria 1015
53 Ga0065714_10002999 3300005288 Bacteria 16414
54 Ga0065704_10474221 3300005289 Bacteria 687
55 Ga0070676_10148778 3300005328 Bacteria 1497
56 Ga0070670_100043425 3300005331 Bacteria 3864
57 Ga0070666_10153368 3300005335 Bacteria 1608
58 Ga0068868_101482485 3300005338 Bacteria 635
59 Ga0070660_100166306 3300005339 Bacteria 1779
60 Ga0070687_100016361 3300005343 Bacteria 3381
61 Ga0070668_100667209 3300005347 Bacteria 915
62 Ga0070675_101099054 3300005354 Bacteria 731
63 Ga0070671_100036590 3300005355 Bacteria 4071
64 Ga0070671_100085106 3300005355 Bacteria 2644
65 Ga0070673_100351729 3300005364 Bacteria 1308
66 Ga0070673_101057969 3300005364 Bacteria 757
67 Ga0070673_101122996 3300005364 Bacteria 735
68 Ga0070659_100224189 3300005366 Bacteria 1552
69 Ga0070659_100236197 3300005366 Bacteria 1511
70 Ga0070667_100039867 3300005367 Bacteria 3937
71 Ga0070667_100060735 3300005367 Bacteria 3199
72 Ga0070667_101308259 3300005367 Bacteria 679
73 Ga0070701_10622682 3300005438 Bacteria 717
74 Ga0070663_100123554 3300005455 Bacteria 1958
75 Ga0070663_101842918 3300005455 Bacteria 543
76 Ga0070662_101058408 3300005457 Bacteria 695
77 Ga0068867_100113778 3300005459 Bacteria 2083
78 Ga0070684_100109726 3300005535 Bacteria 2473
79 Ga0068853_100001906 3300005539 Bacteria 15366
80 Ga0068853_100212568 3300005539 Bacteria 1763
81 Ga0068853_100376772 3300005539 Bacteria 1325
82 Ga0070672_100040260 3300005543 Bacteria 3584
83 Ga0070672_100244562 3300005543 Bacteria 1510
84 Ga0070665_100026463 3300005548 Bacteria 5840
85 Ga0070665_100089102 3300005548 Bacteria 3091
86 Ga0070665_101049152 3300005548 Bacteria 827
87 Ga0068855_100136320 3300005563 Bacteria 2800
88 Ga0068855_101646158 3300005563 Bacteria 656
89 Ga0070664_100000906 3300005564 Bacteria 23107
90 Ga0070664_100026825 3300005564 Bacteria 4784
91 Ga0068857_100044583 3300005577 Bacteria 3934
92 Ga0068857_100184118 3300005577 Bacteria 1901
93 Ga0068854_100286283 3300005578 Bacteria 1328
94 Ga0068856_100399840 3300005614 Bacteria 1393
95 Ga0068852_100303257 3300005616 Bacteria 1547
96 Ga0068852_100361246 3300005616 Bacteria 1420
97 Ga0068852_102079791 3300005616 Bacteria 590
98 Ga0068859_100256912 3300005617 Bacteria 1838
99 Ga0068859_100995316 3300005617 Bacteria 921
100 Ga0068864_101772146 3300005618 Bacteria 623
101 Ga0068851_10008200 3300005834 Bacteria 4822
102 Ga0068851_10845737 3300005834 Bacteria 571
103 Ga0068863_100115485 3300005841 Bacteria 2558
104 Ga0068858_100035074 3300005842 Bacteria 4653
105 Ga0068860_100396629 3300005843 Bacteria 1364
106 Ga0068862_100631059 3300005844 Bacteria 1032
107 Ga0075365_10006694 3300006038 Bacteria 6369
108 Ga0075365_10024645 3300006038 Bacteria 3798
109 Ga0075365_10133362 3300006038 Bacteria 1720
110 Ga0075365_10814384 3300006038 Bacteria 659
111 Ga0075363_100729593 3300006048 Bacteria 599
112 Ga0075364_10046579 3300006051 Bacteria 2824
113 Ga0075364_10549147 3300006051 Bacteria 790
114 Ga0075362_10527560 3300006177 Bacteria 606
115 Ga0075369_10011862 3300006186 Bacteria 3433
116 Ga0075366_10019786 3300006195 Bacteria 3901
117 Ga0075366_10184448 3300006195 Bacteria 1268
118 Ga0075366_10449645 3300006195 Bacteria 795
119 Ga0075370_10022899 3300006353 Bacteria 3436
120 Ga0075370_10084099 3300006353 Bacteria 1831
121 Ga0075370_10163373 3300006353 Bacteria 1307
122 Ga0075370_10172701 3300006353 Bacteria 1271
123 Ga0075370_10179816 3300006353 Bacteria 1244
124 Ga0075370_10182189 3300006353 Bacteria 1236
125 Ga0068871_100095067 3300006358 Bacteria 2488
126 Ga0068871_100587177 3300006358 Bacteria 1012
127 Ga0097620_100256904 3300006931 Bacteria 1838
128 Ga0097620_100995335 3300006931 Bacteria 921
129 Ga0099826_10001174 3300006948 Bacteria 15137
130 Ga0105244_10008377 3300009036 Bacteria 6460
131 Ga0105244_10065916 3300009036 Bacteria 1813
132 Ga0105240_10207106 3300009093 Bacteria 2295
133 Ga0105245_10959277 3300009098 Bacteria 898
134 Ga0105243_10009905 3300009148 Bacteria 7247
135 Ga0105243_10441095 3300009148 Bacteria 1219
136 Ga0105243_11139708 3300009148 Bacteria 790
137 Ga0105242_10090604 3300009176 Bacteria 2573
138 Ga0105242_10215280 3300009176 Bacteria 1714
139 Ga0105248_10822666 3300009177 Bacteria 1048
140 Ga0105248_13165674 3300009177 Bacteria 524
141 Ga0105237_10032464 3300009545 Bacteria 5285
142 Ga0105238_10206127 3300009551 Bacteria 1942
143 Ga0105238_10773253 3300009551 Bacteria 975
144 Ga0105238_11824954 3300009551 Bacteria 640
145 Ga0105249_11677363 3300009553 Bacteria 708
146 Ga0105239_10100518 3300010375 Bacteria 3199
147 Ga0105239_10786920 3300010375 Bacteria 1090
148 Ga0105246_10062875 3300011119 Bacteria 2587
