F460754

General Info

Members Datasets Scaffolds Average Seq Length
536 383 416 412

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10015867|Ga0070681_100158673
Length 470
Sequence MGSFFSRVRFVDTRKRFGKFHKIVIANPAWAGLPNRRAVRYSVRNIRFLAEDFAHVRTFDRFFAGPYLVTDGTPSRPYARSAMAYVLAGGRGSRLLELTDKRAKPAVYFGCKSRIIDFALSNALNSGIRHIGVATQYKAHSLIRHLQRGWNFLRPERNESFDILPASQRVSETEWYAGTADAVYQNIDIIESYAPRHIIILAGDHIYKMDYEPMLQQHVAQEADVTVGCLEVPLAEAQAFGVMHVDASDRILAFVEKPKDPPSMPGKPDRALASIGIYVFDTKFLFDQLRRDAADPNSARDFGKDIIPYLVRNAKAVAHPYSRSCVRSAVQRHSYWRDVGTLDAYWSANLDLTDVLPELDLYDRHWPIWSYAEITPPAKFVYDVDGRRGTAISSLVSGGCIVSGATVIRSLLFTGTYLHSYSRVENAVILPYIPAGLVVGEDPALDAQRFRRTESGICLITKPMIDQLQA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
3 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
4 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
5 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
6 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
7 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
8 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
9 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
10 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
11 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
12 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
13 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
14 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
15 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
16 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
17 2738543024 Aminobacter sp. AP02 Isolate Unclassified
18 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
19 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
20 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
21 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
22 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
23 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
24 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
25 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
26 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
27 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
28 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
29 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
30 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
31 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
32 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
33 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
34 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
35 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
36 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
37 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
38 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
39 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
40 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
41 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
42 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
43 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
44 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
45 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
46 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
47 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
48 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
49 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
50 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
51 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
52 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
53 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
54 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
55 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
56 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
57 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
58 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
59 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
60 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
61 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
62 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
63 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
64 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
65 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
66 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
67 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
68 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
69 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
70 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
71 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
72 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
73 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
74 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
75 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
76 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
77 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
78 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
79 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
80 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
81 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
82 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
83 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
84 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
85 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
86 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
87 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
88 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
89 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
90 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
91 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
92 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
93 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
94 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
95 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
96 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
97 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
98 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
99 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
100 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
101 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
102 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
103 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
104 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
105 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
106 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
107 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
108 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
109 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
110 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
111 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
112 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
113 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
114 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
115 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
116 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
117 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
118 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
119 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
120 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
121 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
122 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
123 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
124 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
125 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
126 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
127 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
128 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
129 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
130 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
131 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
132 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
133 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
134 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
135 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
136 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
137 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
138 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
