F460685

General Info

Members Datasets Scaffolds Average Seq Length
535 360 497 270

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1314594|Ga0436364_1314594_216_1106
Length 296
Sequence LGCYLPRDIDSDKPLGEARQSGPGVLMLEIDSLSRNFGGRAAVAGVSLQIEKGSFVGIIGRSGAGKSTLLRLINRLLEPSAGRVVFDGADVTALRGRALRQWRARAAMVFQQFNLIGRLDVLTNVLIGRLAMVPAWRSLLRYWPDRDQAIALAALEQFDMAELAAQRADHLSGGQQQRVAIARALVQEPLLILADEPTASLDPHNTRVVMEALRRINRHFGITVICNLHSLDVARAYCDRLVGMAAGKIVFDDATAMLTDDAARALYGVASAGGDAMAASSADAPLPAHALGQPAA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
6 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
7 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
8 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
9 2751185800 Brucella pituitosa AA2 Isolate Unclassified
10 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
11 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
12 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
13 2854911287 Brucella lupini LUP21 Isolate Unclassified
14 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
15 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
16 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
17 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
18 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
19 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
20 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
21 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
22 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
23 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
24 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
25 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
28 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
34 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
35 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
120 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
198 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
202 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
210 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
323 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
326 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
327 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
328 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
329 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
330 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
331 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
332 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
333 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
334 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
335 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
336 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
337 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
340 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
341 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
342 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
343 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
344 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
345 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
346 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
347 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 641522639 Methylobacterium sp. 4-46 Isolate Nodule
350 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
351 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
352 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
353 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
354 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
355 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
356 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
357 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
358 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
359 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
360 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.07
Metatranscriptomes 0
Isolates 6.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.14
Nodule 4.49
Rhizoplane 4.86
Rhizosphere 62.24
Stem 0
Stem Tuber 0
Unclassified 13.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10015033 3300002244 Bacteria 1301
2 JGI25158J39367_1000165 3300002739 Bacteria 15739
3 JGI25152J39213_1001185 3300002773 Bacteria 12013
4 JGI25159J45721_1000586 3300002987 Bacteria 16363
5 JGI25159J45721_1009163 3300002987 Bacteria 2637
6 JGI25151J46595_10002045 3300003187 Bacteria 12604
7 JGI25406J46586_10010195 3300003203 Bacteria 4178
8 JGI25153J46596_10001784 3300003215 Bacteria 12763
9 JGI25160J50197_1003605 3300003354 Bacteria 6874
10 JGI25160J50197_1003824 3300003354 Bacteria 6614
11 JGI25160J50197_1019666 3300003354 Bacteria 2063
12 JGI25161J50226_1000093 3300003374 Bacteria 72639
13 JGI25404J52841_10007911 3300003659 Bacteria 2255
14 Ga0055526_1013476 3300003771 Bacteria 3454
15 Ga0055528_1008093 3300003790 Bacteria 4557
16 Ga0055540_1008429 3300003792 Bacteria 3715
17 Ga0055543_1000264 3300004625 Bacteria 39219
18 Ga0070658_10323661 3300005327 Bacteria 1317