149 Ga0105246_10392895 3300011119 Bacteria 1150
150 Ga0105246_12048375 3300011119 Bacteria 553
151 Ga0157322_1006550 3300012490 Bacteria 837
152 Ga0157347_1010157 3300012502 Bacteria 984
153 Ga0157339_1000353 3300012505 Bacteria 2317
154 Ga0157373_10052066 3300013100 Bacteria 2914
155 Ga0157371_10026873 3300013102 Bacteria 4179
156 Ga0157370_10261664 3300013104 Bacteria 1599
157 Ga0157370_10299440 3300013104 Bacteria 1485
158 Ga0157374_10751783 3300013296 Bacteria 990
159 Ga0157374_11232254 3300013296 Bacteria 770
160 Ga0157378_10700257 3300013297 Bacteria 1032
161 Ga0157378_10709569 3300013297 Bacteria 1026
162 Ga0163162_10154783 3300013306 Bacteria 2412
163 Ga0163162_11069772 3300013306 Bacteria 913
164 Ga0157372_10039693 3300013307 Bacteria 5197
165 Ga0157375_10331923 3300013308 Bacteria 1686
166 Ga0157375_11334292 3300013308 Bacteria 844
167 Ga0157375_11715446 3300013308 Bacteria 744
168 Ga0157380_10028645 3300014326 Bacteria 4248
169 Ga0182008_10009543 3300014497 Bacteria 5230
170 Ga0157379_10073596 3300014968 Bacteria 3058
171 Ga0157376_10328039 3300014969 Bacteria 1457
172 Ga0157376_12438415 3300014969 Bacteria 563
173 Ga0182006_1022134 3300015261 Bacteria 2645
174 Ga0182007_10001063 3300015262 Bacteria 14973
175 Ga0182007_10006657 3300015262 Bacteria 4940
176 Ga0183362_10004 3300015683 Bacteria 569303
177 Ga0163161_10004815 3300017792 Bacteria 9404
178 Ga0163161_10031502 3300017792 Bacteria 3779
179 Ga0163161_10402126 3300017792 Bacteria 1098
180 Ga0209436_113339 3300025208 Bacteria 1348
181 Ga0209436_122991 3300025208 Bacteria 791
182 Ga0209672_105891 3300025228 Bacteria 2055
183 Ga0209147_100449 3300025229 Bacteria 25874
184 Ga0209258_100015 3300025242 Bacteria 706310
185 Ga0207425_1000405 3300025245 Bacteria 29038
186 Ga0207425_1002893 3300025245 Bacteria 5758
187 Ga0209148_1000028 3300025254 Bacteria 582773
188 Ga0209129_1000461 3300025258 Bacteria 29937
189 Ga0209129_1007161 3300025258 Bacteria 3394
190 Ga0209565_1000182 3300025263 Bacteria 77316
191 Ga0209565_1000646 3300025263 Bacteria 22549
192 Ga0209565_1006184 3300025263 Bacteria 3389
193 Ga0209673_1000106 3300025273 Bacteria 185426
194 Ga0209673_1000461 3300025273 Bacteria 68612
195 Ga0209673_1001670 3300025273 Bacteria 18991
196 Ga0209673_1003337 3300025273 Bacteria 9602
197 Ga0209130_1000485 3300025284 Bacteria 40942
198 Ga0209130_1000542 3300025284 Bacteria 38002
199 Ga0209130_1010682 3300025284 Bacteria 2510
200 Ga0209675_1000058 3300025291 Bacteria 185426
201 Ga0209675_1000369 3300025291 Bacteria 38317
202 Ga0209675_1001011 3300025291 Bacteria 17652
203 Ga0209675_1009637 3300025291 Bacteria 3389
204 Ga0209676_1000575 3300025292 Bacteria 55372
205 Ga0209676_1008604 3300025292 Bacteria 4524
206 Ga0209676_1011658 3300025292 Bacteria 3523
207 Ga0209676_1011741 3300025292 Bacteria 3504
208 Ga0209025_1000305 3300025294 Bacteria 109479
209 Ga0209025_1001143 3300025294 Bacteria 37800
210 Ga0209025_1017879 3300025294 Bacteria 4062
211 Ga0209025_1023795 3300025294 Bacteria 3187
212 Ga0209025_1105471 3300025294 Bacteria 880
213 Ga0209564_1000110 3300025295 Bacteria 212842
214 Ga0209564_1000123 3300025295 Bacteria 202487
215 Ga0209564_1040571 3300025295 Bacteria 1262
216 Ga0209758_1000039 3300025297 Bacteria 428951
217 Ga0209758_1022655 3300025297 Bacteria 2869
218 Ga0209050_1000015 3300025298 Bacteria 759102
219 Ga0209050_1001757 3300025298 Bacteria 21484
220 Ga0209050_1026248 3300025298 Bacteria 1956
221 Ga0209256_1000074 3300025299 Bacteria 236893
222 Ga0209256_1000082 3300025299 Bacteria 221491
223 Ga0209256_1021893 3300025299 Bacteria 1950
224 Ga0207426_1000112 3300025302 Bacteria 231436
225 Ga0207426_1000121 3300025302 Bacteria 219007
226 Ga0209051_1000081 3300025303 Bacteria 195619
227 Ga0209051_1001437 3300025303 Bacteria 20303
228 Ga0209051_1003682 3300025303 Bacteria 9907
229 Ga0209051_1007392 3300025303 Bacteria 6011
230 Ga0209051_1009495 3300025303 Bacteria 5009
231 Ga0209257_1000015 3300025304 Bacteria 908141
232 Ga0209257_1000026 3300025304 Bacteria 723225
233 Ga0209257_1001188 3300025304 Bacteria 32794
234 Ga0209257_1011735 3300025304 Bacteria 4168
235 Ga0207656_10010607 3300025321 Bacteria 3457
236 Ga0207655_1002128 3300025728 Bacteria 16541
237 Ga0207655_1045128 3300025728 Bacteria 1844
238 Ga0207682_10332499 3300025893 Bacteria 714
239 Ga0207642_10297517 3300025899 Bacteria 934
240 Ga0207642_10452839 3300025899 Bacteria 778
241 Ga0207688_10285770 3300025901 Bacteria 1006
242 Ga0207680_10135527 3300025903 Bacteria 1627
243 Ga0207680_10245628 3300025903 Bacteria 1235
244 Ga0207645_10058276 3300025907 Bacteria 2466
245 Ga0207654_11282323 3300025911 Bacteria 534