139 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
140 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
141 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
142 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
143 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
144 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
145 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
146 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
147 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
148 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
149 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
150 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
151 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
152 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
153 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
154 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
155 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
156 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
157 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
158 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
159 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
160 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
161 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
162 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
163 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
164 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
165 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
166 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
167 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
168 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
169 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
170 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
171 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
172 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
173 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
174 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
175 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
176 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
177 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
178 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
179 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
180 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
181 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
182 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
183 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
184 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
185 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
186 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
187 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
188 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
189 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
190 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
191 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
192 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
193 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
195 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
196 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
240 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
241 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
242 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
243 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
244 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
245 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
248 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
249 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
250 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
251 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
252 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
253 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
254 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
260 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
261 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
265 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
269 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
271 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
272 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
273 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
280 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
283 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
284 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
309 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
343 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
344 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
349 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
353 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
354 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
355 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
363 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
364 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
365 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
366 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
367 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
368 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
369 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
370 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
371 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
372 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
373 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
374 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
375 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
376 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
380 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
381 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
382 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
383 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.61
Metatranscriptomes 0
Isolates 22.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.46
Nodule 17.72
Rhizoplane 2.24
Rhizosphere 65.49
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10037570 3300001979 Bacteria 1493
2 JGI24739J22299_10018324 3300001989 Bacteria 2517
3 JGI24751J29686_10000002 3300002459 Bacteria 160619
4 JGI25156J39149_1001723 3300002705 Bacteria 8780
5 JGI25157J39369_1001529 3300002741 Bacteria 8392
6 JGI25406J46586_10000403 3300003203 Bacteria 19890
7 JGI25406J46586_10014481 3300003203 Bacteria 3353
8 JGI25165J46597_1000016 3300003214 Bacteria 377866
9 Ga0055542_1001310 3300003762 Bacteria 13179
10 Ga0065707_10082484 3300005295 Bacteria 14611
11 Ga0070658_10051154 3300005327 Bacteria 3348
12 Ga0070658_10091862 3300005327 Bacteria 2502
13 Ga0070676_10109368 3300005328 Bacteria 1719
14 Ga0070670_100000012 3300005331 Bacteria 256314
15 Ga0070670_100000863 3300005331 Bacteria 23798
16 Ga0070670_100002996 3300005331 Bacteria 13980
17 Ga0070670_100013630 3300005331 Bacteria 6966
18 Ga0070670_100121101 3300005331 Bacteria 2257
19 Ga0070677_10000500 3300005333 Bacteria 13513
20 Ga0070666_10013035 3300005335 Bacteria 5264
21 Ga0070660_100033819 3300005339 Bacteria 3857
22 Ga0070668_100000004 3300005347 Bacteria 189408
23 Ga0070669_100000041 3300005353 Bacteria 127426
24 Ga0070669_100001204 3300005353 Bacteria 18831
25 Ga0070669_100023365 3300005353 Bacteria 4427
26 Ga0070675_100000605 3300005354 Bacteria 24695
27 Ga0070671_100000289 3300005355 Bacteria 34220
28 Ga0070671_100000441 3300005355 Bacteria 28883
29 Ga0070671_100016874 3300005355 Bacteria 5907
30 Ga0070674_100003278 3300005356 Bacteria 9053
31 Ga0070674_100013585 3300005356 Bacteria 5038
32 Ga0070674_100202117 3300005356 Bacteria 1535
33 Ga0070674_100212632 3300005356 Bacteria 1500
34 Ga0070673_100010448 3300005364 Bacteria 6286
35 Ga0070659_100027452 3300005366 Bacteria 4387
36 Ga0070667_100000037 3300005367 Bacteria 172343
37 Ga0070667_100014025 3300005367 Bacteria 6624
38 Ga0070714_100215557 3300005435 Bacteria 1762
39 Ga0070713_100013956 3300005436 Bacteria 5948
40 Ga0070713_100052881 3300005436 Bacteria 3364
41 Ga0070713_100065338 3300005436 Bacteria 3056
42 Ga0070711_100032567 3300005439 Bacteria 3466
43 Ga0070663_100166460 3300005455 Bacteria 1701
44 Ga0070678_100006466 3300005456 Bacteria 6881
45 Ga0070678_100109081 3300005456 Bacteria 2162