19 Ga0070676_10149543 3300005328 Bacteria 1494
20 Ga0070690_100194040 3300005330 Bacteria 1409
21 Ga0068869_100285194 3300005334 Bacteria 1329
22 Ga0070666_10174630 3300005335 Bacteria 1506
23 Ga0070682_100118079 3300005337 Bacteria 1777
24 Ga0070689_100231001 3300005340 Bacteria 1521
25 Ga0070661_100260977 3300005344 Bacteria 1339
26 Ga0070668_100017995 3300005347 Bacteria 5301
27 Ga0070668_100126848 3300005347 Bacteria 2044
28 Ga0070668_100271518 3300005347 Bacteria 1413
29 Ga0070669_100072150 3300005353 Bacteria 2556
30 Ga0070674_100122867 3300005356 Bacteria 1924
31 Ga0070688_100309718 3300005365 Bacteria 1144
32 Ga0070688_100464405 3300005365 Bacteria 949
33 Ga0070705_100132224 3300005440 Bacteria 1629
34 Ga0070663_100056679 3300005455 Bacteria 2808
35 Ga0070663_100100032 3300005455 Bacteria 2162
36 Ga0070663_100109666 3300005455 Bacteria 2072
37 Ga0070663_100438994 3300005455 Bacteria 1074
38 Ga0070678_100283632 3300005456 Bacteria 1402
39 Ga0070662_100079000 3300005457 Bacteria 2445
40 Ga0070681_10061529 3300005458 Bacteria 3728
41 Ga0068867_100033985 3300005459 Bacteria 3695
42 Ga0068867_100677509 3300005459 Bacteria 908
43 Ga0070706_100028002 3300005467 Bacteria 5184
44 Ga0070706_100038662 3300005467 Bacteria 4404
45 Ga0070707_100016013 3300005468 Bacteria 7034
46 Ga0070698_100012359 3300005471 Bacteria 9039
47 Ga0070697_100073676 3300005536 Bacteria 2804
48 Ga0070697_100074879 3300005536 Bacteria 2782
49 Ga0068853_100162257 3300005539 Bacteria 2018
50 Ga0068853_100165547 3300005539 Bacteria 1998
51 Ga0068853_100166991 3300005539 Bacteria 1989
52 Ga0070672_100127233 3300005543 Bacteria 2091
53 Ga0070693_100065055 3300005547 Bacteria 2130
54 Ga0070665_100051780 3300005548 Bacteria 4117
55 Ga0070665_100063825 3300005548 Bacteria 3693
56 Ga0070665_100133587 3300005548 Bacteria 2483
57 Ga0070704_100171373 3300005549 Bacteria 1727
58 Ga0070664_100361163 3300005564 Bacteria 1323
59 Ga0068857_100158668 3300005577 Bacteria 2052
60 Ga0068857_100187409 3300005577 Bacteria 1884
61 Ga0068854_100284014 3300005578 Bacteria 1334
62 Ga0068856_100419193 3300005614 Bacteria 1359
63 Ga0068856_100573463 3300005614 Bacteria 1150
64 Ga0070702_100047676 3300005615 Bacteria 2435
65 Ga0068852_100475475 3300005616 Bacteria 1241
66 Ga0068852_100634717 3300005616 Bacteria 1075
67 Ga0068859_100066364 3300005617 Bacteria 3643
68 Ga0068861_100102623 3300005719 Bacteria 2277
69 Ga0068863_100229587 3300005841 Bacteria 1790
70 Ga0068863_100380806 3300005841 Bacteria 1377
71 Ga0068858_100110545 3300005842 Bacteria 2566
72 Ga0068858_100322788 3300005842 Bacteria 1476
73 Ga0068858_100332219 3300005842 Bacteria 1454
74 Ga0068860_100000401 3300005843 Bacteria 56564
75 Ga0068860_100634458 3300005843 Bacteria 1075
76 Ga0068862_100150043 3300005844 Bacteria 2074
77 Ga0068862_100187768 3300005844 Bacteria 1858
78 Ga0068862_100242781 3300005844 Bacteria 1638
79 Ga0068862_100468429 3300005844 Bacteria 1190
80 Ga0081455_10000015 3300005937 Bacteria 189655
81 Ga0081455_10005028 3300005937 Bacteria 14622
82 Ga0081455_10047487 3300005937 Bacteria 3718
83 Ga0081540_1005314 3300005983 Bacteria 9633
84 Ga0081540_1007564 3300005983 Bacteria 7723
85 Ga0081540_1009052 3300005983 Bacteria 6881
86 Ga0081540_1024041 3300005983 Bacteria 3545
87 Ga0081539_10010306 3300005985 Bacteria 7619
88 Ga0081539_10041328 3300005985 Bacteria 2696
89 Ga0081539_10155618 3300005985 Bacteria 1095
90 Ga0070717_10002386 3300006028 Bacteria 13244
91 Ga0075368_10054001 3300006042 Bacteria 1600
92 Ga0075363_100017233 3300006048 Bacteria 3579
93 Ga0075364_10062739 3300006051 Bacteria 2439
94 Ga0070716_100192733 3300006173 Bacteria 1348
95 Ga0070712_100246052 3300006175 Bacteria 1426
96 Ga0075362_10079173 3300006177 Bacteria 1512
97 Ga0075362_10172308 3300006177 Bacteria 1046
98 Ga0097621_100077484 3300006237 Bacteria 2759
99 Ga0075428_100049121 3300006844 Bacteria 4629
100 Ga0075431_100000872 3300006847 Bacteria 26496
101 Ga0075433_10661072 3300006852 Bacteria 916
102 Ga0075434_100144235 3300006871 Bacteria 2401
103 Ga0068865_100099651 3300006881 Bacteria 2125
104 Ga0097620_100066366 3300006931 Bacteria 3643
105 Ga0099822_1002166 3300006943 Bacteria 24178
106 Ga0075435_100236269 3300007076 Bacteria 1553
107 Ga0075435_100413901 3300007076 Bacteria 1160
108 Ga0099795_10008327 3300007788 Bacteria 2951
109 Ga0105245_10025354 3300009098 Bacteria 5215
110 Ga0105245_10035550 3300009098 Bacteria 4422
111 Ga0105247_10011726 3300009101 Bacteria 5272
112 Ga0105247_10070919 3300009101 Bacteria 2178
113 Ga0105247_10200515 3300009101 Bacteria 1340
114 Ga0114129_10641816 3300009147 Bacteria 1371
115 Ga0114129_11192931 3300009147 Bacteria 948
116 Ga0105243_10130213 3300009148 Bacteria 2133
117 Ga0105242_10016328 3300009176 Bacteria 5773
118 Ga0105248_10154200 3300009177 Bacteria 2592
119 Ga0105248_10566555 3300009177 Bacteria 1281
120 Ga0105237_10305385 3300009545 Bacteria 1594
121 Ga0105238_10061312 3300009551 Bacteria 3764
122 Ga0105249_10032515 3300009553 Bacteria 4720
123 Ga0105249_10102923 3300009553 Bacteria 2688
124 Ga0105239_10024361 3300010375 Bacteria 6667
125 Ga0105239_10068632 3300010375 Bacteria 3896