246 Ga0207671_10088390 3300025914 Bacteria 2331
247 Ga0207662_10215634 3300025918 Bacteria 1248
248 Ga0207649_10736904 3300025920 Bacteria 766
249 Ga0207694_10653087 3300025924 Bacteria 886
250 Ga0207650_10434029 3300025925 Bacteria 1091
251 Ga0207650_10501985 3300025925 Bacteria 1014
252 Ga0207659_10335661 3300025926 Bacteria 1251
253 Ga0207687_10265955 3300025927 Bacteria 1369
254 Ga0207644_10031847 3300025931 Bacteria 3677
255 Ga0207644_10426362 3300025931 Bacteria 1087
256 Ga0207690_10190898 3300025932 Bacteria 1549
257 Ga0207690_10540378 3300025932 Bacteria 946
258 Ga0207706_10228367 3300025933 Bacteria 1629
259 Ga0207686_11064656 3300025934 Bacteria 658
260 Ga0207709_10013268 3300025935 Bacteria 4546
261 Ga0207704_10510868 3300025938 Bacteria 970
262 Ga0207704_10952603 3300025938 Bacteria 724
263 Ga0207691_10233556 3300025940 Bacteria 1592
264 Ga0207691_10977427 3300025940 Bacteria 707
265 Ga0207691_10985267 3300025940 Bacteria 704
266 Ga0207711_10584045 3300025941 Bacteria 1042
267 Ga0207689_10167765 3300025942 Bacteria 1809
268 Ga0207679_10005146 3300025945 Bacteria 8188
269 Ga0207679_10092399 3300025945 Bacteria 2344
270 Ga0207667_10148751 3300025949 Bacteria 2411
271 Ga0207667_11150158 3300025949 Bacteria 757
272 Ga0207651_10427942 3300025960 Bacteria 1131
273 Ga0207668_10098987 3300025972 Bacteria 2162
274 Ga0207640_10021817 3300025981 Bacteria 3822
275 Ga0207640_10811682 3300025981 Bacteria 811
276 Ga0207658_10048511 3300025986 Bacteria 3114
277 Ga0207703_10896093 3300026035 Bacteria 849
278 Ga0207639_10023563 3300026041 Bacteria 4445
279 Ga0207639_10194206 3300026041 Bacteria 1736
280 Ga0207639_10220354 3300026041 Bacteria 1638
281 Ga0207639_10714027 3300026041 Bacteria 930
282 Ga0207639_10859463 3300026041 Bacteria 847
283 Ga0207678_10377989 3300026067 Bacteria 1224
284 Ga0207702_11367250 3300026078 Bacteria 702
285 Ga0207641_10029431 3300026088 Bacteria 4542
286 Ga0207641_11021473 3300026088 Bacteria 824
287 Ga0207648_10085364 3300026089 Bacteria 2754
288 Ga0207674_10053089 3300026116 Bacteria 4131
289 Ga0207675_102120586 3300026118 Bacteria 578
290 Ga0207683_10030023 3300026121 Bacteria 4708
291 Ga0207683_10101744 3300026121 Bacteria 2566
292 Ga0207683_10590582 3300026121 Bacteria 1028
293 Ga0207683_10969708 3300026121 Bacteria 789
294 Ga0207698_10212995 3300026142 Bacteria 1740
295 Ga0209970_1000297 3300027614 Bacteria 8189
296 Ga0209282_1032384 3300027666 Bacteria 3198
297 Ga0209974_10224935 3300027876 Bacteria 700
298 Ga0268266_10062451 3300028379 Bacteria 3215
299 Ga0268266_10112691 3300028379 Bacteria 2411
300 Ga0268266_10320482 3300028379 Bacteria 1450
301 Ga0268266_10559201 3300028379 Bacteria 1097
302 Ga0268266_10850615 3300028379 Bacteria 882
303 Ga0268265_10986168 3300028380 Bacteria 832
304 Ga0268264_11062806 3300028381 Bacteria 817
305 Ga0265334_10034508 3300028573 Bacteria 2007
306 Ga0307517_10278802 3300028786 Bacteria 955
307 Ga0307515_10000006 3300028794 Bacteria 725810
308 Ga0307515_10003269 3300028794 Bacteria 34269
309 Ga0307515_10023794 3300028794 Bacteria 10711
310 Ga0307515_10029894 3300028794 Bacteria 9182
311 Ga0307515_10057529 3300028794 Bacteria 5625
312 Ga0307515_10120107 3300028794 Bacteria 2984
313 Ga0307515_10142910 3300028794 Bacteria 2555
314 Ga0307515_10573952 3300028794 Bacteria 738
315 Ga0307512_10022753 3300030522 Bacteria 5619
316 Ga0307512_10143404 3300030522 Bacteria 1453
317 Ga0307512_10202645 3300030522 Bacteria 1071
318 Ga0265330_10000368 3300031235 Bacteria 31833
319 Ga0265332_10000394 3300031238 Bacteria 31776
320 Ga0265340_10025544 3300031247 Bacteria 2990
321 Ga0265327_10039615 3300031251 Bacteria 2557
322 Ga0265327_10153768 3300031251 Bacteria 1067
323 Ga0307513_10005085 3300031456 Bacteria 17406
324 Ga0307513_10154932 3300031456 Bacteria 2193
325 Ga0307513_10175603 3300031456 Bacteria 2013
326 Ga0307513_10222687 3300031456 Bacteria 1706
327 Ga0307509_10003916 3300031507 Bacteria 21998
328 Ga0307509_10006677 3300031507 Bacteria 15393
329 Ga0307509_10448161 3300031507 Bacteria 985
330 Ga0307408_100004207 3300031548 Bacteria 9800
331 Ga0307408_100136552 3300031548 Bacteria 1919
332 Ga0307408_100608413 3300031548 Bacteria 972
333 Ga0307408_101941324 3300031548 Bacteria 565
334 Ga0307508_10000028 3300031616 Bacteria 168639
335 Ga0307508_10000254 3300031616 Bacteria 65091
336 Ga0307508_10473391 3300031616 Bacteria 846
337 Ga0307514_10031044 3300031649 Bacteria 4285
338 Ga0265314_10000292 3300031711 Bacteria 71982
339 Ga0307516_10001925 3300031730 Bacteria 28437
340 Ga0307516_10011266 3300031730 Bacteria 9744
341 Ga0307405_10528787 3300031731 Bacteria 950