46 Ga0070681_10015867 3300005458 Bacteria 7510
47 Ga0070681_10082256 3300005458 Bacteria 3175
48 Ga0068867_100012142 3300005459 Bacteria 6085
49 Ga0068867_100012571 3300005459 Bacteria 5986
50 Ga0070679_100033626 3300005530 Bacteria 5078
51 Ga0070679_100073201 3300005530 Bacteria 3418
52 Ga0070679_100145518 3300005530 Bacteria 2348
53 Ga0070672_100011953 3300005543 Bacteria 6069
54 Ga0070696_100049205 3300005546 Bacteria 2927
55 Ga0070665_100018129 3300005548 Bacteria 7063
56 Ga0070665_100080766 3300005548 Bacteria 3257
57 Ga0070665_100195818 3300005548 Bacteria 2022
58 Ga0068855_100002478 3300005563 Bacteria 22773
59 Ga0068857_100015748 3300005577 Bacteria 6616
60 Ga0068856_100044311 3300005614 Bacteria 4378
61 Ga0068856_100123655 3300005614 Bacteria 2590
62 Ga0068859_100007063 3300005617 Bacteria 11405
63 Ga0068859_100009326 3300005617 Bacteria 9906
64 Ga0068859_100056730 3300005617 Bacteria 3943
65 Ga0068864_100000010 3300005618 Bacteria 358723
66 Ga0068864_100272330 3300005618 Bacteria 1578
67 Ga0068861_100047771 3300005719 Bacteria 3232
68 Ga0068863_100004471 3300005841 Bacteria 13781
69 Ga0068863_100015027 3300005841 Bacteria 7437
70 Ga0068858_100000466 3300005842 Bacteria 42207
71 Ga0068858_100058649 3300005842 Bacteria 3560
72 Ga0068860_100000002 3300005843 Bacteria 627849
73 Ga0068860_100000073 3300005843 Bacteria 173235
74 Ga0068860_100142467 3300005843 Bacteria 2305
75 Ga0068862_100000016 3300005844 Bacteria 250031
76 Ga0068862_100001423 3300005844 Bacteria 22170
77 Ga0068862_100002964 3300005844 Bacteria 14824
78 Ga0068862_100289115 3300005844 Bacteria 1505
79 Ga0081455_10001156 3300005937 Bacteria 33081
80 Ga0081455_10104551 3300005937 Bacteria 2265
81 Ga0081455_10171900 3300005937 Bacteria 1650
82 Ga0081540_1015968 3300005983 Bacteria 4730
83 Ga0081539_10003049 3300005985 Bacteria 21640
84 Ga0070717_10038744 3300006028 Bacteria 3875
85 Ga0075363_100000506 3300006048 Bacteria 12473
86 Ga0075364_10001185 3300006051 Bacteria 13972
87 Ga0075362_10000008 3300006177 Bacteria 112391
88 Ga0075369_10003005 3300006186 Bacteria 6100
89 Ga0075366_10000332 3300006195 Bacteria 21695
90 Ga0097621_100001534 3300006237 Bacteria 15825
91 Ga0097621_100256637 3300006237 Bacteria 1532
92 Ga0075370_10000040 3300006353 Bacteria 41531
93 Ga0068871_100000172 3300006358 Bacteria 43437
94 Ga0068871_100011199 3300006358 Bacteria 6573
95 Ga0068871_100153053 3300006358 Bacteria 1968
96 Ga0075428_100140703 3300006844 Bacteria 2624
97 Ga0075430_100015722 3300006846 Bacteria 6447
98 Ga0075434_100084236 3300006871 Bacteria 3178
99 Ga0097620_100007063 3300006931 Bacteria 11405
100 Ga0097620_100009325 3300006931 Bacteria 9906
101 Ga0097620_100056731 3300006931 Bacteria 3943
102 Ga0105240_10002394 3300009093 Bacteria 30190
103 Ga0105240_10004750 3300009093 Bacteria 20518
104 Ga0105245_10201675 3300009098 Bacteria 1911
105 Ga0105243_10065613 3300009148 Bacteria 2917
106 Ga0105242_10137994 3300009176 Bacteria 2113
107 Ga0105248_10000053 3300009177 Bacteria 143972
108 Ga0105248_10051997 3300009177 Bacteria 4597
109 Ga0105248_10126736 3300009177 Bacteria 2880
110 Ga0105249_10068243 3300009553 Bacteria 3279
111 Ga0157378_10035796 3300013297 Bacteria 4393
112 Ga0163162_10192278 3300013306 Bacteria 2168
113 Ga0163163_10082470 3300014325 Bacteria 3219
114 Ga0157380_10000134 3300014326 Bacteria 41479
115 Ga0182008_10007111 3300014497 Bacteria 6197
116 Ga0157376_10183235 3300014969 Bacteria 1916
117 Ga0163161_10076413 3300017792 Bacteria 2458
118 Ga0213874_10005839 3300021377 Bacteria 2888
119 Ga0213876_10048517 3300021384 Bacteria 2243
120 Ga0213875_10001139 3300021388 Bacteria 18280
121 Ga0209026_1000005 3300025250 Bacteria 731387
122 Ga0209148_1000056 3300025254 Bacteria 363380
123 Ga0209759_1000106 3300025256 Bacteria 149959
124 Ga0209233_1000068 3300025261 Bacteria 377969
125 Ga0209455_1000285 3300025272 Bacteria 54489
126 Ga0209051_1004063 3300025303 Bacteria 9221
127 Ga0209257_1030208 3300025304 Bacteria 1753
128 Ga0207682_10002636 3300025893 Bacteria 7984
129 Ga0207692_10010580 3300025898 Bacteria 3893
130 Ga0207710_10110744 3300025900 Bacteria 1303
131 Ga0207688_10115687 3300025901 Bacteria 1561
132 Ga0207680_10009243 3300025903 Bacteria 4878
133 Ga0207647_10030768 3300025904 Bacteria 3460
134 Ga0207645_10005832 3300025907 Bacteria 8881
135 Ga0207705_10049952 3300025909 Bacteria 3010
136 Ga0207707_10020749 3300025912 Bacteria 5739
137 Ga0207707_10064752 3300025912 Bacteria 3182
138 Ga0207695_10011987 3300025913 Bacteria 10431
139 Ga0207695_10264431 3300025913 Bacteria 1617
140 Ga0207693_10004153 3300025915 Bacteria 12285
141 Ga0207663_10024609 3300025916 Bacteria 3469
142 Ga0207657_10013301 3300025919 Bacteria 8072
143 Ga0207657_10046657 3300025919 Bacteria 3794
144 Ga0207657_10119785 3300025919 Bacteria 2166
145 Ga0207652_10039205 3300025921 Bacteria 4020
146 Ga0207681_10000013 3300025923 Bacteria 357411
147 Ga0207681_10001625 3300025923 Bacteria 14491
148 Ga0207681_10011344 3300025923 Bacteria 5476
149 Ga0207650_10000008 3300025925 Bacteria 498534
150 Ga0207650_10000326 3300025925 Bacteria 46321
151 Ga0207650_10001003 3300025925 Bacteria 21229
152 Ga0207659_10005507 3300025926 Bacteria 7681
153 Ga0207687_10226183 3300025927 Bacteria 1476
154 Ga0207700_10048387 3300025928 Bacteria 3157
155 Ga0207644_10000011 3300025931 Bacteria 223950
156 Ga0207644_10000424 3300025931 Bacteria 27437
157 Ga0207690_10017629 3300025932 Bacteria 4365
158 Ga0207709_10020125 3300025935 Bacteria 3761
159 Ga0207669_10002254 3300025937 Bacteria 8197
160 Ga0207669_10046532 3300025937 Bacteria 2564
161 Ga0207669_10130897 3300025937 Bacteria 1724
162 Ga0207669_10162377 3300025937 Bacteria 1580
163 Ga0207691_10000049 3300025940 Bacteria 94813
164 Ga0207711_10006215 3300025941 Bacteria 10089
165 Ga0207711_10036889 3300025941 Bacteria 4149
166 Ga0207711_10078615 3300025941 Bacteria 2878
167 Ga0207711_10176114 3300025941 Bacteria 1943
168 Ga0207679_10125338 3300025945 Bacteria 2051
169 Ga0207667_10004694 3300025949 Bacteria 16723
170 Ga0207667_10415198 3300025949 Bacteria 1369
171 Ga0207712_10028976 3300025961 Bacteria 3709
172 Ga0207668_10000122 3300025972 Bacteria 54614
173 Ga0207668_10013605 3300025972 Bacteria 5018
174 Ga0207668_10144258 3300025972 Bacteria 1835
175 Ga0207640_10004035 3300025981 Bacteria 7931
176 Ga0207658_10000002 3300025986 Bacteria 1364188
177 Ga0207658_10000025 3300025986 Bacteria 182470
178 Ga0207658_10008204 3300025986 Bacteria 7115
179 Ga0207703_10001057 3300026035 Bacteria 26252
180 Ga0207703_10009799 3300026035 Bacteria 7515
181 Ga0207678_10115181 3300026067 Bacteria 2293
182 Ga0207678_10136584 3300026067 Bacteria 2092
183 Ga0207702_10021612 3300026078 Bacteria 5329
184 Ga0207641_10000557 3300026088 Bacteria 41685
185 Ga0207641_10007125 3300026088 Bacteria 9340
186 Ga0207641_10064387 3300026088 Bacteria 3133
187 Ga0207676_10000012 3300026095 Bacteria 353971
188 Ga0207676_10220582 3300026095 Bacteria 1688
189 Ga0207674_10014812 3300026116 Bacteria 8601
190 Ga0207674_10074948 3300026116 Bacteria 3394
191 Ga0207675_100022318 3300026118 Bacteria 5894
192 Ga0207675_100042438 3300026118 Bacteria 4247
193 Ga0268265_10000006 3300028380 Bacteria 466482
194 Ga0268265_10000849 3300028380 Bacteria 28736
195 Ga0268265_10002420 3300028380 Bacteria 14090
196 Ga0268264_10000001 3300028381 Bacteria 1221000
197 Ga0268264_10000120 3300028381 Bacteria 191138
198 Ga0268264_10074689 3300028381 Bacteria 2880
199 Ga0265318_10004967 3300028577 Bacteria 6333
200 Ga0265338_10006711 3300028800 Bacteria 14542
201 Ga0265338_10078184 3300028800 Bacteria 2792
202 Ga0265328_10003792 3300031239 Bacteria 6644
203 Ga0265320_10062514 3300031240 Bacteria 1773
204 Ga0265325_10042651 3300031241 Bacteria 2371
205 Ga0265325_10050947 3300031241 Bacteria 2130
206 Ga0265339_10023123 3300031249 Bacteria 3595
207 Ga0265339_10060562 3300031249 Bacteria 2040
208 Ga0265327_10007946 3300031251 Bacteria 8028
209 Ga0265316_10021301 3300031344 Bacteria 5494
210 Ga0265316_10190047 3300031344 Bacteria 1526
211 Ga0307408_100048163 3300031548 Bacteria 3056
212 Ga0265313_10013165 3300031595 Bacteria 4985
213 Ga0265314_10028015 3300031711 Bacteria 4207
214 Ga0265314_10030964 3300031711 Bacteria 3954
215 Ga0265314_10059937 3300031711 Bacteria 2600
216 Ga0307405_10006227 3300031731 Bacteria 5848
217 Ga0307405_10076885 3300031731 Bacteria 2167
218 Ga0307413_10090061 3300031824 Bacteria 1995
219 Ga0307413_10131598 3300031824 Bacteria 1713
220 Ga0307410_10044209 3300031852 Bacteria 2957