126 Ga0105239_10117205 3300010375 Bacteria 2956
127 Ga0105239_10199233 3300010375 Bacteria 2243
128 Ga0157374_10058664 3300013296 Bacteria 3597
129 Ga0157378_10057089 3300013297 Bacteria 3479
130 Ga0157378_10119272 3300013297 Bacteria 2429
131 Ga0157375_10404657 3300013308 Bacteria 1531
132 Ga0157380_10268303 3300014326 Bacteria 1554
133 Ga0157380_10285106 3300014326 Bacteria 1513
134 Ga0157380_10556111 3300014326 Bacteria 1126
135 Ga0157377_10044003 3300014745 Bacteria 2488
136 Ga0157379_10166547 3300014968 Bacteria 1989
137 Ga0163161_10229903 3300017792 Bacteria 1439
138 Ga0213872_10126196 3300021361 Bacteria 1129
139 Ga0213876_10018976 3300021384 Bacteria 3633
140 Ga0213875_10000003 3300021388 Bacteria 719367
141 Ga0213875_10002033 3300021388 Bacteria 12447
142 Ga0213871_10004267 3300021441 Bacteria 2846
143 Ga0213871_10019297 3300021441 Bacteria 1677
144 Ga0209436_100007 3300025208 Bacteria 149841
145 Ga0209673_1005611 3300025273 Bacteria 6269
146 Ga0209130_1000001 3300025284 Bacteria 831557
147 Ga0209130_1000934 3300025284 Bacteria 23359
148 Ga0209130_1000945 3300025284 Bacteria 23096
149 Ga0209025_1000215 3300025294 Bacteria 138335
150 Ga0209564_1002242 3300025295 Bacteria 15926
151 Ga0209758_1009318 3300025297 Bacteria 6130
152 Ga0209758_1037139 3300025297 Bacteria 1887
153 Ga0209256_1005394 3300025299 Bacteria 7394
154 Ga0207426_1000045 3300025302 Bacteria 422847
155 Ga0207426_1000301 3300025302 Bacteria 96798
156 Ga0207426_1000860 3300025302 Bacteria 31819
157 Ga0209257_1027994 3300025304 Bacteria 1863
158 Ga0207692_10148134 3300025898 Bacteria 1342
159 Ga0207710_10080122 3300025900 Bacteria 1514
160 Ga0207688_10012610 3300025901 Bacteria 4600
161 Ga0207645_10097021 3300025907 Bacteria 1899
162 Ga0207645_10212424 3300025907 Bacteria 1275
163 Ga0207643_10150968 3300025908 Bacteria 1393
164 Ga0207705_10064077 3300025909 Bacteria 2656
165 Ga0207684_10292205 3300025910 Bacteria 1405
166 Ga0207660_10040819 3300025917 Bacteria 3250
167 Ga0207657_10332870 3300025919 Bacteria 1199
168 Ga0207649_10056615 3300025920 Bacteria 2449
169 Ga0207649_10146756 3300025920 Bacteria 1620
170 Ga0207681_10048649 3300025923 Bacteria 2863
171 Ga0207694_10171026 3300025924 Bacteria 1759
172 Ga0207694_10371886 3300025924 Bacteria 1185
173 Ga0207687_10020485 3300025927 Bacteria 4387
174 Ga0207687_10034456 3300025927 Bacteria 3438
175 Ga0207690_10355491 3300025932 Bacteria 1159
176 Ga0207706_10035606 3300025933 Bacteria 4425
177 Ga0207706_10060267 3300025933 Bacteria 3342
178 Ga0207669_10098501 3300025937 Bacteria 1925
179 Ga0207704_10063069 3300025938 Bacteria 2308
180 Ga0207691_10040143 3300025940 Bacteria 4326
181 Ga0207691_10170618 3300025940 Bacteria 1905
182 Ga0207689_10215185 3300025942 Bacteria 1588
183 Ga0207661_10110085 3300025944 Bacteria 2328
184 Ga0207679_10164737 3300025945 Bacteria 1819
185 Ga0207712_10147002 3300025961 Bacteria 1816
186 Ga0207668_10053351 3300025972 Bacteria 2801
187 Ga0207668_10130154 3300025972 Bacteria 1920
188 Ga0207668_10147809 3300025972 Bacteria 1815
189 Ga0207668_10284458 3300025972 Bacteria 1357
190 Ga0207703_10068200 3300026035 Bacteria 2930
191 Ga0207703_10520984 3300026035 Bacteria 1118
192 Ga0207703_10706878 3300026035 Bacteria 959
193 Ga0207639_10499052 3300026041 Bacteria 1112
194 Ga0207639_10651902 3300026041 Bacteria 974
195 Ga0207678_10044910 3300026067 Bacteria 3821
196 Ga0207678_10047174 3300026067 Bacteria 3726
197 Ga0207678_10070966 3300026067 Bacteria 2986
198 Ga0207678_10159021 3300026067 Bacteria 1929
199 Ga0207678_10167246 3300026067 Bacteria 1878
200 Ga0207678_10234713 3300026067 Bacteria 1570
201 Ga0207708_10021294 3300026075 Bacteria 4889
202 Ga0207702_10289974 3300026078 Bacteria 1550
203 Ga0207702_10426509 3300026078 Bacteria 1283
204 Ga0207648_10007491 3300026089 Bacteria 10723
205 Ga0207674_10225745 3300026116 Bacteria 1821
206 Ga0207675_100011623 3300026118 Bacteria 8231
207 Ga0207683_10023490 3300026121 Bacteria 5305
208 Ga0209179_1008463 3300027512 Bacteria 1735
209 Ga0268266_10035685 3300028379 Bacteria 4229
210 Ga0268266_10290839 3300028379 Bacteria 1521
211 Ga0268265_10076736 3300028380 Bacteria 2622
212 Ga0268265_10092348 3300028380 Bacteria 2422
213 Ga0268265_10112759 3300028380 Bacteria 2223
214 Ga0268265_10533373 3300028380 Bacteria 1111
215 Ga0268264_10000020 3300028381 Bacteria 483593
216 Ga0307517_10000139 3300028786 Bacteria 111985
217 Ga0307515_10154721 3300028794 Bacteria 2374
218 Ga0307515_10236335 3300028794 Bacteria 1608
219 Ga0265338_10007116 3300028800 Bacteria 14011
220 Ga0265330_10003776 3300031235 Bacteria 7817
221 Ga0265332_10020782 3300031238 Bacteria 2900
222 Ga0265328_10018918 3300031239 Bacteria 2650
223 Ga0265325_10002588 3300031241 Bacteria 12133
224 Ga0265340_10036339 3300031247 Bacteria 2442
225 Ga0265339_10006110 3300031249 Bacteria 7947
226 Ga0265331_10004867 3300031250 Bacteria 8268
227 Ga0307513_10337460 3300031456 Bacteria 1259
228 Ga0307509_10038026 3300031507 Bacteria 5254
229 Ga0307509_10090209 3300031507 Bacteria 3141
230 Ga0265313_10021170 3300031595 Bacteria 3563
231 Ga0307508_10042362 3300031616 Bacteria 4084