342 Ga0307413_10257674 3300031824 Bacteria 1298
343 Ga0307413_11236107 3300031824 Bacteria 651
344 Ga0307406_10068590 3300031901 Bacteria 2316
345 Ga0307406_10988757 3300031901 Bacteria 721
346 Ga0307407_10203094 3300031903 Bacteria 1329
347 Ga0307407_10400785 3300031903 Bacteria 984
348 Ga0307409_102931157 3300031995 Bacteria 504
349 Ga0307416_100408107 3300032002 Bacteria 1398
350 Ga0307414_10015332 3300032004 Bacteria 4626
351 Ga0307414_10597145 3300032004 Bacteria 989
352 Ga0307411_10228874 3300032005 Bacteria 1447
353 Ga0307507_10100353 3300033179 Bacteria 2426
354 Ga0307507_10175251 3300033179 Bacteria 1547
355 Ga0307510_10061923 3300033180 Bacteria 3829
356 Ga0307510_10095412 3300033180 Bacteria 2794
357 Ga0373931_0021332 3300035691 Bacteria 3249
358 Ga0373931_0837839 3300035691 Bacteria 615
359 Ga0395905_0156735 3300037471 Bacteria 2141
360 Ga0395901_0246368 3300038443 Bacteria 1863
361 Ga0451787_206049 3300041441 Bacteria 526
362 Ga0451791_0502816 3300041451 Bacteria 693
363 Ga0451791_1592747 3300041451 Bacteria 517
364 Ga0451793_0122007 3300041452 Bacteria 710
365 Ga0451793_0491369 3300041452 Bacteria 2691
366 Ga0451797_0043020 3300041453 Bacteria 564
367 Ga0451797_0730191 3300041453 Bacteria 2429
368 Ga0451797_1011916 3300041453 Bacteria 887
369 Ga0451797_1544582 3300041453 Bacteria 1075
370 Ga0451800_1342812 3300041459 Bacteria 1140
371 Ga0451802_0441883 3300041460 Bacteria 579
372 Ga0451802_1416091 3300041460 Bacteria 574
373 Ga0451807_1572285 3300041486 Bacteria 1650
374 Ga0451833_0261504 3300041491 Bacteria 1426
375 Ga0451837_0287279 3300041494 Bacteria 846
376 Ga0451839_0322877 3300041496 Bacteria 610
377 Ga0451851_0151585 3300041507 Bacteria 630
378 Ga0451843_0090589 3300041509 Bacteria 1185
379 Ga0451853_0137518 3300041512 Bacteria 506
380 Ga0439445_0004141 3300042004 Bacteria 3277
381 Ga0439455_0014283 3300042012 Bacteria 1811
382 Ga0439455_0050953 3300042012 Bacteria 1082
383 Ga0439463_016887 3300042016 Bacteria 1806
384 Ga0450911_000107 3300042115 Bacteria 34252
385 Ga0439458_0055082 3300042157 Bacteria 986
386 Ga0439464_0310862 3300042439 Bacteria 516
387 Ga0451577_0137339 3300042876 Bacteria 2195
388 Ga0451577_0982136 3300042876 Bacteria 759
389 Ga0451577_1320301 3300042876 Bacteria 641
390 Ga0451577_1379820 3300042876 Bacteria 625
391 Ga0453683_0001483 3300044673 Bacteria 20077
392 Ga0453684_0054091 3300044712 Bacteria 5233
393 Ga0451576_0009211 3300045051 Bacteria 11474
394 Ga0451576_0373992 3300045051 Bacteria 1493
395 Ga0495592_0690238 3300046454 Bacteria 615
396 Ga0495638_0033950 3300046460 Bacteria 3259
397 Ga0495651_0721699 3300046462 Bacteria 620
398 Ga0495610_0021260 3300046512 Bacteria 3573
399 Ga0495610_0031212 3300046512 Bacteria 2782
400 Ga0495616_0035345 3300046513 Bacteria 2587
401 Ga0495620_0037989 3300046515 Bacteria 2140
402 Ga0495620_0087960 3300046515 Bacteria 1249
403 Ga0495628_0530734 3300046516 Bacteria 847
404 Ga0495631_0000634 3300046518 Bacteria 22982
405 Ga0495632_0005536 3300046519 Bacteria 8326
406 Ga0495643_0024495 3300046522 Bacteria 3423
407 Ga0495663_0230088 3300046525 Bacteria 654
408 Ga0495663_0257033 3300046525 Bacteria 621
409 Ga0495666_0180086 3300046526 Bacteria 976
410 Ga0495666_0385732 3300046526 Bacteria 630
411 Ga0495642_0160004 3300046528 Bacteria 976
412 Ga0495652_0595039 3300046529 Bacteria 755
413 Ga0495654_0024279 3300046530 Bacteria 3134
414 Ga0495654_0058788 3300046530 Bacteria 1854
415 Ga0495621_0014566 3300046539 Bacteria 2491
416 Ga0495597_0001326 3300046542 Bacteria 18086
417 Ga0495645_0971389 3300046543 Bacteria 501
418 Ga0495622_0319104 3300046557 Bacteria 675
419 Ga0495633_0000657 3300046558 Bacteria 31904
420 Ga0495656_0009114 3300046615 Bacteria 3563
421 Ga0495668_0168650 3300046616 Bacteria 1199
422 Ga0495668_0547954 3300046616 Bacteria 638
423 Ga0495625_0006294 3300046660 Bacteria 10616
424 Ga0495625_0186432 3300046660 Bacteria 1377
425 Ga0495635_0147685 3300046663 Bacteria 1601
426 Ga0495588_0660806 3300046674 Bacteria 547
427 Ga0495657_0081281 3300046675 Bacteria 2096
428 Ga0495658_0479482 3300046683 Bacteria 795
429 Ga0495658_0503109 3300046683 Bacteria 775
430 Ga0495624_0193928 3300046690 Bacteria 1235
431 Ga0495676_0027975 3300047321 Bacteria 4825
432 Ga0495680_0201821 3300047322 Bacteria 1426
433 Ga0495687_000187 3300047443 Bacteria 90147
434 Ga0495686_0003359 3300047472 Bacteria 13945
435 Ga0495686_0115562 3300047472 Bacteria 1605
436 Ga0495593_0067023 3300047673 Bacteria 1869
437 Ga0495614_0012595 3300048089 Bacteria 3710
438 Ga0496101_0095335 3300048904 Bacteria 2219
439 Ga0496101_1080719 3300048904 Bacteria 630
440 Ga0496102_0005711 3300048905 Bacteria 10569