221 Ga0307406_10054295 3300031901 Bacteria 2556
222 Ga0307407_10006887 3300031903 Bacteria 5102
223 Ga0307412_10001365 3300031911 Bacteria 13577
224 Ga0307412_10027709 3300031911 Bacteria 3536
225 Ga0307409_100234830 3300031995 Bacteria 1665
226 Ga0307416_100010692 3300032002 Bacteria 6079
227 Ga0307415_100029346 3300032126 Bacteria 3514
228 Ga0307510_10041475 3300033180 Bacteria 5031
229 Ga0373944_0021439 3300035089 Bacteria 1870
230 Ga0373923_0028874 3300035111 Bacteria 2221
231 Ga0373953_0002266 3300035117 Bacteria 5782
232 Ga0373953_0039785 3300035117 Bacteria 1865
233 Ga0373954_0008602 3300035118 Bacteria 4488
234 Ga0373956_0011867 3300035119 Bacteria 3600
235 Ga0373957_0002105 3300035120 Bacteria 5590
236 Ga0373946_0016941 3300035171 Bacteria 2783
237 Ga0373924_0013636 3300035410 Bacteria 3056
238 Ga0373931_0008252 3300035691 Bacteria 4934
239 Ga0373931_0034403 3300035691 Bacteria 2630
240 Ga0373935_0005848 3300035692 Bacteria 7286
241 Ga0373935_0023300 3300035692 Bacteria 3804
242 Ga0373927_0028829 3300035695 Bacteria 3620
243 Ga0373927_0041734 3300035695 Bacteria 2975
244 Ga0373933_0027463 3300035724 Bacteria 3277
245 Ga0373947_0046720 3300035725 Bacteria 2593
246 Ga0373937_0000312 3300036401 Bacteria 45975
247 Ga0373937_0031997 3300036401 Bacteria 4769
248 Ga0373937_0056432 3300036401 Bacteria 3607
249 Ga0373925_0065346 3300037068 Bacteria 2740
250 Ga0373925_0073261 3300037068 Bacteria 2592
251 Ga0395898_0022622 3300037466 Bacteria 6365
252 Ga0436364_0252111 3300037853 Bacteria 9253
253 Ga0436364_1518815 3300037853 Bacteria 35900
254 Ga0395901_0050057 3300038443 Bacteria 4341
255 Ga0436365_0090053 3300039437 Bacteria 2357
256 Ga0436365_1805499 3300039437 Bacteria 3389
257 Ga0436360_0333527 3300039438 Bacteria 4057
258 Ga0436361_0251163 3300039447 Bacteria 2836
259 Ga0436363_0345584 3300039450 Bacteria 2171
260 Ga0436363_1166451 3300039450 Bacteria 7352
261 Ga0436362_0250154 3300039453 Bacteria 1639
262 Ga0451577_0011282 3300042876 Bacteria 8462
263 Ga0451577_0059376 3300042876 Bacteria 3410
264 Ga0466972_0013486 3300044658 Bacteria 4103
265 Ga0453684_0001014 3300044712 Bacteria 90517
266 Ga0453684_0047993 3300044712 Bacteria 5653
267 Ga0453684_0265872 3300044712 Bacteria 1962
268 Ga0466967_0371718 3300045976 Bacteria 1387
269 Ga0495629_0052423 3300046459 Bacteria 2855
270 Ga0495638_0062922 3300046460 Bacteria 2289
271 Ga0495662_0053762 3300046476 Bacteria 1945
272 Ga0495664_0008025 3300046477 Bacteria 5877
273 Ga0495585_0034993 3300046492 Bacteria 2840
274 Ga0495608_0024937 3300046511 Bacteria 4086
275 Ga0495608_0038798 3300046511 Bacteria 3196
276 Ga0495610_0000527 3300046512 Bacteria 38468
277 Ga0495628_0193241 3300046516 Bacteria 1536
278 Ga0495637_0037246 3300046520 Bacteria 2113
279 Ga0495643_0000027 3300046522 Bacteria 266446
280 Ga0495643_0025873 3300046522 Bacteria 3317
281 Ga0495640_0081850 3300046533 Bacteria 2146
282 Ga0495640_0121929 3300046533 Bacteria 1694
283 Ga0495587_0029876 3300046536 Bacteria 3307
284 Ga0495645_0002014 3300046543 Bacteria 13845
285 Ga0495645_0097649 3300046543 Bacteria 2092
286 Ga0495622_0000566 3300046557 Bacteria 22206
287 Ga0495667_0011135 3300046559 Bacteria 6087
288 Ga0495667_0016988 3300046559 Bacteria 4913
289 Ga0495625_0040966 3300046660 Bacteria 3373
290 Ga0495599_0005757 3300046678 Bacteria 7437
291 Ga0495599_0043980 3300046678 Bacteria 2802
292 Ga0495646_0007807 3300046680 Bacteria 6794
293 Ga0495604_0067379 3300047317 Bacteria 2720
294 Ga0495680_0038995 3300047322 Bacteria 3793
295 Ga0495675_0083963 3300047444 Bacteria 2004
296 Ga0495681_0000102 3300047470 Bacteria 75370
297 Ga0495686_0004233 3300047472 Bacteria 11897
298 Ga0495686_0018453 3300047472 Bacteria 4681
299 Ga0495686_0036627 3300047472 Bacteria 3149
300 Ga0495602_0000195 3300048088 Bacteria 57149
301 Ga0495602_0101950 3300048088 Bacteria 2353
302 Ga0496100_0008367 3300048903 Bacteria 5766
303 Ga0496101_0008317 3300048904 Bacteria 6780
304 Ga0496104_0032561 3300048907 Bacteria 4852
305 Ga0496106_0007764 3300048909 Bacteria 7936
306 Ga0496107_0000473 3300048910 Bacteria 22078
307 Ga0496108_0084372 3300048911 Bacteria 2696
308 Ga0496109_0053690 3300048912 Bacteria 3676
309 Ga0496109_0149249 3300048912 Bacteria 2188
310 Ga0496110_0057720 3300048913 Bacteria 3417
311 Ga0496110_0081669 3300048913 Bacteria 2882
312 Ga0496112_0007768 3300048915 Bacteria 9543
313 Ga0496113_0000241 3300048916 Bacteria 25760
314 Ga0496118_0097394 3300048921 Bacteria 2002
315 Ga0496121_0000031 3300048924 Bacteria 384119
316 Ga0496122_0006557 3300048925 Bacteria 13307
317 Ga0496123_0035943 3300048926 Bacteria 3522
318 Ga0496125_0022459 3300048928 Bacteria 5859
319 Ga0501031_0000104 3300049568 Bacteria 45024
320 Ga0501031_0011297 3300049568 Bacteria 5818
321 Ga0501032_0000008 3300049569 Bacteria 240313
322 Ga0501032_0052913 3300049569 Bacteria 2735
323 Ga0501033_0000012 3300049570 Bacteria 241599
324 Ga0501033_0054691 3300049570 Bacteria 2952
325 Ga0501034_0000035 3300049571 Bacteria 241623
326 Ga0501034_0009529 3300049571 Bacteria 10166
327 Ga0501034_0064066 3300049571 Bacteria 3689
328 Ga0501034_0077302 3300049571 Bacteria 3334
329 Ga0501034_0078510 3300049571 Bacteria 3305
330 Ga0501034_0290354 3300049571 Bacteria 1573
331 Ga0501036_0000006 3300049572 Bacteria 241623
332 Ga0501036_0004724 3300049572 Bacteria 10989
333 Ga0501037_0000072 3300049573 Bacteria 94452
334 Ga0501037_0035932 3300049573 Bacteria 3651
335 Ga0501037_0048548 3300049573 Bacteria 3110
336 Ga0501037_0088794 3300049573 Bacteria 2237
337 Ga0501038_0000007 3300049574 Bacteria 210775
338 Ga0501038_0012015 3300049574 Bacteria 7908
339 Ga0501038_0090139 3300049574 Bacteria 2571
340 Ga0501038_0120726 3300049574 Bacteria 2162
341 Ga0501039_0000012 3300049575 Bacteria 241623
342 Ga0501039_0004953 3300049575 Bacteria 10100
343 Ga0501042_0006052 3300049578 Bacteria 7836
344 Ga0501043_0000211 3300049579 Bacteria 53464
345 Ga0501043_0058059 3300049579 Bacteria 3038
346 Ga0501043_0066668 3300049579 Bacteria 2827
347 Ga0501043_0121263 3300049579 Bacteria 2051
348 Ga0501046_0023978 3300049580 Bacteria 5010
349 Ga0501046_0079145 3300049580 Bacteria 2541
350 Ga0501047_0007361 3300049581 Bacteria 10351
351 Ga0501047_0013458 3300049581 Bacteria 7755
352 Ga0501047_0036759 3300049581 Bacteria 4734
353 Ga0501047_0051297 3300049581 Bacteria 3985
354 Ga0501047_0053241 3300049581 Bacteria 3912
355 Ga0501047_0080081 3300049581 Bacteria 3140
356 Ga0501048_0033951 3300049582 Bacteria 3683
357 Ga0501069_0002147 3300049585 Bacteria 9931
358 Ga0501070_0008858 3300049586 Bacteria 8505
359 Ga0501070_0124535 3300049586 Bacteria 2130
360 Ga0501070_0258523 3300049586 Bacteria 1423
361 Ga0501073_0006521 3300049589 Bacteria 8682
362 Ga0501073_0046151 3300049589 Bacteria 3065
363 Ga0501073_0096703 3300049589 Bacteria 2051
364 Ga0501073_0102625 3300049589 Bacteria 1986
365 Ga0501074_0031381 3300049590 Bacteria 3849
366 Ga0501235_008716 3300049669 Bacteria 2213
367 Ga0501249_000044 3300049679 Bacteria 52592
368 Ga0501079_0017654 3300049741 Bacteria 5450
369 Ga0501080_0004939 3300049742 Bacteria 11876
370 Ga0501080_0164202 3300049742 Bacteria 2050
371 Ga0501083_0004503 3300049744 Bacteria 9843
372 Ga0501083_0048139 3300049744 Bacteria 2878
373 Ga0501241_003814 3300049758 Bacteria 2841
374 Ga0501264_002199 3300049761 Bacteria 1848
375 Ga0501035_0000035 3300049822 Bacteria 166916
376 Ga0501035_0004343 3300049822 Bacteria 13453
377 Ga0501035_0074121 3300049822 Bacteria 3011
378 Ga0501044_0000015 3300049823 Bacteria 241623
379 Ga0501044_0028797 3300049823 Bacteria 5859
380 Ga0501044_0039951 3300049823 Bacteria 4891
381 Ga0501044_0047829 3300049823 Bacteria 4423
382 nmdc:mga03683_15_c1 3300050489 Bacteria 102058
383 nmdc:mga03n38_397_c1 3300050490 Bacteria 10773
384 nmdc:mga00v17_5301_c1 3300050491 Bacteria 6794
385 nmdc:mga0yw44_97741_c1 3300050492 Bacteria 1866
386 nmdc:mga0k408_21_c1 3300050493 Bacteria 107428
387 nmdc:mga0k408_68201_c1 3300050493 Bacteria 2074
388 nmdc:mga06z11_39133_c1 3300050494 Bacteria 2358
389 nmdc:mga07m45_14_c1 3300050496 Bacteria 154035
390 nmdc:mga07m45_63734_c1 3300050496 Bacteria 2090
391 nmdc:mga0n895_91354_c1 3300050512 Bacteria 3047
392 nmdc:mga0sz30_2946_c1 3300050516 Bacteria 6100
393 Ga0495601_0001883 3300053077 Bacteria 11717
394 Ga0495612_0004884 3300053078 Bacteria 5551
395 Ga0500643_000008 3300053087 Bacteria 457931
396 Ga0500643_002856 3300053087 Bacteria 8608
397 Ga0500647_0012561 3300053091 Bacteria 3815
398 Ga0500651_0034421 3300053093 Bacteria 3194