232 Ga0307508_10128427 3300031616 Bacteria 2138
233 Ga0265342_10019343 3300031712 Bacteria 4391
234 Ga0265342_10145457 3300031712 Bacteria 1320
235 Ga0307516_10143629 3300031730 Bacteria 2153
236 Ga0307413_10165434 3300031824 Bacteria 1559
237 Ga0307507_10018492 3300033179 Bacteria 7918
238 Ga0307510_10008205 3300033180 Bacteria 12438
239 Ga0307510_10108156 3300033180 Bacteria 2536
240 Ga0373926_0048273 3300035083 Bacteria 1531
241 Ga0373923_0012720 3300035111 Bacteria 3120
242 Ga0373953_0002925 3300035117 Bacteria 5220
243 Ga0373954_0016363 3300035118 Bacteria 3318
244 Ga0373954_0048524 3300035118 Bacteria 1989
245 Ga0373956_0002706 3300035119 Bacteria 7174
246 Ga0373957_0003773 3300035120 Bacteria 4537
247 Ga0373955_0026253 3300035172 Bacteria 2998
248 Ga0373955_0036192 3300035172 Bacteria 2618
249 Ga0373924_0002474 3300035410 Bacteria 6210
250 Ga0373924_0007926 3300035410 Bacteria 3844
251 Ga0373935_0021315 3300035692 Bacteria 3966
252 Ga0373935_0107367 3300035692 Bacteria 1848
253 Ga0373927_0079135 3300035695 Bacteria 2129
254 Ga0373927_0092207 3300035695 Bacteria 1968
255 Ga0373933_0011908 3300035724 Bacteria 4802
256 Ga0373947_0061629 3300035725 Bacteria 2280
257 Ga0373937_0019213 3300036401 Bacteria 6117
258 Ga0373937_0060138 3300036401 Bacteria 3491
259 Ga0316582_0204169 3300036647 Bacteria 1349
260 Ga0316584_0017283 3300036712 Bacteria 5182
261 Ga0373925_0182371 3300037068 Bacteria 1662
262 Ga0436364_0416519 3300037853 Bacteria 115750
263 Ga0436364_0735894 3300037853 Bacteria 1400
264 Ga0436364_0875435 3300037853 Bacteria 49936
265 Ga0436364_1012512 3300037853 Bacteria 984
266 Ga0436364_1077806 3300037853 Bacteria 2225
267 Ga0436364_1314594 3300037853 Bacteria 1308
268 Ga0400488_16929 3300038741 Bacteria 2834
269 Ga0400483_124412 3300039062 Bacteria 5863
270 Ga0400483_138863 3300039062 Bacteria 12841
271 Ga0400483_227660 3300039062 Bacteria 13230
272 Ga0400483_275483 3300039062 Bacteria 1194
273 Ga0400483_285611 3300039062 Bacteria 2847
274 Ga0436365_0241419 3300039437 Bacteria 1878
275 Ga0436365_0762112 3300039437 Bacteria 3214
276 Ga0436365_1762481 3300039437 Bacteria 2038
277 Ga0436360_0326591 3300039438 Bacteria 4014
278 Ga0436360_0994756 3300039438 Bacteria 898
279 Ga0436360_1133014 3300039438 Bacteria 2203
280 Ga0436361_0025217 3300039447 Bacteria 4148
281 Ga0436361_0684437 3300039447 Bacteria 4824
282 Ga0436361_0759151 3300039447 Bacteria 1505
283 Ga0436363_0335493 3300039450 Bacteria 1668
284 Ga0436363_1545047 3300039450 Bacteria 4016
285 Ga0439465_0042058 3300041413 Bacteria 1480
286 Ga0451800_0712582 3300041459 Bacteria 1043
287 Ga0451802_0750801 3300041460 Bacteria 1031
288 Ga0439431_0072103 3300041997 Bacteria 921
289 Ga0466972_0127562 3300044658 Bacteria 1198
290 Ga0466966_0058403 3300044684 Bacteria 2438
291 Ga0466960_0182294 3300044901 Bacteria 1139
292 Ga0466959_0075791 3300045049 Bacteria 2430
293 Ga0451576_0002032 3300045051 Bacteria 31949
294 Ga0495617_105295 3300046452 Bacteria 915
295 Ga0495592_0032930 3300046454 Bacteria 3909
296 Ga0495592_0044611 3300046454 Bacteria 3312
297 Ga0495592_0187145 3300046454 Bacteria 1406
298 Ga0495603_0005569 3300046455 Bacteria 7520
299 Ga0495603_0013569 3300046455 Bacteria 4930
300 Ga0495629_0006932 3300046459 Bacteria 8359
301 Ga0495629_0026709 3300046459 Bacteria 4100
302 Ga0495638_0008466 3300046460 Bacteria 7292
303 Ga0495638_0098983 3300046460 Bacteria 1746
304 Ga0495641_0007231 3300046461 Bacteria 6983
305 Ga0495651_0154486 3300046462 Bacteria 1650
306 Ga0495653_0006024 3300046463 Bacteria 9932
307 Ga0495580_0064128 3300046472 Bacteria 2576
308 Ga0495605_0071012 3300046474 Bacteria 1645
309 Ga0495639_0001090 3300046475 Bacteria 12231
310 Ga0495662_0003031 3300046476 Bacteria 8476
311 Ga0495664_0024431 3300046477 Bacteria 3513
312 Ga0495585_0057182 3300046492 Bacteria 2153
313 Ga0495594_0012745 3300046499 Bacteria 4386
314 Ga0495608_0023285 3300046511 Bacteria 4246
315 Ga0495608_0028573 3300046511 Bacteria 3789
316 Ga0495616_0080626 3300046513 Bacteria 1558
317 Ga0495628_0051667 3300046516 Bacteria 3249
318 Ga0495630_0041576 3300046517 Bacteria 3433
319 Ga0495632_0144831 3300046519 Bacteria 1100
320 Ga0495643_0008427 3300046522 Bacteria 6525
321 Ga0495644_0025750 3300046523 Bacteria 2232
322 Ga0495648_0011298 3300046524 Bacteria 6737
323 Ga0495652_0114560 3300046529 Bacteria 2162
324 Ga0495640_0008246 3300046533 Bacteria 8177
325 Ga0495640_0021688 3300046533 Bacteria 4708
326 Ga0495640_0114897 3300046533 Bacteria 1755
327 Ga0495640_0379236 3300046533 Bacteria 870
328 Ga0495587_0019828 3300046536 Bacteria 4157
329 Ga0495587_0034503 3300046536 Bacteria 3051
330 Ga0495645_0026110 3300046543 Bacteria 4239
331 Ga0495622_0012388 3300046557 Bacteria 3948
332 Ga0495622_0043211 3300046557 Bacteria 2096
333 Ga0495667_0004548 3300046559 Bacteria 9365
334 Ga0495667_0016130 3300046559 Bacteria 5048
335 Ga0495667_0271774 3300046559 Bacteria 1077
336 Ga0495668_0131731 3300046616 Bacteria 1368
337 Ga0495634_0055281 3300046642 Bacteria 2654
338 Ga0495625_0243310 3300046660 Bacteria 1170
339 Ga0495635_0011805 3300046663 Bacteria 6125
340 Ga0495635_0021577 3300046663 Bacteria 4488