441 Ga0496102_0277531 3300048905 Bacteria 1580
442 Ga0496103_0061730 3300048906 Bacteria 2332
443 Ga0496107_0169052 3300048910 Bacteria 1622
444 Ga0496108_0048593 3300048911 Bacteria 3547
445 Ga0496110_0097750 3300048913 Bacteria 2630
446 Ga0496110_1801966 3300048913 Unclassified 522
447 Ga0496112_0780611 3300048915 Bacteria 881
448 Ga0496114_0199730 3300048917 Bacteria 1751
449 Ga0496116_0032642 3300048919 Bacteria 3707
450 Ga0496116_0228406 3300048919 Bacteria 946
451 Ga0496117_0027258 3300048920 Bacteria 4454
452 Ga0496117_0120010 3300048920 Bacteria 1617
453 Ga0496117_0156742 3300048920 Bacteria 1339
454 Ga0496118_0016464 3300048921 Bacteria 6781
455 Ga0496118_0043957 3300048921 Bacteria 3504
456 Ga0496119_0084480 3300048922 Bacteria 1820
457 Ga0496121_0011908 3300048924 Bacteria 9573
458 Ga0496121_0059532 3300048924 Bacteria 3148
459 Ga0496121_0066911 3300048924 Bacteria 2914
460 Ga0496121_0412936 3300048924 Bacteria 880
461 Ga0496122_0007142 3300048925 Bacteria 12524
462 Ga0496122_0122534 3300048925 Bacteria 1673
463 Ga0496122_0123631 3300048925 Bacteria 1662
464 Ga0496122_0371957 3300048925 Bacteria 737
465 Ga0496123_0174833 3300048926 Bacteria 1128
466 Ga0496123_0222094 3300048926 Bacteria 952
467 Ga0496124_0010935 3300048927 Bacteria 9130
468 Ga0496124_0056460 3300048927 Bacteria 3311
469 Ga0496124_0056537 3300048927 Bacteria 3308
470 Ga0496124_0703318 3300048927 Bacteria 640
471 Ga0496125_0001361 3300048928 Bacteria 36000
472 Ga0496125_0003321 3300048928 Bacteria 19662
473 Ga0496125_0011410 3300048928 Bacteria 8888
474 Ga0496125_0017874 3300048928 Bacteria 6745
475 Ga0496125_0037817 3300048928 Bacteria 4191
476 Ga0496125_0075592 3300048928 Bacteria 2606
477 Ga0496125_0702377 3300048928 Bacteria 537
478 Ga0496126_0142422 3300048929 Bacteria 2062
479 Ga0496126_0238597 3300048929 Bacteria 1520
480 Ga0496126_0352027 3300048929 Bacteria 1204
481 Ga0496126_0458739 3300048929 Bacteria 1024
482 Ga0496126_0664971 3300048929 Bacteria 813
483 Ga0501034_0188942 3300049571 Bacteria 2023
484 Ga0501071_0307163 3300049587 Bacteria 1203
485 Ga0501259_143847 3300049688 Bacteria 586
486 Ga0501241_016988 3300049758 Bacteria 1330
487 Ga0501266_000347 3300049763 Bacteria 6131
488 nmdc:mga03683_232303_c1 3300050489 Bacteria 853
489 nmdc:mga00v17_12860_c1 3300050491 Bacteria 4630
490 nmdc:mga00v17_217989_c1 3300050491 Bacteria 1235
491 nmdc:mga00v17_281255_c1 3300050491 Bacteria 1080
492 nmdc:mga0yw44_4696_c1 3300050492 Bacteria 6315
493 nmdc:mga0yw44_619667_c1 3300050492 Bacteria 735
494 nmdc:mga0yw44_64044_c1 3300050492 Bacteria 2262
495 nmdc:mga0yw44_704399_c1 3300050492 Bacteria 686
496 nmdc:mga0k408_15571_c1 3300050493 Bacteria 4205
497 nmdc:mga0k408_191196_c1 3300050493 Bacteria 1221
498 nmdc:mga0k408_444692_c1 3300050493 Bacteria 770
499 nmdc:mga07m45_30036_c1 3300050496 Bacteria 3009
500 nmdc:mga07m45_33658_c1 3300050496 Bacteria 2847
501 nmdc:mga07m45_834071_c1 3300050496 Bacteria 528
502 nmdc:mga0sz30_37335_c1 3300050516 Bacteria 2033
503 nmdc:mga0sz30_89181_c1 3300050516 Bacteria 1340
504 Ga0500643_165813 3300053087 Bacteria 592
505 Ga0500651_0002119 3300053093 Bacteria 10327
506 Ga0500556_0000714 3300053104 Bacteria 20113
507 Ga0500560_016681 3300053107 Bacteria 2010
508 Ga0500562_012270 3300053108 Bacteria 2178
509 Ga0500562_015738 3300053108 Bacteria 1942
510 Ga0500571_000120 3300053110 Bacteria 25884
511 Ga0500572_047289 3300053111 Bacteria 1271
512 Ga0500592_036463 3300053116 Bacteria 795
513 Ga0500593_006915 3300053117 Bacteria 4573
514 Ga0500594_0003171 3300053118 Bacteria 3601
515 Ga0500607_024268 3300053121 Bacteria 3389
516 Ga0500608_069405 3300053122 Bacteria 1676
517 Ga0500618_053388 3300053125 Bacteria 913
518 Ga0500618_091131 3300053125 Bacteria 685
519 Ga0500626_222795 3300053128 Bacteria 725
520 Ga0500628_105087 3300053129 Bacteria 751
521 Ga0500655_000968 3300053133 Bacteria 5531
522 Ga0500655_007554 3300053133 Bacteria 1955
523 Ga0500658_0004750 3300053134 Bacteria 5061
524 Ga0500658_0005317 3300053134 Bacteria 4787
525 Ga0500658_0008312 3300053134 Bacteria 3835
526 Ga0500559_0044486 3300053136 Bacteria 1942
527 Ga0500561_0067269 3300053137 Bacteria 1017
528 Ga0500564_172251 3300053138 Bacteria 908
529 Ga0500568_0004355 3300053139 Bacteria 7578
530 Ga0500616_0016885 3300053153 Bacteria 4145
531 Ga0500625_121333 3300053729 Bacteria 1050
532 Ga0500565_004671 3300053734 Bacteria 1170
533 Ga0500587_000722 3300053739 Bacteria 4242
534 2587754301 2585428062 Bacteria 6842168
535 2929205235 2929199973 Bacteria 7260745
536 8055913414 8055909800 Bacteria 7278581
537 Ga0307509_10450107
538 JGI24739J22299_10040550