399 Ga0500555_001529 3300053103 Bacteria 7002
400 Ga0500556_0000013 3300053104 Bacteria 243797
401 Ga0500595_000892 3300053119 Bacteria 17000
402 Ga0500618_003282 3300053125 Bacteria 5614
403 Ga0500618_006442 3300053125 Bacteria 3446
404 Ga0500642_0008136 3300053130 Bacteria 3569
405 Ga0500655_000081 3300053133 Bacteria 25123
406 Ga0500568_0000125 3300053139 Bacteria 68806
407 Ga0500590_000198 3300053148 Bacteria 18343
408 Ga0500636_0001280 3300053177 Bacteria 13646
409 Ga0500636_0007674 3300053177 Bacteria 6239
410 Ga0500570_000014 3300053724 Bacteria 52194
411 Ga0500645_000575 3300053730 Bacteria 23790
412 Ga0501084_0001034 3300054114 Bacteria 21610
413 Ga0501084_0036850 3300054114 Bacteria 4086
414 Ga0501084_0082979 3300054114 Bacteria 2690
415 Ga0501082_0002250 3300060353 Bacteria 16900
416 Ga0501082_0083449 3300060353 Bacteria 2757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025901 Ga0207688_10115687 Ga0207688_101156872 338
2 3300039447 Ga0436361_0251163 Ga0436361_0251163_1566_2741 341
3 3300013306 Ga0163162_10192278 Ga0163162_101922782 364
4 3300025303 Ga0209051_1004063 Ga0209051_10040636 364
5 3300005331 Ga0070670_100000863 Ga0070670_1000008633 365
6 3300005333 Ga0070677_10000500 Ga0070677_100005003 365
7 3300005354 Ga0070675_100000605 Ga0070675_1000006054 365
8 3300005355 Ga0070671_100016874 Ga0070671_1000168742 365
9 3300005356 Ga0070674_100003278 Ga0070674_1000032785 365
10 3300005364 Ga0070673_100010448 Ga0070673_1000104482 365
11 3300005456 Ga0070678_100006466 Ga0070678_1000064663 365
12 3300005459 Ga0068867_100012571 Ga0068867_1000125712 365
13 3300005543 Ga0070672_100011953 Ga0070672_1000119533 365
14 3300005618 Ga0068864_100272330 Ga0068864_1002723301 365
15 3300009148 Ga0105243_10065613 Ga0105243_100656132 365
16 3300025893 Ga0207682_10002636 Ga0207682_100026364 365
17 3300025925 Ga0207650_10000326 Ga0207650_100003263 365
18 3300025926 Ga0207659_10005507 Ga0207659_100055072 365
19 3300025935 Ga0207709_10020125 Ga0207709_100201252 365
20 3300025937 Ga0207669_10002254 Ga0207669_100022544 365
21 3300025940 Ga0207691_10000049 Ga0207691_1000004934 365
22 3300025945 Ga0207679_10125338 Ga0207679_101253381 365
23 3300026095 Ga0207676_10220582 Ga0207676_102205822 365
24 3300031548 Ga0307408_100048163 Ga0307408_1000481632 365
25 3300031731 Ga0307405_10006227 Ga0307405_100062274 365
26 3300031824 Ga0307413_10131598 Ga0307413_101315981 365
27 3300031901 Ga0307406_10054295 Ga0307406_100542952 365
28 3300031911 Ga0307412_10027709 Ga0307412_100277093 365
29 3300032002 Ga0307416_100010692 Ga0307416_1000106922 365
30 3300032126 Ga0307415_100029346 Ga0307415_1000293462 365
31 3300048911 Ga0496108_0084372 Ga0496108_0084372_733_1992 365
32 3300048912 Ga0496109_0053690 Ga0496109_0053690_1423_2682 365
33 3300005455 Ga0070663_100166460 Ga0070663_1001664601 366
34 3300005459 Ga0068867_100012142 Ga0068867_1000121423 366
35 3300025907 Ga0207645_10005832 Ga0207645_100058324 366
36 3300025972 Ga0207668_10013605 Ga0207668_100136052 366
37 3300026067 Ga0207678_10136584 Ga0207678_101365841 366
38 3300031995 Ga0307409_100234830 Ga0307409_1002348301 366
39 3300005356 Ga0070674_100013585 Ga0070674_1000135852 367
40 3300005456 Ga0070678_100109081 Ga0070678_1001090812 367
41 3300025937 Ga0207669_10046532 Ga0207669_100465322 367
42 3300021377 Ga0213874_10005839 Ga0213874_100058393 369
43 3300039450 Ga0436363_1166451 Ga0436363_1166451_4891_6144 369
44 3300046492 Ga0495585_0034993 Ga0495585_0034993_763_2025 369
45 3300048924 Ga0496121_0000031 Ga0496121_0000031_257784_259013 369
46 3300021384 Ga0213876_10048517 Ga0213876_100485172 370
47 3300039437 Ga0436365_0090053 Ga0436365_0090053_633_1916 370
48 3300045976 Ga0466967_0371718 Ga0466967_0371718_68_1330 370
49 3300031249 Ga0265339_10060562 Ga0265339_100605622 371
50 3300031344 Ga0265316_10190047 Ga0265316_101900471 371
51 3300031711 Ga0265314_10059937 Ga0265314_100599372 371
52 3300035691 Ga0373931_0008252 Ga0373931_0008252_2673_3986 373
53 3300006871 Ga0075434_100084236 Ga0075434_1000842361 375
54 3300050512 nmdc:mga0n895_91354_c1 nmdc:mga0n895_91354_c1_1648_2907 375
55 iso_pu_bacteria 8004395343 8004401386 376
56 3300005937 Ga0081455_10001156 Ga0081455_1000115615 378
57 3300005983 Ga0081540_1015968 Ga0081540_10159684 378
58 3300044712 Ga0453684_0265872 Ga0453684_0265872_99_1364 378
59 3300047472 Ga0495686_0004233 Ga0495686_0004233_4190_5542 378
60 3300048913 Ga0496110_0081669 Ga0496110_0081669_1085_2350 378
61 3300042876 Ga0451577_0059376 Ga0451577_0059376_432_1697 380
62 3300005719 Ga0068861_100047771 Ga0068861_1000477712 381
63 3300026118 Ga0207675_100042438 Ga0207675_1000424383 381
64 3300039450 Ga0436363_0345584 Ga0436363_0345584_332_1609 381
65 3300039453 Ga0436362_0250154 Ga0436362_0250154_78_1355 381
66 3300042876 Ga0451577_0011282 Ga0451577_0011282_4579_5844 381
67 3300044712 Ga0453684_0001014 Ga0453684_0001014_63786_65051 381
68 3300005577 Ga0068857_100015748 Ga0068857_1000157483 384
69 3300005614 Ga0068856_100044311 Ga0068856_1000443113 384
70 3300026078 Ga0207702_10021612 Ga0207702_100216124 384
71 3300026116 Ga0207674_10014812 Ga0207674_100148123 384
72 3300036401 Ga0373937_0031997 Ga0373937_0031997_477_1745 386
73 3300049761 Ga0501264_002199 Ga0501264_002199_418_1659 386
74 3300005546 Ga0070696_100049205 Ga0070696_1000492052 387
75 3300033180 Ga0307510_10041475 Ga0307510_100414752 387
76 3300049589 Ga0501073_0006521 Ga0501073_0006521_7140_8414 388
77 3300050496 nmdc:mga07m45_63734_c1 nmdc:mga07m45_63734_c1_16_1296 388
78 3300054114 Ga0501084_0082979 Ga0501084_0082979_1250_2524 388
79 3300060353 Ga0501082_0083449 Ga0501082_0083449_185_1459 388
80 3300005331 Ga0070670_100002996 Ga0070670_1000029965 389
81 3300005347 Ga0070668_100000004 Ga0070668_10000000420 389
82 3300005353 Ga0070669_100023365 Ga0070669_1000233653 389
83 3300005355 Ga0070671_100000441 Ga0070671_10000044121 389
84 3300005367 Ga0070667_100000037 Ga0070667_10000003718 389
85 3300005617 Ga0068859_100007063 Ga0068859_1000070632 389
86 3300005841 Ga0068863_100004471 Ga0068863_1000044716 389
87 3300005842 Ga0068858_100000466 Ga0068858_10000046619 389
88 3300005843 Ga0068860_100000002 Ga0068860_100000002588 389
89 3300005844 Ga0068862_100001423 Ga0068862_10000142321 389
90 3300006931 Ga0097620_100007063 Ga0097620_1000070638 389
91 3300009177 Ga0105248_10051997 Ga0105248_100519972 389
92 3300025923 Ga0207681_10011344 Ga0207681_100113442 389
93 3300025925 Ga0207650_10001003 Ga0207650_1000100316 389
94 3300025931 Ga0207644_10000424 Ga0207644_1000042421 389
95 3300025941 Ga0207711_10078615 Ga0207711_100786152 389
96 3300025972 Ga0207668_10000122 Ga0207668_1000012221 389
97 3300025986 Ga0207658_10000002 Ga0207658_10000002871 389
98 3300026035 Ga0207703_10001057 Ga0207703_1000105718 389
99 3300026088 Ga0207641_10000557 Ga0207641_1000055719 389
100 3300026088 Ga0207641_10064387 Ga0207641_100643872 389
101 3300028380 Ga0268265_10000849 Ga0268265_1000084916 389
102 3300028381 Ga0268264_10000001 Ga0268264_100000011196 389
103 3300035089 Ga0373944_0021439 Ga0373944_0021439_182_1387 389
104 3300046476 Ga0495662_0053762 Ga0495662_0053762_238_1443 389
105 3300046533 Ga0495640_0121929 Ga0495640_0121929_410_1675 390
106 3300046543 Ga0495645_0097649 Ga0495645_0097649_430_1695 390
107 3300046678 Ga0495599_0043980 Ga0495599_0043980_836_2101 390
108 3300047322 Ga0495680_0038995 Ga0495680_0038995_368_1633 390
109 iso_pu_bacteria 2977828996 2977834859 390
110 3300005328 Ga0070676_10109368 Ga0070676_101093681 392
111 3300009177 Ga0105248_10126736 Ga0105248_101267362 392
112 3300021388 Ga0213875_10001139 Ga0213875_100011397 392
113 3300025941 Ga0207711_10036889 Ga0207711_100368893 392
114 3300037853 Ga0436364_1518815 Ga0436364_1518815_15353_16621 392
115 3300049669 Ga0501235_008716 Ga0501235_008716_939_2198 392
116 3300031240 Ga0265320_10062514 Ga0265320_100625142 393
117 3300009093 Ga0105240_10004750 Ga0105240_100047506 394
118 3300014969 Ga0157376_10183235 Ga0157376_101832352 394
119 3300035117 Ga0373953_0002266 Ga0373953_0002266_3849_5069 394
120 3300035118 Ga0373954_0008602 Ga0373954_0008602_2894_4114 394
121 3300035119 Ga0373956_0011867 Ga0373956_0011867_1370_2590 394
122 3300035120 Ga0373957_0002105 Ga0373957_0002105_2270_3490 394
123 3300035171 Ga0373946_0016941 Ga0373946_0016941_528_1748 394
124 3300035410 Ga0373924_0013636 Ga0373924_0013636_1279_2499 394
125 3300035692 Ga0373935_0005848 Ga0373935_0005848_5235_6455 394
126 3300035695 Ga0373927_0041734 Ga0373927_0041734_86_1306 394
127 3300035724 Ga0373933_0027463 Ga0373933_0027463_1205_2425 394