341 Ga0495588_0043630 3300046674 Bacteria 2295
342 Ga0495657_0010590 3300046675 Bacteria 6929
343 Ga0495623_0036244 3300046679 Bacteria 3160
344 Ga0495646_0006104 3300046680 Bacteria 7639
345 Ga0495647_0037285 3300046681 Bacteria 1834
346 Ga0495658_0017308 3300046683 Bacteria 3722
347 Ga0495669_0002077 3300046684 Bacteria 8198
348 Ga0495669_0044430 3300046684 Bacteria 1979
349 Ga0495613_0041726 3300046689 Bacteria 3397
350 Ga0495613_0089425 3300046689 Bacteria 2231
351 Ga0495649_0077511 3300046694 Bacteria 1779
352 Ga0495600_0008516 3300046809 Bacteria 6304
353 Ga0495581_0053082 3300047315 Bacteria 2341
354 Ga0495604_0058403 3300047317 Bacteria 2962
355 Ga0495636_0163270 3300047318 Bacteria 1004
356 Ga0495674_0019734 3300047319 Bacteria 6252
357 Ga0495680_0029385 3300047322 Bacteria 4501
358 Ga0495680_0157605 3300047322 Bacteria 1650
359 Ga0495675_0035602 3300047444 Bacteria 3178
360 Ga0495675_0035829 3300047444 Bacteria 3168
361 Ga0495685_064558 3300047447 Bacteria 1231
362 Ga0495684_0008792 3300047471 Bacteria 7805
363 Ga0495686_0118714 3300047472 Bacteria 1579
364 Ga0495686_0143592 3300047472 Bacteria 1407
365 Ga0495593_0003242 3300047673 Bacteria 9755
366 Ga0495593_0007020 3300047673 Bacteria 6603
367 Ga0495602_0094867 3300048088 Bacteria 2464
368 Ga0496100_0007844 3300048903 Bacteria 5925
369 Ga0496100_0305958 3300048903 Bacteria 1191
370 Ga0496101_0030678 3300048904 Bacteria 3772
371 Ga0496102_0001499 3300048905 Bacteria 20618
372 Ga0496102_0193281 3300048905 Bacteria 1918
373 Ga0496102_0349946 3300048905 Bacteria 1391
374 Ga0496103_0056075 3300048906 Bacteria 2445
375 Ga0496103_0070295 3300048906 Bacteria 2190
376 Ga0496104_0006502 3300048907 Bacteria 10279
377 Ga0496105_0169607 3300048908 Bacteria 1789
378 Ga0496105_0419450 3300048908 Bacteria 1060
379 Ga0496106_0000237 3300048909 Bacteria 38613
380 Ga0496106_0075960 3300048909 Bacteria 2574
381 Ga0496107_0009222 3300048910 Bacteria 6838
382 Ga0496108_0121296 3300048911 Bacteria 2242
383 Ga0496109_0022302 3300048912 Bacteria 5607
384 Ga0496109_0426141 3300048912 Bacteria 1253
385 Ga0496110_0053680 3300048913 Bacteria 3544
386 Ga0496111_0150825 3300048914 Bacteria 1724
387 Ga0496112_0159973 3300048915 Bacteria 2218
388 Ga0496113_0131858 3300048916 Bacteria 1962
389 Ga0496114_0005644 3300048917 Bacteria 9812
390 Ga0496115_0013014 3300048918 Bacteria 6280
391 Ga0496117_0032123 3300048920 Bacteria 3994
392 Ga0496118_0063618 3300048921 Bacteria 2713
393 Ga0496118_0078833 3300048921 Bacteria 2328
394 Ga0496121_0000923 3300048924 Bacteria 53102
395 Ga0496121_0005996 3300048924 Bacteria 15351
396 Ga0496121_0007289 3300048924 Bacteria 13381
397 Ga0496121_0009595 3300048924 Bacteria 11088
398 Ga0496121_0071432 3300048924 Bacteria 2791
399 Ga0496121_0155388 3300048924 Bacteria 1679
400 Ga0496121_0175111 3300048924 Bacteria 1554
401 Ga0496121_0197196 3300048924 Bacteria 1438
402 Ga0496121_0297450 3300048924 Bacteria 1097
403 Ga0496122_0042325 3300048925 Bacteria 3585
404 Ga0496122_0092410 3300048925 Bacteria 2057
405 Ga0496123_0124647 3300048926 Bacteria 1440
406 Ga0496124_0039178 3300048927 Bacteria 4110
407 Ga0496124_0081547 3300048927 Bacteria 2658
408 Ga0496124_0106131 3300048927 Bacteria 2268
409 Ga0496124_0109872 3300048927 Bacteria 2221
410 Ga0496125_0000314 3300048928 Bacteria 95420
411 Ga0496125_0000446 3300048928 Bacteria 75321
412 Ga0496125_0008194 3300048928 Bacteria 10996
413 Ga0496125_0083913 3300048928 Bacteria 2421
414 Ga0496125_0108015 3300048928 Bacteria 2026
415 Ga0496125_0209034 3300048928 Bacteria 1269
416 Ga0496125_0235869 3300048928 Bacteria 1165
417 Ga0496126_0008116 3300048929 Bacteria 11369
418 Ga0496126_0036184 3300048929 Bacteria 4618
419 Ga0496126_0269269 3300048929 Bacteria 1414
420 Ga0501031_0179009 3300049568 Bacteria 1385
421 Ga0501032_0045722 3300049569 Bacteria 2960
422 Ga0501034_0129011 3300049571 Bacteria 2512
423 Ga0501036_0053356 3300049572 Bacteria 3424
424 Ga0501036_0188587 3300049572 Bacteria 1735
425 Ga0501038_0084628 3300049574 Bacteria 2668
426 Ga0501038_0228026 3300049574 Bacteria 1484
427 Ga0501047_0119485 3300049581 Bacteria 2518
428 Ga0501047_0171396 3300049581 Bacteria 2039
429 Ga0501068_0020701 3300049584 Bacteria 3837
430 Ga0501074_0508805 3300049590 Bacteria 853
431 Ga0501076_0213047 3300049592 Bacteria 1579
432 Ga0501077_0118808 3300049593 Bacteria 1675
433 Ga0501080_0084231 3300049742 Bacteria 2954
434 Ga0501083_0068826 3300049744 Bacteria 2355
435 Ga0501035_0091564 3300049822 Bacteria 2676
436 nmdc:mga03683_54797_c1 3300050489 Bacteria 1673
437 nmdc:mga03683_85804_c1 3300050489 Bacteria 1366
438 nmdc:mga00v17_258703_c1 3300050491 Bacteria 1129
439 nmdc:mga00v17_50733_c1 3300050491 Bacteria 2522
440 nmdc:mga0yw44_155838_c1 3300050492 Bacteria 1493
441 nmdc:mga0k408_130384_c1 3300050493 Bacteria 1492
442 nmdc:mga0k408_85242_c1 3300050493 Bacteria 1854
443 nmdc:mga06z11_156212_c1 3300050494 Bacteria 1301
444 nmdc:mga07m45_63823_c1 3300050496 Bacteria 2089
445 nmdc:mga05p37_62949_c1 3300050507 Bacteria 4565
446 nmdc:mga09592_62539_c1 3300050508 Bacteria 3150
447 nmdc:mga0qj67_91630_c1 3300050509 Bacteria 2443