539 JGI25152J39213_1020632
540 JGI25150J39212_1001870
541 JGI25150J39212_1034983
542 JGI25159J45721_1003487
543 JGI25159J45721_1005654
544 JGI25151J46595_10010978
545 JGI25153J46596_10003806
546 JGI25153J46596_10015208
547 rootH1_10019653
548 rootH2_10011974
549 rootH2_10043127
550 rootL2_10183268
551 rootH1_10025650
552 JGI25160J50197_1003119
553 JGI25160J50197_1015383
554 JGI25161J50226_1008350
555 JGI25161J50226_1009830
556 JGI26138J51218_103059
557 Ga0006562J51391_1177735
558 Ga0006562J51391_1177736
559 Ga0055527_1024836
560 Ga0055535_1000133
561 Ga0055542_1000003
562 Ga0055526_1004193
563 Ga0055526_1004531
564 Ga0055537_1000206
565 Ga0055537_1001556
566 Ga0055537_1010692
567 Ga0055524_1002799
568 Ga0055524_1003036
569 Ga0055536_1008634
570 Ga0055536_1014382
571 Ga0055534_1000197
572 Ga0055534_1000772
573 Ga0055534_1004057
574 Ga0055534_1004524
575 Ga0055528_1000352
576 Ga0055528_1003236
577 Ga0055528_1023008
578 Ga0055528_1026257
579 Ga0055530_10000593
580 Ga0055530_10004662
581 Ga0055540_1007677
582 Ga0055540_1050125
583 Ga0055531_10011731
584 Ga0055531_10015071
585 Ga0055543_1001224
586 Ga0065165_1001795
587 Ga0065165_1011981
588 Ga0065165_1062499
589 Ga0065714_10002999
590 Ga0065704_10474221
591 Ga0070676_10148778
592 Ga0070670_100043425
593 Ga0070666_10153368
594 Ga0068868_101482485
595 Ga0070660_100166306
596 Ga0070687_100016361
597 Ga0070668_100667209
598 Ga0070675_101099054
599 Ga0070671_100036590
600 Ga0070671_100085106
601 Ga0070673_100351729
602 Ga0070673_101057969
603 Ga0070673_101122996
604 Ga0070659_100224189
605 Ga0070659_100236197
606 Ga0070667_100039867
607 Ga0070667_100060735
608 Ga0070667_101308259
609 Ga0070701_10622682
610 Ga0070663_100123554
611 Ga0070663_101842918
612 Ga0070662_101058408
613 Ga0068867_100113778
614 Ga0070684_100109726
615 Ga0068853_100001906
616 Ga0068853_100212568
617 Ga0068853_100376772
618 Ga0070672_100040260
619 Ga0070672_100244562
620 Ga0070665_100026463
621 Ga0070665_100089102
622 Ga0070665_101049152
623 Ga0068855_100136320
624 Ga0068855_101646158
625 Ga0070664_100000906
626 Ga0070664_100026825
627 Ga0068857_100044583
628 Ga0068857_100184118
629 Ga0068854_100286283
630 Ga0068856_100399840
631 Ga0068852_100303257
632 Ga0068852_100361246
633 Ga0068852_102079791
634 Ga0068859_100256912
635 Ga0068859_100995316
636 Ga0068864_101772146
637 Ga0068851_10008200
638 Ga0068851_10845737
639 Ga0068863_100115485
640 Ga0068858_100035074
641 Ga0068860_100396629
642 Ga0068862_100631059
643 Ga0075365_10006694
644 Ga0075365_10024645
645 Ga0075365_10133362
646 Ga0075365_10814384
647 Ga0075363_100729593
648 Ga0075364_10046579
649 Ga0075364_10549147
650 Ga0075362_10527560
651 Ga0075369_10011862
652 Ga0075366_10019786
653 Ga0075366_10184448
654 Ga0075366_10449645
655 Ga0075370_10022899
656 Ga0075370_10084099
657 Ga0075370_10163373
658 Ga0075370_10172701
659 Ga0075370_10179816
660 Ga0075370_10182189
661 Ga0068871_100095067
662 Ga0068871_100587177
663 Ga0097620_100256904
664 Ga0097620_100995335
665 Ga0099826_10001174
666 Ga0105244_10008377
667 Ga0105244_10065916
668 Ga0105240_10207106
669 Ga0105245_10959277
670 Ga0105243_10009905
671 Ga0105243_10441095
672 Ga0105243_11139708
673 Ga0105242_10090604
674 Ga0105242_10215280
675 Ga0105248_10822666
676 Ga0105248_13165674
677 Ga0105237_10032464
678 Ga0105238_10206127
679 Ga0105238_10773253
680 Ga0105238_11824954
681 Ga0105249_11677363
682 Ga0105239_10100518
683 Ga0105239_10786920
684 Ga0105246_10062875
685 Ga0105246_10392895
686 Ga0105246_12048375
687 Ga0157322_1006550
688 Ga0157347_1010157
689 Ga0157339_1000353
690 Ga0157373_10052066
691 Ga0157371_10026873
692 Ga0157370_10261664
693 Ga0157370_10299440
694 Ga0157374_10751783
695 Ga0157374_11232254
696 Ga0157378_10700257
697 Ga0157378_10709569
698 Ga0163162_10154783
699 Ga0163162_11069772
700 Ga0157372_10039693
701 Ga0157375_10331923
702 Ga0157375_11334292
703 Ga0157375_11715446
704 Ga0157380_10028645
705 Ga0182008_10009543
706 Ga0157379_10073596
707 Ga0157376_10328039
708 Ga0157376_12438415
709 Ga0182006_1022134
710 Ga0182007_10001063
711 Ga0182007_10006657
712 Ga0183362_10004
713 Ga0163161_10004815
714 Ga0163161_10031502
715 Ga0163161_10402126
716 Ga0209436_113339
717 Ga0209436_122991
718 Ga0209672_105891
719 Ga0209147_100449
720 Ga0209258_100015
721 Ga0207425_1000405
722 Ga0207425_1002893
723 Ga0209148_1000028
724 Ga0209129_1000461
725 Ga0209129_1007161
726 Ga0209565_1000182
727 Ga0209565_1000646
728 Ga0209565_1006184
729 Ga0209673_1000106
730 Ga0209673_1000461
731 Ga0209673_1001670
732 Ga0209673_1003337
733 Ga0209130_1000485
734 Ga0209130_1000542
735 Ga0209130_1010682
736 Ga0209675_1000058