128 3300036401 Ga0373937_0000312 Ga0373937_0000312_42944_44164 394
129 3300037068 Ga0373925_0073261 Ga0373925_0073261_599_1819 394
130 3300046477 Ga0495664_0008025 Ga0495664_0008025_3955_5175 394
131 3300046511 Ga0495608_0024937 Ga0495608_0024937_827_2047 394
132 3300046511 Ga0495608_0038798 Ga0495608_0038798_172_1392 394
133 3300046516 Ga0495628_0193241 Ga0495628_0193241_216_1436 394
134 3300046533 Ga0495640_0081850 Ga0495640_0081850_612_1832 394
135 3300046536 Ga0495587_0029876 Ga0495587_0029876_1113_2333 394
136 3300046543 Ga0495645_0002014 Ga0495645_0002014_3667_4887 394
137 3300046559 Ga0495667_0011135 Ga0495667_0011135_1270_2490 394
138 3300046559 Ga0495667_0016988 Ga0495667_0016988_1844_3064 394
139 3300046660 Ga0495625_0040966 Ga0495625_0040966_478_1698 394
140 3300046678 Ga0495599_0005757 Ga0495599_0005757_4935_6155 394
141 3300046680 Ga0495646_0007807 Ga0495646_0007807_1779_2999 394
142 3300047317 Ga0495604_0067379 Ga0495604_0067379_1370_2590 394
143 3300047444 Ga0495675_0083963 Ga0495675_0083963_528_1748 394
144 3300047472 Ga0495686_0036627 Ga0495686_0036627_993_2213 394
145 3300048088 Ga0495602_0000195 Ga0495602_0000195_13715_14935 394
146 3300048088 Ga0495602_0101950 Ga0495602_0101950_1062_2282 394
147 3300049581 Ga0501047_0051297 Ga0501047_0051297_498_1718 394
148 3300049822 Ga0501035_0004343 Ga0501035_0004343_3372_4592 394
149 3300049823 Ga0501044_0028797 Ga0501044_0028797_4184_5404 394
150 3300050489 nmdc:mga03683_15_c1 nmdc:mga03683_15_c1_52079_53299 394
151 3300050490 nmdc:mga03n38_397_c1 nmdc:mga03n38_397_c1_3635_4855 394
152 3300050493 nmdc:mga0k408_21_c1 nmdc:mga0k408_21_c1_88445_89665 394
153 3300050516 nmdc:mga0sz30_2946_c1 nmdc:mga0sz30_2946_c1_2480_3700 394
154 3300053077 Ga0495601_0001883 Ga0495601_0001883_596_1816 394
155 3300053078 Ga0495612_0004884 Ga0495612_0004884_3032_4252 394
156 3300053104 Ga0500556_0000013 Ga0500556_0000013_202856_204076 394
157 3300005331 Ga0070670_100121101 Ga0070670_1001211012 395
158 3300005458 Ga0070681_10015867 Ga0070681_100158673 395
159 3300005530 Ga0070679_100145518 Ga0070679_1001455182 395
160 3300009093 Ga0105240_10002394 Ga0105240_1000239417 395
161 3300025912 Ga0207707_10020749 Ga0207707_100207492 395
162 3300025921 Ga0207652_10039205 Ga0207652_100392052 395
163 3300039437 Ga0436365_1805499 Ga0436365_1805499_377_1600 395
164 3300039438 Ga0436360_0333527 Ga0436360_0333527_1031_2254 395
165 3300044712 Ga0453684_0047993 Ga0453684_0047993_1292_2515 395
166 3300046512 Ga0495610_0000527 Ga0495610_0000527_22147_23370 395
167 3300046522 Ga0495643_0000027 Ga0495643_0000027_173018_174241 395
168 3300049573 Ga0501037_0088794 Ga0501037_0088794_18_1247 395
169 3300053103 Ga0500555_001529 Ga0500555_001529_5659_6882 395
170 3300053125 Ga0500618_003282 Ga0500618_003282_1102_2331 395
171 3300028577 Ga0265318_10004967 Ga0265318_100049672 397
172 3300031241 Ga0265325_10050947 Ga0265325_100509472 397
173 3300031344 Ga0265316_10021301 Ga0265316_100213013 397
174 3300031595 Ga0265313_10013165 Ga0265313_100131652 397
175 3300031711 Ga0265314_10030964 Ga0265314_100309642 397
176 3300049571 Ga0501034_0290354 Ga0501034_0290354_246_1517 398
177 3300049573 Ga0501037_0048548 Ga0501037_0048548_750_2021 398
178 3300049579 Ga0501043_0066668 Ga0501043_0066668_756_2027 398
179 3300049581 Ga0501047_0036759 Ga0501047_0036759_799_2070 398
180 3300005331 Ga0070670_100013630 Ga0070670_1000136303 399
181 3300005844 Ga0068862_100289115 Ga0068862_1002891152 399
182 3300053730 Ga0500645_000575 Ga0500645_000575_18141_19376 399
183 3300005844 Ga0068862_100002964 Ga0068862_1000029642 402
184 3300006051 Ga0075364_10001185 Ga0075364_100011853 402
185 3300025972 Ga0207668_10144258 Ga0207668_101442582 402
186 3300028380 Ga0268265_10002420 Ga0268265_100024209 402
187 3300050491 nmdc:mga00v17_5301_c1 nmdc:mga00v17_5301_c1_2629_3888 402
188 3300009098 Ga0105245_10201675 Ga0105245_102016752 403
189 3300025900 Ga0207710_10110744 Ga0207710_101107441 403
190 iso_pu_bacteria 2894772417 2894776726 403
191 iso_pu_bacteria 2896253425 2896255862 403
192 iso_pu_bacteria 2919709256 2919711475 403
193 iso_pu_bacteria 2738543024 2739308600 404
194 iso_pu_bacteria 8002285264 8002288008 404
195 iso_pu_bacteria 2503198000 2503203511 405
196 iso_pu_bacteria 2509276022 2509397928 405
197 iso_pu_bacteria 2510065059 2510316507 405
198 iso_pu_bacteria 2512875016 2512929599 405
199 iso_pu_bacteria 2513237090 2513608201 405
200 iso_pu_bacteria 2513237305 2514422848 405
201 iso_pu_bacteria 2588253730 2588515171 405
202 iso_pu_bacteria 2597489875 2597815901 405
203 iso_pu_bacteria 2643221550 2643774135 405
204 iso_pu_bacteria 2693429783 2694632515 405
205 iso_pu_bacteria 2693429784 2694639754 405
206 iso_pu_bacteria 2721755686 2723577633 405
207 iso_pu_bacteria 2841734538 2841734959 405
208 iso_pu_bacteria 2847670302 2847672025 405
209 iso_pu_bacteria 2856314179 2856318235 405
210 iso_pu_bacteria 2856320880 2856324203 405
211 iso_pu_bacteria 2856342000 2856345366 405
212 iso_pu_bacteria 2856356410 2856360343 405
213 iso_pu_bacteria 2869162929 2869168114 405
214 iso_pu_bacteria 2869278585 2869281799 405
215 iso_pu_bacteria 2871474448 2871477064 405
216 iso_pu_bacteria 2871488783 2871494135 405
217 iso_pu_bacteria 2871495908 2871498997 405
218 iso_pu_bacteria 2874109183 2874110936 405
219 iso_pu_bacteria 2874123672 2874127766 405
220 iso_pu_bacteria 2874139085 2874140523 405
221 iso_pu_bacteria 2876363079 2876366839 405
222 iso_pu_bacteria 2876369609 2876375293 405
223 iso_pu_bacteria 2876420981 2876427004 405
224 iso_pu_bacteria 2878035449 2878037547 405
225 iso_pu_bacteria 2878738818 2878739469 405
226 iso_pu_bacteria 2878753008 2878756710 405
227 iso_pu_bacteria 2878760144 2878763207 405
228 iso_pu_bacteria 2878767105 2878770185 405
229 iso_pu_bacteria 2878788777 2878796647 405
230 iso_pu_bacteria 2881147464 2881153954 405
231 iso_pu_bacteria 2881155292 2881157660 405
232 iso_pu_bacteria 2881861095 2881862437 405
233 iso_pu_bacteria 2882632389 2882636936 405
234 iso_pu_bacteria 2882912400 2882913514 405
235 iso_pu_bacteria 2885305155 2885311962 405
236 iso_pu_bacteria 2885312484 2885315942 405
237 iso_pu_bacteria 2885318864 2885320942 405
238 iso_pu_bacteria 2885326080 2885331746 405
239 iso_pu_bacteria 2885334103 2885342087 405
240 iso_pu_bacteria 2885342637 2885342702 405
241 iso_pu_bacteria 2885350715 2885352699 405
242 iso_pu_bacteria 2888337043 2888341716 405
243 iso_pu_bacteria 2888343758 2888349008 405
244 iso_pu_bacteria 2889016732 2889021941 405
245 iso_pu_bacteria 2894817345 2894817544 405
246 iso_pu_bacteria 2903448605 2903453693 405
247 iso_pu_bacteria 2903492973 2903502361 405
248 iso_pu_bacteria 2903521522 2903524706 405
249 iso_pu_bacteria 2903528002 2903531051 405
250 iso_pu_bacteria 2903540706 2903543798 405
251 iso_pu_bacteria 2906414383 2906418272 405
252 iso_pu_bacteria 2924718760 2924718998 405
253 iso_pu_bacteria 2924741084 2924741297 405
254 iso_pu_bacteria 2924776078 2924776994 405
255 iso_pu_bacteria 2924784321 2924788299 405
256 iso_pu_bacteria 2937836603 2937838566 405
257 iso_pu_bacteria 2937848649 2937850648 405
258 iso_pu_bacteria 2937877337 2937880299 405
259 iso_pu_bacteria 2937972304 2937976164 405
260 iso_pu_bacteria 2937994558 2937997648 405
261 iso_pu_bacteria 2958034702 2958037760 405
262 iso_pu_bacteria 2958041894 2958047472 405
263 iso_pu_bacteria 2958071322 2958074606 405
264 iso_pu_bacteria 2958084443 2958087435 405
265 iso_pu_bacteria 2958100919 2958104022 405
266 iso_pu_bacteria 2958144490 2958149069 405
267 iso_pu_bacteria 2958165035 2958168122 405
268 iso_pu_bacteria 2958172287 2958175326 405
269 iso_pu_bacteria 2961127735 2961134133 405
270 iso_pu_bacteria 2961163497 2961166587 405
271 iso_pu_bacteria 2961170736 2961173000 405
272 iso_pu_bacteria 2963644680 2963649633 405
273 iso_pu_bacteria 2965018300 2965021410 405
274 iso_pu_bacteria 2965119406 2965121162 405
275 iso_pu_bacteria 2967996073 2967998211 405
276 iso_pu_bacteria 2968003550 2968008863 405
277 iso_pu_bacteria 2968016561 2968019392 405
278 iso_pu_bacteria 2968083720 2968087057 405
279 iso_pu_bacteria 2968171901 2968174992 405
280 iso_pu_bacteria 2970469710 2970472713 405
281 iso_pu_bacteria 2970489779 2970494720 405
282 iso_pu_bacteria 2970503327 2970505594 405
283 iso_pu_bacteria 2970524798 2970529210 405
284 iso_pu_bacteria 2970540015 2970544237 405
285 iso_pu_bacteria 2970554993 2970558051 405
286 iso_pu_bacteria 2970593180 2970596403 405
287 iso_pu_bacteria 2977821940 2977825890 405