448 nmdc:mga06r32_1263_c1 3300050510 Bacteria 22731
449 nmdc:mga08y16_290882_c1 3300050511 Bacteria 1684
450 nmdc:mga0n895_141321_c1 3300050512 Bacteria 2436
451 nmdc:mga0rr50_101826_c1 3300050513 Bacteria 2258
452 nmdc:mga0rr50_37652_c1 3300050513 Bacteria 3494
453 nmdc:mga0sz30_15225_c1 3300050516 Bacteria 3038
454 Ga0495601_0030446 3300053077 Bacteria 3351
455 Ga0495601_0300616 3300053077 Bacteria 1045
456 Ga0500635_0016194 3300053080 Bacteria 2213
457 Ga0495655_0018320 3300053083 Bacteria 1537
458 Ga0495619_0005109 3300053085 Bacteria 8331
459 Ga0495619_0010563 3300053085 Bacteria 5810
460 Ga0500643_033237 3300053087 Bacteria 1561
461 Ga0500643_043358 3300053087 Bacteria 1312
462 Ga0500651_0002542 3300053093 Bacteria 9673
463 Ga0500651_0046289 3300053093 Bacteria 2736
464 Ga0500566_0000929 3300053094 Bacteria 16757
465 Ga0500641_0020884 3300053096 Bacteria 2489
466 Ga0500641_0122672 3300053096 Bacteria 1120
467 Ga0500554_043556 3300053102 Bacteria 1387
468 Ga0500572_000432 3300053111 Bacteria 14752
469 Ga0500595_001913 3300053119 Bacteria 10731
470 Ga0500595_002769 3300053119 Bacteria 8442
471 Ga0500595_002988 3300053119 Bacteria 8040
472 Ga0500595_021879 3300053119 Bacteria 2275
473 Ga0500595_026652 3300053119 Bacteria 1989
474 Ga0500642_0053511 3300053130 Bacteria 1790
475 Ga0500642_0117090 3300053130 Bacteria 1245
476 Ga0500559_0000381 3300053136 Bacteria 32402
477 Ga0500559_0066734 3300053136 Bacteria 1614
478 Ga0500568_0003894 3300053139 Bacteria 8127
479 Ga0500577_0000350 3300053142 Bacteria 11834
480 Ga0500590_042268 3300053148 Bacteria 2341
481 Ga0500603_027384 3300053150 Bacteria 1448
482 Ga0500616_0000333 3300053153 Bacteria 67555
483 Ga0500622_0000134 3300053156 Bacteria 78418
484 Ga0500622_0048554 3300053156 Bacteria 2190
485 Ga0500633_0004366 3300053160 Bacteria 3232
486 Ga0500638_018535 3300053162 Bacteria 3248
487 Ga0500639_014110 3300053163 Bacteria 4202
488 Ga0500639_179895 3300053163 Bacteria 936
489 Ga0500636_0043127 3300053177 Bacteria 2664
490 Ga0500636_0087291 3300053177 Bacteria 1790
491 Ga0500636_0154126 3300053177 Bacteria 1259
492 Ga0500637_0042512 3300053178 Bacteria 2569
493 Ga0500637_0069319 3300053178 Bacteria 2027
494 Ga0500611_009623 3300053727 Bacteria 1539
495 Ga0500596_003159 3300053735 Bacteria 3163
496 Ga0500661_000488 3300055283 Bacteria 7345
497 Ga0501082_0205500 3300060353 Bacteria 1713

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0011908 Ga0373933_0011908_1776_2468 217
2 3300006175 Ga0070712_100246052 Ga0070712_1002460522 233
3 3300025898 Ga0207692_10148134 Ga0207692_101481342 233
4 3300028800 Ga0265338_10007116 Ga0265338_100071165 236
5 3300049581 Ga0501047_0119485 Ga0501047_0119485_1733_2470 240
6 3300049590 Ga0501074_0508805 Ga0501074_0508805_45_776 240
7 3300060353 Ga0501082_0205500 Ga0501082_0205500_28_765 240
8 3300009147 Ga0114129_11192931 Ga0114129_111929311 241
9 3300007076 Ga0075435_100236269 Ga0075435_1002362691 242
10 3300050513 nmdc:mga0rr50_37652_c1 nmdc:mga0rr50_37652_c1_640_1437 242
11 3300033180 Ga0307510_10108156 Ga0307510_101081562 244
12 3300035117 Ga0373953_0002925 Ga0373953_0002925_1134_1919 245
13 3300035118 Ga0373954_0048524 Ga0373954_0048524_50_835 245
14 3300035172 Ga0373955_0036192 Ga0373955_0036192_1193_1978 245
15 3300035410 Ga0373924_0002474 Ga0373924_0002474_1700_2485 245
16 3300035692 Ga0373935_0107367 Ga0373935_0107367_874_1659 245
17 3300035695 Ga0373927_0092207 Ga0373927_0092207_1014_1799 245
18 3300036401 Ga0373937_0060138 Ga0373937_0060138_2671_3456 245
19 3300046511 Ga0495608_0023285 Ga0495608_0023285_504_1289 245
20 3300046533 Ga0495640_0114897 Ga0495640_0114897_183_968 245
21 3300046536 Ga0495587_0034503 Ga0495587_0034503_133_918 245
22 3300046559 Ga0495667_0016130 Ga0495667_0016130_3391_4176 245
23 3300047322 Ga0495680_0029385 Ga0495680_0029385_1588_2373 245
24 3300047444 Ga0495675_0035829 Ga0495675_0035829_1770_2555 245
25 3300053077 Ga0495601_0300616 Ga0495601_0300616_36_821 245
26 3300053085 Ga0495619_0010563 Ga0495619_0010563_1534_2319 245
27 3300003354 JGI25160J50197_1003605 JGI25160J50197_10036055 249
28 3300037853 Ga0436364_1012512 Ga0436364_1012512_79_837 250
29 3300048913 Ga0496110_0053680 Ga0496110_0053680_2512_3327 250
30 3300048927 Ga0496124_0081547 Ga0496124_0081547_1175_1990 250
31 3300048928 Ga0496125_0000314 Ga0496125_0000314_59616_60431 250
32 3300053111 Ga0500572_000432 Ga0500572_000432_5284_6042 250
33 3300053136 Ga0500559_0000381 Ga0500559_0000381_767_1525 250
34 3300053163 Ga0500639_014110 Ga0500639_014110_3338_4096 250
35 3300053735 Ga0500596_003159 Ga0500596_003159_2324_3082 250
36 3300044901 Ga0466960_0182294 Ga0466960_0182294_32_826 251
37 3300003203 JGI25406J46586_10010195 JGI25406J46586_100101952 253
38 3300005985 Ga0081539_10010306 Ga0081539_100103062 253
39 iso_pu_bacteria 8019586578 8019596048 253
40 3300053177 Ga0500636_0043127 Ga0500636_0043127_1677_2492 254
41 3300041997 Ga0439431_0072103 Ga0439431_0072103_26_793 255
42 3300048925 Ga0496122_0042325 Ga0496122_0042325_21_806 256
43 iso_pu_bacteria 2687453129 2687578224 259
44 3300036647 Ga0316582_0204169 Ga0316582_0204169_182_988 260