737 Ga0209675_1000369
738 Ga0209675_1001011
739 Ga0209675_1009637
740 Ga0209676_1000575
741 Ga0209676_1008604
742 Ga0209676_1011658
743 Ga0209676_1011741
744 Ga0209025_1000305
745 Ga0209025_1001143
746 Ga0209025_1017879
747 Ga0209025_1023795
748 Ga0209025_1105471
749 Ga0209564_1000110
750 Ga0209564_1000123
751 Ga0209564_1040571
752 Ga0209758_1000039
753 Ga0209758_1022655
754 Ga0209050_1000015
755 Ga0209050_1001757
756 Ga0209050_1026248
757 Ga0209256_1000074
758 Ga0209256_1000082
759 Ga0209256_1021893
760 Ga0207426_1000112
761 Ga0207426_1000121
762 Ga0209051_1000081
763 Ga0209051_1001437
764 Ga0209051_1003682
765 Ga0209051_1007392
766 Ga0209051_1009495
767 Ga0209257_1000015
768 Ga0209257_1000026
769 Ga0209257_1001188
770 Ga0209257_1011735
771 Ga0207656_10010607
772 Ga0207655_1002128
773 Ga0207655_1045128
774 Ga0207682_10332499
775 Ga0207642_10297517
776 Ga0207642_10452839
777 Ga0207688_10285770
778 Ga0207680_10135527
779 Ga0207680_10245628
780 Ga0207645_10058276
781 Ga0207654_11282323
782 Ga0207671_10088390
783 Ga0207662_10215634
784 Ga0207649_10736904
785 Ga0207694_10653087
786 Ga0207650_10434029
787 Ga0207650_10501985
788 Ga0207659_10335661
789 Ga0207687_10265955
790 Ga0207644_10031847
791 Ga0207644_10426362
792 Ga0207690_10190898
793 Ga0207690_10540378
794 Ga0207706_10228367
795 Ga0207686_11064656
796 Ga0207709_10013268
797 Ga0207704_10510868
798 Ga0207704_10952603
799 Ga0207691_10233556
800 Ga0207691_10977427
801 Ga0207691_10985267
802 Ga0207711_10584045
803 Ga0207689_10167765
804 Ga0207679_10005146
805 Ga0207679_10092399
806 Ga0207667_10148751
807 Ga0207667_11150158
808 Ga0207651_10427942
809 Ga0207668_10098987
810 Ga0207640_10021817
811 Ga0207640_10811682
812 Ga0207658_10048511
813 Ga0207703_10896093
814 Ga0207639_10023563
815 Ga0207639_10194206
816 Ga0207639_10220354
817 Ga0207639_10714027
818 Ga0207639_10859463
819 Ga0207678_10377989
820 Ga0207702_11367250
821 Ga0207641_10029431
822 Ga0207641_11021473
823 Ga0207648_10085364
824 Ga0207674_10053089
825 Ga0207675_102120586
826 Ga0207683_10030023
827 Ga0207683_10101744
828 Ga0207683_10590582
829 Ga0207683_10969708
830 Ga0207698_10212995
831 Ga0209970_1000297
832 Ga0209282_1032384
833 Ga0209974_10224935
834 Ga0268266_10062451
835 Ga0268266_10112691
836 Ga0268266_10320482
837 Ga0268266_10559201
838 Ga0268266_10850615
839 Ga0268265_10986168
840 Ga0268264_11062806
841 Ga0265334_10034508
842 Ga0307517_10278802
843 Ga0307515_10000006
844 Ga0307515_10003269
845 Ga0307515_10023794
846 Ga0307515_10029894
847 Ga0307515_10057529
848 Ga0307515_10120107
849 Ga0307515_10142910
850 Ga0307515_10573952
851 Ga0307512_10022753
852 Ga0307512_10143404
853 Ga0307512_10202645
854 Ga0265330_10000368
855 Ga0265332_10000394
856 Ga0265340_10025544
857 Ga0265327_10039615
858 Ga0265327_10153768
859 Ga0307513_10005085
860 Ga0307513_10154932
861 Ga0307513_10175603
862 Ga0307513_10222687
863 Ga0307509_10003916
864 Ga0307509_10006677
865 Ga0307509_10448161
866 Ga0307408_100004207
867 Ga0307408_100136552
868 Ga0307408_100608413
869 Ga0307408_101941324
870 Ga0307508_10000028
871 Ga0307508_10000254
872 Ga0307508_10473391
873 Ga0307514_10031044
874 Ga0265314_10000292
875 Ga0307516_10001925
876 Ga0307516_10011266
877 Ga0307405_10528787
878 Ga0307413_10257674
879 Ga0307413_11236107
880 Ga0307406_10068590
881 Ga0307406_10988757
882 Ga0307407_10203094
883 Ga0307407_10400785
884 Ga0307409_102931157
885 Ga0307416_100408107
886 Ga0307414_10015332
887 Ga0307414_10597145
888 Ga0307411_10228874
889 Ga0307507_10100353
890 Ga0307507_10175251
891 Ga0307510_10061923
892 Ga0307510_10095412
893 Ga0373931_0021332
894 Ga0373931_0837839
895 Ga0395905_0156735
896 Ga0395901_0246368
897 Ga0451787_206049
898 Ga0451791_0502816
899 Ga0451791_1592747
900 Ga0451793_0122007
901 Ga0451793_0491369
902 Ga0451797_0043020
903 Ga0451797_0730191
904 Ga0451797_1011916
905 Ga0451797_1544582
906 Ga0451800_1342812
907 Ga0451802_0441883
908 Ga0451802_1416091
909 Ga0451807_1572285
910 Ga0451833_0261504
911 Ga0451837_0287279
912 Ga0451839_0322877
913 Ga0451851_0151585
914 Ga0451843_0090589
915 Ga0451853_0137518
916 Ga0439445_0004141
917 Ga0439455_0014283
918 Ga0439455_0050953
919 Ga0439463_016887
920 Ga0450911_000107
921 Ga0439458_0055082
922 Ga0439464_0310862
923 Ga0451577_0137339
924 Ga0451577_0982136
925 Ga0451577_1320301
926 Ga0451577_1379820
927 Ga0453683_0001483
928 Ga0453684_0054091
929 Ga0451576_0009211
930 Ga0451576_0373992
931 Ga0495592_0690238
932 Ga0495638_0033950
933 Ga0495651_0721699
934 Ga0495610_0021260
935 Ga0495610_0031212
936 Ga0495616_0035345
937 Ga0495620_0037989
938 Ga0495620_0087960
939 Ga0495628_0530734
940 Ga0495631_0000634
941 Ga0495632_0005536