288 iso_pu_bacteria 2977864932 2977869120 405
289 iso_pu_bacteria 2977922695 2977927663 405
290 iso_pu_bacteria 2979710463 2979711939 405
291 iso_pu_bacteria 2979808191 2979810315 405
292 iso_pu_bacteria 2987659509 2987662598 405
293 iso_pu_bacteria 2996348954 2996352154 405
294 iso_pu_bacteria 3004188549 3004191649 405
295 iso_pu_bacteria 3004211236 3004213943 405
296 iso_pu_bacteria 3004218560 3004223534 405
297 iso_pu_bacteria 3004275668 3004278852 405
298 iso_pu_bacteria 3004289098 3004289524 405
299 iso_pu_bacteria 3004334049 3004339180 405
300 iso_pu_bacteria 637000159 637079345 405
301 iso_pu_bacteria 8004374579 8004378298 405
302 iso_pu_bacteria 8055617313 8055623277 405
303 3300025304 Ga0209257_1030208 Ga0209257_10302082 406
304 3300028800 Ga0265338_10078184 Ga0265338_100781842 406
305 3300031241 Ga0265325_10042651 Ga0265325_100426512 406
306 3300049571 Ga0501034_0009529 Ga0501034_0009529_3722_4993 406
307 3300049574 Ga0501038_0120726 Ga0501038_0120726_307_1578 406
308 3300049579 Ga0501043_0058059 Ga0501043_0058059_456_1727 406
309 3300049586 Ga0501070_0258523 Ga0501070_0258523_39_1310 406
310 3300049589 Ga0501073_0102625 Ga0501073_0102625_603_1874 406
311 iso_pu_bacteria 2996336353 2996340112 406
312 3300005327 Ga0070658_10091862 Ga0070658_100918621 407
313 3300005335 Ga0070666_10013035 Ga0070666_100130352 407
314 3300005339 Ga0070660_100033819 Ga0070660_1000338192 407
315 3300005356 Ga0070674_100212632 Ga0070674_1002126321 407
316 3300005366 Ga0070659_100027452 Ga0070659_1000274522 407
317 3300005458 Ga0070681_10082256 Ga0070681_100822562 407
318 3300005530 Ga0070679_100073201 Ga0070679_1000732013 407
319 3300005548 Ga0070665_100018129 Ga0070665_1000181295 407
320 3300005937 Ga0081455_10171900 Ga0081455_101719001 407
321 3300006237 Ga0097621_100001534 Ga0097621_1000015343 407
322 3300006237 Ga0097621_100256637 Ga0097621_1002566372 407
323 3300006358 Ga0068871_100000172 Ga0068871_10000017231 407
324 3300006358 Ga0068871_100011199 Ga0068871_1000111993 407
325 3300006358 Ga0068871_100153053 Ga0068871_1001530532 407
326 3300009176 Ga0105242_10137994 Ga0105242_101379942 407
327 3300017792 Ga0163161_10076413 Ga0163161_100764132 407
328 3300025903 Ga0207680_10009243 Ga0207680_100092433 407
329 3300025912 Ga0207707_10064752 Ga0207707_100647522 407
330 3300025913 Ga0207695_10011987 Ga0207695_100119874 407
331 3300025913 Ga0207695_10264431 Ga0207695_102644311 407
332 3300025919 Ga0207657_10013301 Ga0207657_100133013 407
333 3300025919 Ga0207657_10119785 Ga0207657_101197852 407
334 3300025932 Ga0207690_10017629 Ga0207690_100176292 407
335 3300025937 Ga0207669_10162377 Ga0207669_101623772 407
336 3300025961 Ga0207712_10028976 Ga0207712_100289763 407
337 3300028800 Ga0265338_10006711 Ga0265338_100067113 407
338 3300031251 Ga0265327_10007946 Ga0265327_100079464 407
339 3300031711 Ga0265314_10028015 Ga0265314_100280153 407
340 3300037853 Ga0436364_0252111 Ga0436364_0252111_4086_5354 407
341 3300046557 Ga0495622_0000566 Ga0495622_0000566_2027_3286 407
342 3300047470 Ga0495681_0000102 Ga0495681_0000102_46452_47711 407
343 3300047472 Ga0495686_0018453 Ga0495686_0018453_2398_3657 407
344 3300048921 Ga0496118_0097394 Ga0496118_0097394_436_1695 407
345 3300048925 Ga0496122_0006557 Ga0496122_0006557_3746_5005 407
346 3300048926 Ga0496123_0035943 Ga0496123_0035943_1003_2262 407
347 3300048928 Ga0496125_0022459 Ga0496125_0022459_564_1823 407
348 3300049571 Ga0501034_0078510 Ga0501034_0078510_451_1710 407
349 3300049579 Ga0501043_0121263 Ga0501043_0121263_271_1530 407
350 3300049581 Ga0501047_0080081 Ga0501047_0080081_1269_2528 407
351 3300049586 Ga0501070_0124535 Ga0501070_0124535_464_1723 407
352 3300049744 Ga0501083_0048139 Ga0501083_0048139_1430_2704 407
353 3300053087 Ga0500643_000008 Ga0500643_000008_10497_11756 407
354 3300053119 Ga0500595_000892 Ga0500595_000892_4533_5792 407
355 3300054114 Ga0501084_0036850 Ga0501084_0036850_283_1557 407
356 3300002459 JGI24751J29686_10000002 JGI24751J29686_10000002112 408
357 3300003203 JGI25406J46586_10014481 JGI25406J46586_100144811 408
358 3300005295 Ga0065707_10082484 Ga0065707_100824845 408
359 3300005331 Ga0070670_100000012 Ga0070670_10000001288 408
360 3300005353 Ga0070669_100000041 Ga0070669_10000004120 408
361 3300005353 Ga0070669_100001204 Ga0070669_1000012045 408
362 3300005355 Ga0070671_100000289 Ga0070671_10000028922 408
363 3300005367 Ga0070667_100014025 Ga0070667_1000140253 408
364 3300005435 Ga0070714_100215557 Ga0070714_1002155572 408
365 3300005436 Ga0070713_100013956 Ga0070713_1000139564 408
366 3300005436 Ga0070713_100052881 Ga0070713_1000528813 408
367 3300005436 Ga0070713_100065338 Ga0070713_1000653383 408
368 3300005439 Ga0070711_100032567 Ga0070711_1000325672 408
369 3300005548 Ga0070665_100080766 Ga0070665_1000807662 408
370 3300005563 Ga0068855_100002478 Ga0068855_1000024783 408
371 3300005617 Ga0068859_100009326 Ga0068859_1000093264 408
372 3300005617 Ga0068859_100056730 Ga0068859_1000567303 408
373 3300005618 Ga0068864_100000010 Ga0068864_100000010184 408
374 3300005842 Ga0068858_100058649 Ga0068858_1000586492 408
375 3300005843 Ga0068860_100142467 Ga0068860_1001424672 408
376 3300005844 Ga0068862_100000016 Ga0068862_10000001678 408
377 3300005937 Ga0081455_10104551 Ga0081455_101045512 408
378 3300005985 Ga0081539_10003049 Ga0081539_1000304912 408
379 3300006028 Ga0070717_10038744 Ga0070717_100387442 408
380 3300006048 Ga0075363_100000506 Ga0075363_1000005062 408
381 3300006177 Ga0075362_10000008 Ga0075362_1000000850 408
382 3300006186 Ga0075369_10003005 Ga0075369_100030053 408
383 3300006195 Ga0075366_10000332 Ga0075366_1000033220 408
384 3300006353 Ga0075370_10000040 Ga0075370_1000004019 408
385 3300006931 Ga0097620_100009325 Ga0097620_1000093254 408
386 3300006931 Ga0097620_100056731 Ga0097620_1000567313 408
387 3300009177 Ga0105248_10000053 Ga0105248_1000005330 408
388 3300014325 Ga0163163_10082470 Ga0163163_100824702 408
389 3300014326 Ga0157380_10000134 Ga0157380_100001343 408
390 3300014497 Ga0182008_10007111 Ga0182008_100071113 408
391 3300025898 Ga0207692_10010580 Ga0207692_100105802 408
392 3300025915 Ga0207693_10004153 Ga0207693_100041537 408
393 3300025916 Ga0207663_10024609 Ga0207663_100246093 408
394 3300025923 Ga0207681_10000013 Ga0207681_10000013170 408
395 3300025923 Ga0207681_10001625 Ga0207681_100016255 408
396 3300025925 Ga0207650_10000008 Ga0207650_10000008251 408
397 3300025928 Ga0207700_10048387 Ga0207700_100483873 408
398 3300025931 Ga0207644_10000011 Ga0207644_1000001176 408
399 3300025941 Ga0207711_10006215 Ga0207711_100062152 408
400 3300025941 Ga0207711_10176114 Ga0207711_101761142 408
401 3300025949 Ga0207667_10004694 Ga0207667_100046943 408
402 3300025949 Ga0207667_10415198 Ga0207667_104151981 408
403 3300025986 Ga0207658_10008204 Ga0207658_100082044 408
404 3300026035 Ga0207703_10009799 Ga0207703_100097994 408
405 3300026095 Ga0207676_10000012 Ga0207676_10000012146 408
406 3300026118 Ga0207675_100022318 Ga0207675_1000223182 408
407 3300028380 Ga0268265_10000006 Ga0268265_10000006278 408
408 3300028381 Ga0268264_10074689 Ga0268264_100746893 408
409 3300031239 Ga0265328_10003792 Ga0265328_100037923 408
410 3300035111 Ga0373923_0028874 Ga0373923_0028874_760_2022 408
411 3300035117 Ga0373953_0039785 Ga0373953_0039785_118_1380 408
412 3300035691 Ga0373931_0034403 Ga0373931_0034403_996_2258 408
413 3300035692 Ga0373935_0023300 Ga0373935_0023300_1397_2659 408
414 3300035695 Ga0373927_0028829 Ga0373927_0028829_1320_2582 408
415 3300035725 Ga0373947_0046720 Ga0373947_0046720_437_1699 408
416 3300036401 Ga0373937_0056432 Ga0373937_0056432_906_2168 408
417 3300037068 Ga0373925_0065346 Ga0373925_0065346_1251_2513 408
418 3300037466 Ga0395898_0022622 Ga0395898_0022622_45_1316 408
419 3300038443 Ga0395901_0050057 Ga0395901_0050057_465_1736 408
420 3300046459 Ga0495629_0052423 Ga0495629_0052423_1577_2839 408
421 3300048903 Ga0496100_0008367 Ga0496100_0008367_53_1315 408
422 3300048904 Ga0496101_0008317 Ga0496101_0008317_3654_4916 408
423 3300048907 Ga0496104_0032561 Ga0496104_0032561_65_1327 408
424 3300048909 Ga0496106_0007764 Ga0496106_0007764_5852_7114 408
425 3300048910 Ga0496107_0000473 Ga0496107_0000473_17611_18873 408
426 3300048912 Ga0496109_0149249 Ga0496109_0149249_147_1409 408
427 3300048913 Ga0496110_0057720 Ga0496110_0057720_2104_3366 408
428 3300048916 Ga0496113_0000241 Ga0496113_0000241_5536_6798 408
429 3300049568 Ga0501031_0000104 Ga0501031_0000104_2666_3928 408
430 3300049569 Ga0501032_0000008 Ga0501032_0000008_51629_52891 408