45 3300036712 Ga0316584_0017283 Ga0316584_0017283_849_1655 260
46 3300039062 Ga0400483_124412 Ga0400483_124412_444_1241 261
47 3300039062 Ga0400483_138863 Ga0400483_138863_6230_7027 261
48 3300039062 Ga0400483_227660 Ga0400483_227660_701_1498 261
49 3300039062 Ga0400483_285611 Ga0400483_285611_586_1383 261
50 3300039437 Ga0436365_0241419 Ga0436365_0241419_979_1773 262
51 3300039450 Ga0436363_0335493 Ga0436363_0335493_744_1547 262
52 3300006847 Ga0075431_100000872 Ga0075431_10000087226 263
53 3300050508 nmdc:mga09592_62539_c1 nmdc:mga09592_62539_c1_41_859 263
54 3300050509 nmdc:mga0qj67_91630_c1 nmdc:mga0qj67_91630_c1_1604_2422 263
55 3300050510 nmdc:mga06r32_1263_c1 nmdc:mga06r32_1263_c1_9746_10564 263
56 3300021384 Ga0213876_10018976 Ga0213876_100189762 264
57 3300021388 Ga0213875_10000003 Ga0213875_1000000396 264
58 3300037853 Ga0436364_0875435 Ga0436364_0875435_21153_21965 264
59 3300039437 Ga0436365_0762112 Ga0436365_0762112_1907_2719 264
60 iso_pu_bacteria 2510917026 2511172769 264
61 iso_pu_bacteria 2821443989 2821444457 264
62 iso_pu_bacteria 2844533157 2844536529 264
63 iso_pu_bacteria 2889790730 2889791326 264
64 iso_pu_bacteria 2889914905 2889920371 264
65 iso_pu_bacteria 2919171160 2919173875 264
66 iso_pu_bacteria 2922361189 2922362550 264
67 iso_pu_bacteria 3005409236 3005413978 264
68 3300031456 Ga0307513_10337460 Ga0307513_103374602 265
69 3300039447 Ga0436361_0684437 Ga0436361_0684437_3605_4402 265
70 3300049592 Ga0501076_0213047 Ga0501076_0213047_718_1530 265
71 3300049593 Ga0501077_0118808 Ga0501077_0118808_143_955 265
72 iso_pu_bacteria 2513237104 2513714776 265
73 iso_pu_bacteria 2876761206 2876765903 265
74 iso_pu_bacteria 641522639 641643114 265
75 iso_pu_bacteria 8016539877 8016543441 265
76 iso_pu_bacteria 8016557553 8016558266 265
77 iso_pu_bacteria 8016566248 8016568842 265
78 iso_pu_bacteria 8016575299 8016581489 265
79 iso_pu_bacteria 8016595262 8016596263 265
80 iso_pu_bacteria 8016603502 8016607173 265
81 iso_pu_bacteria 8019530166 8019538824 265
82 3300002987 JGI25159J45721_1009163 JGI25159J45721_10091632 266
83 3300003187 JGI25151J46595_10002045 JGI25151J46595_100020454 266
84 3300003354 JGI25160J50197_1019666 JGI25160J50197_10196662 266
85 3300005539 Ga0068853_100165547 Ga0068853_1001655471 266
86 3300010375 Ga0105239_10199233 Ga0105239_101992333 266
87 3300025284 Ga0209130_1000945 Ga0209130_100094523 266
88 3300025294 Ga0209025_1000215 Ga0209025_1000215109 266
89 3300025297 Ga0209758_1009318 Ga0209758_10093184 266
90 3300025302 Ga0207426_1000860 Ga0207426_10008604 266
91 3300039438 Ga0436360_0994756 Ga0436360_0994756_75_875 266
92 3300039450 Ga0436363_1545047 Ga0436363_1545047_2845_3651 266
93 3300045051 Ga0451576_0002032 Ga0451576_0002032_16770_17582 266
94 iso_pu_bacteria 2508501128 2509152068 266
95 iso_pu_bacteria 2513237141 2513888256 266
96 iso_pu_bacteria 2751185800 2753359436 266
97 iso_pu_bacteria 2854911287 2854911939 266
98 iso_pu_bacteria 643348564 643601853 266
99 3300005841 Ga0068863_100229587 Ga0068863_1002295872 267
100 3300005843 Ga0068860_100000401 Ga0068860_10000040136 267
101 3300021361 Ga0213872_10126196 Ga0213872_101261962 267
102 3300021388 Ga0213875_10002033 Ga0213875_100020332 267
103 3300026035 Ga0207703_10706878 Ga0207703_107068782 267
104 3300028381 Ga0268264_10000020 Ga0268264_10000020230 267
105 3300031507 Ga0307509_10090209 Ga0307509_100902094 267
106 3300037853 Ga0436364_0416519 Ga0436364_0416519_12092_12901 267
107 3300039447 Ga0436361_0759151 Ga0436361_0759151_33_842 267
108 3300048924 Ga0496121_0297450 Ga0496121_0297450_232_1035 267
109 iso_pu_bacteria 2513237101 2513697953 267
110 iso_pu_bacteria 2667528175 2671120129 267
111 iso_pu_bacteria 2721755755 2723846859 267
112 iso_pu_bacteria 2791355197 2793066309 267
113 iso_pu_bacteria 2874604998 2874611181 267
114 iso_pu_bacteria 2876808645 2876810548 267
115 iso_pu_bacteria 2879110137 2879114406 267
116 iso_pu_bacteria 2889033259 2889038345 267
117 iso_pu_bacteria 2903748898 2903752099 267
118 iso_pu_bacteria 2908756301 2908764672 267
119 iso_pu_bacteria 2922425934 2922431872 267
120 iso_pu_bacteria 8006984368 8006987507 267
121 iso_pu_bacteria 8006994254 8006995008 267
122 3300002739 JGI25158J39367_1000165 JGI25158J39367_100016513 268
123 3300002773 JGI25152J39213_1001185 JGI25152J39213_100118510 268
124 3300002987 JGI25159J45721_1000586 JGI25159J45721_10005863 268
125 3300003215 JGI25153J46596_10001784 JGI25153J46596_100017843 268
126 3300003374 JGI25161J50226_1000093 JGI25161J50226_100009341 268
127 3300003771 Ga0055526_1013476 Ga0055526_10134764 268
128 3300003790 Ga0055528_1008093 Ga0055528_10080936 268
129 3300003792 Ga0055540_1008429 Ga0055540_10084294 268
130 3300004625 Ga0055543_1000264 Ga0055543_100026421 268
131 3300005842 Ga0068858_100332219 Ga0068858_1003322191 268
132 3300005937 Ga0081455_10000015 Ga0081455_10000015124 268
133 3300005937 Ga0081455_10005028 Ga0081455_1000502810 268
134 3300009101 Ga0105247_10011726 Ga0105247_100117263 268
135 3300009551 Ga0105238_10061312 Ga0105238_100613123 268
136 3300010375 Ga0105239_10024361 Ga0105239_100243617 268