942 Ga0495643_0024495
943 Ga0495663_0230088
944 Ga0495663_0257033
945 Ga0495666_0180086
946 Ga0495666_0385732
947 Ga0495642_0160004
948 Ga0495652_0595039
949 Ga0495654_0024279
950 Ga0495654_0058788
951 Ga0495621_0014566
952 Ga0495597_0001326
953 Ga0495645_0971389
954 Ga0495622_0319104
955 Ga0495633_0000657
956 Ga0495656_0009114
957 Ga0495668_0168650
958 Ga0495668_0547954
959 Ga0495625_0006294
960 Ga0495625_0186432
961 Ga0495635_0147685
962 Ga0495588_0660806
963 Ga0495657_0081281
964 Ga0495658_0479482
965 Ga0495658_0503109
966 Ga0495624_0193928
967 Ga0495676_0027975
968 Ga0495680_0201821
969 Ga0495687_000187
970 Ga0495686_0003359
971 Ga0495686_0115562
972 Ga0495593_0067023
973 Ga0495614_0012595
974 Ga0496101_0095335
975 Ga0496101_1080719
976 Ga0496102_0005711
977 Ga0496102_0277531
978 Ga0496103_0061730
979 Ga0496107_0169052
980 Ga0496108_0048593
981 Ga0496110_0097750
982 Ga0496110_1801966
983 Ga0496112_0780611
984 Ga0496114_0199730
985 Ga0496116_0032642
986 Ga0496116_0228406
987 Ga0496117_0027258
988 Ga0496117_0120010
989 Ga0496117_0156742
990 Ga0496118_0016464
991 Ga0496118_0043957
992 Ga0496119_0084480
993 Ga0496121_0011908
994 Ga0496121_0059532
995 Ga0496121_0066911
996 Ga0496121_0412936
997 Ga0496122_0007142
998 Ga0496122_0122534
999 Ga0496122_0123631
1000 Ga0496122_0371957
1001 Ga0496123_0174833
1002 Ga0496123_0222094
1003 Ga0496124_0010935
1004 Ga0496124_0056460
1005 Ga0496124_0056537
1006 Ga0496124_0703318
1007 Ga0496125_0001361
1008 Ga0496125_0003321
1009 Ga0496125_0011410
1010 Ga0496125_0017874
1011 Ga0496125_0037817
1012 Ga0496125_0075592
1013 Ga0496125_0702377
1014 Ga0496126_0142422
1015 Ga0496126_0238597
1016 Ga0496126_0352027
1017 Ga0496126_0458739
1018 Ga0496126_0664971
1019 Ga0501034_0188942
1020 Ga0501071_0307163
1021 Ga0501259_143847
1022 Ga0501241_016988
1023 Ga0501266_000347
1024 nmdc:mga03683_232303_c1
1025 nmdc:mga00v17_12860_c1
1026 nmdc:mga00v17_217989_c1
1027 nmdc:mga00v17_281255_c1
1028 nmdc:mga0yw44_4696_c1
1029 nmdc:mga0yw44_619667_c1
1030 nmdc:mga0yw44_64044_c1
1031 nmdc:mga0yw44_704399_c1
1032 nmdc:mga0k408_15571_c1
1033 nmdc:mga0k408_191196_c1
1034 nmdc:mga0k408_444692_c1
1035 nmdc:mga07m45_30036_c1
1036 nmdc:mga07m45_33658_c1
1037 nmdc:mga07m45_834071_c1
1038 nmdc:mga0sz30_37335_c1
1039 nmdc:mga0sz30_89181_c1
1040 Ga0500643_165813
1041 Ga0500651_0002119
1042 Ga0500556_0000714
1043 Ga0500560_016681
1044 Ga0500562_012270
1045 Ga0500562_015738
1046 Ga0500571_000120
1047 Ga0500572_047289
1048 Ga0500592_036463
1049 Ga0500593_006915
1050 Ga0500594_0003171
1051 Ga0500607_024268
1052 Ga0500608_069405
1053 Ga0500618_053388
1054 Ga0500618_091131
1055 Ga0500626_222795
1056 Ga0500628_105087
1057 Ga0500655_000968
1058 Ga0500655_007554
1059 Ga0500658_0004750
1060 Ga0500658_0005317
1061 Ga0500658_0008312
1062 Ga0500559_0044486
1063 Ga0500561_0067269
1064 Ga0500564_172251
1065 Ga0500568_0004355
1066 Ga0500616_0016885
1067 Ga0500625_121333
1068 Ga0500565_004671
1069 Ga0500587_000722
1070 2587754301
1071 2929205235
1072 8055913414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

82

159

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vh5-assembly1.cif.gz_A crystal structure of a putative thioesterase 0.9865 1 138
1vh9-assembly1.cif.gz_A crystal structure of a putative thioesterase 0.9847 1 137
4k4c-assembly1.cif.gz_D x-ray crystal structure of e. coli ybdb complexed with phenacyl-coa 0.9832 3 137
1vi8-assembly1.cif.gz_B crystal structure of a putative thioesterase 0.9823 1 140
3lz7-assembly1.cif.gz_A crystal structure of thioesterase hi1161 ec3.1.2.- from haemophilus influenzae. orthorombic crystal form. northeast structural genomics consortium target ir63 0.9799 3 138
ID Description Score Start End Superfamily
1sbkA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9621 4 138 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9472 22 140 3.10.129.10
1sbkA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9412 4 138 3.10.129.10
af_Q9M2E4_49_183_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9407 23 136 3.10.129.10
af_Q54GL4_70_197_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9356 14 140 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A8B6LFR4-F1-model_v4 Esterase (EC 3.1.2.-) 1.001 1 137 GO:0005829
GO:0061522
AF-A0A1H0LD91-F1-model_v4 Uncharacterized domain 1-containing protein 1.001 1 138 GO:0005829
GO:0061522
AF-A0A0S9NW76-F1-model_v4 Esterase 1 1 140 GO:0005829
GO:0061522
AF-A0A7Y0C1Z0-F1-model_v4 Hotdog fold thioesterase 0.9994 1 140 GO:0005829
GO:0061522
AF-C9YCE1-F1-model_v4 UPF0152 protein VC_A0580 (EC 4.99.1.1) 0.9994 1 140 GO:0005829
GO:0016829
GO:0061522

Map