431 3300049570 Ga0501033_0000012 Ga0501033_0000012_188733_189995 408
432 3300049570 Ga0501033_0054691 Ga0501033_0054691_159_1430 408
433 3300049571 Ga0501034_0000035 Ga0501034_0000035_188733_189995 408
434 3300049571 Ga0501034_0077302 Ga0501034_0077302_1065_2336 408
435 3300049572 Ga0501036_0000006 Ga0501036_0000006_188733_189995 408
436 3300049573 Ga0501037_0000072 Ga0501037_0000072_51629_52891 408
437 3300049574 Ga0501038_0000007 Ga0501038_0000007_51629_52891 408
438 3300049575 Ga0501039_0000012 Ga0501039_0000012_188733_189995 408
439 3300049579 Ga0501043_0000211 Ga0501043_0000211_51629_52891 408
440 3300049580 Ga0501046_0023978 Ga0501046_0023978_912_2183 408
441 3300049581 Ga0501047_0007361 Ga0501047_0007361_6347_7618 408
442 3300049581 Ga0501047_0013458 Ga0501047_0013458_3197_4459 408
443 3300049589 Ga0501073_0096703 Ga0501073_0096703_73_1344 408
444 3300049679 Ga0501249_000044 Ga0501249_000044_20866_22128 408
445 3300049742 Ga0501080_0164202 Ga0501080_0164202_96_1367 408
446 3300049822 Ga0501035_0000035 Ga0501035_0000035_114026_115288 408
447 3300049823 Ga0501044_0000015 Ga0501044_0000015_51629_52891 408
448 3300049823 Ga0501044_0047829 Ga0501044_0047829_1898_3169 408
449 3300050496 nmdc:mga07m45_14_c1 nmdc:mga07m45_14_c1_19762_21024 408
450 3300053139 Ga0500568_0000125 Ga0500568_0000125_24969_26231 408
451 3300053177 Ga0500636_0007674 Ga0500636_0007674_3635_4903 408
452 3300001989 JGI24739J22299_10018324 JGI24739J22299_100183242 409
453 3300002705 JGI25156J39149_1001723 JGI25156J39149_10017235 409
454 3300002741 JGI25157J39369_1001529 JGI25157J39369_10015295 409
455 3300003203 JGI25406J46586_10000403 JGI25406J46586_100004038 409
456 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016125 409
457 3300003762 Ga0055542_1001310 Ga0055542_10013109 409
458 3300005327 Ga0070658_10051154 Ga0070658_100511542 409
459 3300005530 Ga0070679_100033626 Ga0070679_1000336263 409
460 3300005548 Ga0070665_100195818 Ga0070665_1001958182 409
461 3300005614 Ga0068856_100123655 Ga0068856_1001236552 409
462 3300009553 Ga0105249_10068243 Ga0105249_100682433 409
463 3300025250 Ga0209026_1000005 Ga0209026_1000005231 409
464 3300025254 Ga0209148_1000056 Ga0209148_100005626 409
465 3300025256 Ga0209759_1000106 Ga0209759_1000106114 409
466 3300025261 Ga0209233_1000068 Ga0209233_1000068126 409
467 3300025272 Ga0209455_1000285 Ga0209455_100028527 409
468 3300025904 Ga0207647_10030768 Ga0207647_100307682 409
469 3300025909 Ga0207705_10049952 Ga0207705_100499522 409
470 3300025919 Ga0207657_10046657 Ga0207657_100466572 409
471 3300025927 Ga0207687_10226183 Ga0207687_102261831 409
472 3300026067 Ga0207678_10115181 Ga0207678_101151812 409
473 3300031824 Ga0307413_10090061 Ga0307413_100900612 409
474 3300031852 Ga0307410_10044209 Ga0307410_100442092 409
475 3300031903 Ga0307407_10006887 Ga0307407_100068872 409
476 3300044658 Ga0466972_0013486 Ga0466972_0013486_1244_2509 409
477 3300046520 Ga0495637_0037246 Ga0495637_0037246_33_1298 409
478 3300046522 Ga0495643_0025873 Ga0495643_0025873_1086_2351 409
479 3300048915 Ga0496112_0007768 Ga0496112_0007768_5186_6451 409
480 3300049568 Ga0501031_0011297 Ga0501031_0011297_3259_4524 409
481 3300049569 Ga0501032_0052913 Ga0501032_0052913_579_1844 409
482 3300049571 Ga0501034_0064066 Ga0501034_0064066_2059_3324 409
483 3300049572 Ga0501036_0004724 Ga0501036_0004724_2042_3307 409
484 3300049573 Ga0501037_0035932 Ga0501037_0035932_1777_3042 409
485 3300049574 Ga0501038_0012015 Ga0501038_0012015_3597_4862 409
486 3300049574 Ga0501038_0090139 Ga0501038_0090139_356_1627 409
487 3300049575 Ga0501039_0004953 Ga0501039_0004953_7681_8946 409
488 3300049578 Ga0501042_0006052 Ga0501042_0006052_39_1304 409
489 3300049580 Ga0501046_0079145 Ga0501046_0079145_578_1843 409
490 3300049581 Ga0501047_0053241 Ga0501047_0053241_1001_2266 409
491 3300049582 Ga0501048_0033951 Ga0501048_0033951_1907_3172 409
492 3300049585 Ga0501069_0002147 Ga0501069_0002147_1948_3213 409
493 3300049586 Ga0501070_0008858 Ga0501070_0008858_892_2157 409
494 3300049589 Ga0501073_0046151 Ga0501073_0046151_451_1716 409
495 3300049590 Ga0501074_0031381 Ga0501074_0031381_1777_3042 409
496 3300049741 Ga0501079_0017654 Ga0501079_0017654_1999_3264 409
497 3300049742 Ga0501080_0004939 Ga0501080_0004939_9878_11143 409
498 3300049744 Ga0501083_0004503 Ga0501083_0004503_1158_2423 409
499 3300049822 Ga0501035_0074121 Ga0501035_0074121_1158_2423 409
500 3300049823 Ga0501044_0039951 Ga0501044_0039951_2919_4184 409
501 3300050492 nmdc:mga0yw44_97741_c1 nmdc:mga0yw44_97741_c1_256_1521 409
502 3300050493 nmdc:mga0k408_68201_c1 nmdc:mga0k408_68201_c1_751_2016 409
503 3300050494 nmdc:mga06z11_39133_c1 nmdc:mga06z11_39133_c1_648_1916 409
504 3300053087 Ga0500643_002856 Ga0500643_002856_2215_3486 409
505 3300053091 Ga0500647_0012561 Ga0500647_0012561_1342_2607 409
506 3300053093 Ga0500651_0034421 Ga0500651_0034421_1471_2736 409
507 3300053125 Ga0500618_006442 Ga0500618_006442_1290_2555 409
508 3300053130 Ga0500642_0008136 Ga0500642_0008136_1954_3219 409
509 3300053133 Ga0500655_000081 Ga0500655_000081_2598_3863 409
510 3300053148 Ga0500590_000198 Ga0500590_000198_7258_8523 409
511 3300053724 Ga0500570_000014 Ga0500570_000014_7802_9067 409
512 3300054114 Ga0501084_0001034 Ga0501084_0001034_7172_8437 409
513 3300060353 Ga0501082_0002250 Ga0501082_0002250_14361_15626 409
514 iso_pu_bacteria 2643221605 2644037275 409
515 3300006846 Ga0075430_100015722 Ga0075430_1000157223 410
516 3300013297 Ga0157378_10035796 Ga0157378_100357963 410
517 3300026116 Ga0207674_10074948 Ga0207674_100749482 410
518 3300046460 Ga0495638_0062922 Ga0495638_0062922_679_1974 410
519 3300049758 Ga0501241_003814 Ga0501241_003814_1190_2509 410
520 3300053177 Ga0500636_0001280 Ga0500636_0001280_2197_3474 410
521 iso_pu_bacteria 2582581305 2585263602 410
522 3300001979 JGI24740J21852_10037570 JGI24740J21852_100375701 411
523 3300005356 Ga0070674_100202117 Ga0070674_1002021171 411
524 3300005841 Ga0068863_100015027 Ga0068863_1000150272 411
525 3300005843 Ga0068860_100000073 Ga0068860_10000007372 411
526 3300006844 Ga0075428_100140703 Ga0075428_1001407032 411
527 3300025937 Ga0207669_10130897 Ga0207669_101308971 411
528 3300025981 Ga0207640_10004035 Ga0207640_100040353 411
529 3300025986 Ga0207658_10000025 Ga0207658_1000002588 411
530 3300026088 Ga0207641_10007125 Ga0207641_100071254 411
531 3300028381 Ga0268264_10000120 Ga0268264_1000012087 411
532 3300031249 Ga0265339_10023123 Ga0265339_100231232 411
533 3300031731 Ga0307405_10076885 Ga0307405_100768852 411
534 3300031911 Ga0307412_10001365 Ga0307412_100013658 411
535 iso_pu_bacteria 2643221606 2644041185 411
536 iso_pu_bacteria 2643221671 2644394724 411

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

83

355

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8v-assembly1.cif.gz_A crystal structure of putative acetyltransferase (yp_390128.1) from desulfovibrio desulfuricans g20 at 2.28 a resolution 0.9183 324 379
8gpp-assembly1.cif.gz_C acinetobacter baumannii carbonic anhydrase paay 0.9107 328 379
4mzu-assembly1.cif.gz_B crystal structure of fdtd, a bifunctional ketoisomerase/n-acetyltransferase from shewanella denitrificans 0.8493 323 379
5xhw-assembly1.cif.gz_A crystal structure of hddc from yersinia pseudotuberculosis 0.8441 16 286
5xhw-assembly1.cif.gz_A crystal structure of hddc from yersinia pseudotuberculosis 0.834 16 286
ID Description Score Start End Superfamily
af_Q2G1K1_7_207_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9809 339 380 2.160.10.10
af_P80361_292_404_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9487 325 383 2.160.10.10
af_P9WN43_3_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9456 16 296 3.90.550.10
5l6sO01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.941 12 296 3.90.550.10
af_Q8H1Q7_218_329_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9374 327 383 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A383CJV2-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9828 143 242 GO:0005978
GO:0008878
AF-A0A4R9WVG3-F1-model_v4 Glucose-1-phosphate adenylyltransferase 0.9697 110 220 GO:0005524
GO:0005978
GO:0008878
AF-A0A383CJV2-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9638 143 242 GO:0005978
GO:0008878
AF-A0A2X4VZ65-F1-model_v4 Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27) 0.9616 148 302 GO:0005524
GO:0005978
GO:0008878
AF-A0A1G0DA34-F1-model_v4 deleted 0.9607 13 304

Feature Viewer

pLDDT pTM Quality
83.8 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map