137 3300025208 Ga0209436_100007 Ga0209436_10000773 268
138 3300025273 Ga0209673_1005611 Ga0209673_10056115 268
139 3300025284 Ga0209130_1000001 Ga0209130_1000001697 268
140 3300025295 Ga0209564_1002242 Ga0209564_10022424 268
141 3300025297 Ga0209758_1037139 Ga0209758_10371392 268
142 3300025299 Ga0209256_1005394 Ga0209256_10053946 268
143 3300025302 Ga0207426_1000045 Ga0207426_1000045306 268
144 3300025304 Ga0209257_1027994 Ga0209257_10279942 268
145 3300025924 Ga0207694_10171026 Ga0207694_101710262 268
146 3300026035 Ga0207703_10068200 Ga0207703_100682003 268
147 3300026041 Ga0207639_10499052 Ga0207639_104990521 268
148 3300026078 Ga0207702_10426509 Ga0207702_104265091 268
149 3300037853 Ga0436364_0735894 Ga0436364_0735894_129_977 268
150 3300037853 Ga0436364_1314594 Ga0436364_1314594_216_1106 268
151 3300039437 Ga0436365_1762481 Ga0436365_1762481_930_1742 268
152 3300046522 Ga0495643_0008427 Ga0495643_0008427_3849_4670 268
153 3300048909 Ga0496106_0000237 Ga0496106_0000237_11648_12496 268
154 3300048924 Ga0496121_0009595 Ga0496121_0009595_9020_9841 268
155 3300048924 Ga0496121_0155388 Ga0496121_0155388_222_1028 268
156 3300048927 Ga0496124_0109872 Ga0496124_0109872_1044_1865 268
157 3300048928 Ga0496125_0083913 Ga0496125_0083913_1422_2231 268
158 3300048929 Ga0496126_0269269 Ga0496126_0269269_150_971 268
159 3300049568 Ga0501031_0179009 Ga0501031_0179009_89_910 268
160 3300049569 Ga0501032_0045722 Ga0501032_0045722_1350_2171 268
161 3300049571 Ga0501034_0129011 Ga0501034_0129011_1126_1941 268
162 3300049572 Ga0501036_0053356 Ga0501036_0053356_1574_2395 268
163 3300049574 Ga0501038_0084628 Ga0501038_0084628_1798_2613 268
164 3300049581 Ga0501047_0171396 Ga0501047_0171396_588_1403 268
165 3300049584 Ga0501068_0020701 Ga0501068_0020701_28_849 268
166 3300049742 Ga0501080_0084231 Ga0501080_0084231_1223_2038 268
167 3300049744 Ga0501083_0068826 Ga0501083_0068826_312_1133 268
168 3300049822 Ga0501035_0091564 Ga0501035_0091564_1713_2534 268
169 3300053093 Ga0500651_0046289 Ga0500651_0046289_353_1201 268
170 3300053139 Ga0500568_0003894 Ga0500568_0003894_4441_5289 268
171 3300053153 Ga0500616_0000333 Ga0500616_0000333_29597_30475 268
172 3300053156 Ga0500622_0000134 Ga0500622_0000134_42863_43684 268
173 3300053160 Ga0500633_0004366 Ga0500633_0004366_786_1634 268
174 3300005337 Ga0070682_100118079 Ga0070682_1001180792 269
175 3300005340 Ga0070689_100231001 Ga0070689_1002310012 269
176 3300005344 Ga0070661_100260977 Ga0070661_1002609772 269
177 3300005347 Ga0070668_100126848 Ga0070668_1001268481 269
178 3300005365 Ga0070688_100464405 Ga0070688_1004644051 269
179 3300005455 Ga0070663_100056679 Ga0070663_1000566793 269
180 3300005459 Ga0068867_100677509 Ga0068867_1006775091 269
181 3300005539 Ga0068853_100166991 Ga0068853_1001669912 269
182 3300005547 Ga0070693_100065055 Ga0070693_1000650552 269
183 3300005548 Ga0070665_100133587 Ga0070665_1001335872 269
184 3300005577 Ga0068857_100158668 Ga0068857_1001586681 269
185 3300005614 Ga0068856_100573463 Ga0068856_1005734632 269
186 3300005617 Ga0068859_100066364 Ga0068859_1000663643 269
187 3300005719 Ga0068861_100102623 Ga0068861_1001026232 269
188 3300005841 Ga0068863_100380806 Ga0068863_1003808062 269
189 3300005842 Ga0068858_100110545 Ga0068858_1001105453 269
190 3300005843 Ga0068860_100634458 Ga0068860_1006344582 269
191 3300005844 Ga0068862_100150043 Ga0068862_1001500432 269
192 3300005983 Ga0081540_1005314 Ga0081540_10053145 269
193 3300005985 Ga0081539_10155618 Ga0081539_101556182 269
194 3300006042 Ga0075368_10054001 Ga0075368_100540012 269
195 3300006173 Ga0070716_100192733 Ga0070716_1001927332 269
196 3300006237 Ga0097621_100077484 Ga0097621_1000774843 269
197 3300006871 Ga0075434_100144235 Ga0075434_1001442353 269
198 3300006931 Ga0097620_100066366 Ga0097620_1000663663 269
199 3300007076 Ga0075435_100413901 Ga0075435_1004139011 269
200 3300009098 Ga0105245_10025354 Ga0105245_100253543 269
201 3300009101 Ga0105247_10200515 Ga0105247_102005152 269
202 3300009545 Ga0105237_10305385 Ga0105237_103053852 269
203 3300013297 Ga0157378_10119272 Ga0157378_101192722 269
204 3300021441 Ga0213871_10019297 Ga0213871_100192972 269
205 3300025900 Ga0207710_10080122 Ga0207710_100801222 269
206 3300025919 Ga0207657_10332870 Ga0207657_103328702 269
207 3300025924 Ga0207694_10371886 Ga0207694_103718862 269
208 3300025927 Ga0207687_10034456 Ga0207687_100344562 269
209 3300025932 Ga0207690_10355491 Ga0207690_103554912 269
210 3300025933 Ga0207706_10035606 Ga0207706_100356062 269
211 3300025940 Ga0207691_10170618 Ga0207691_101706182 269
212 3300025942 Ga0207689_10215185 Ga0207689_102151852 269
213 3300025972 Ga0207668_10053351 Ga0207668_100533513 269
214 3300026041 Ga0207639_10651902 Ga0207639_106519021 269
215 3300026067 Ga0207678_10070966 Ga0207678_100709663 269
216 3300026067 Ga0207678_10167246 Ga0207678_101672461 269
217 3300031824 Ga0307413_10165434 Ga0307413_101654342 269
218 3300037853 Ga0436364_1077806 Ga0436364_1077806_293_1108 269
219 3300038741 Ga0400488_16929 Ga0400488_16929_1774_2595 269
220 3300039062 Ga0400483_275483 Ga0400483_275483_311_1141 269
221 3300039438 Ga0436360_1133014 Ga0436360_1133014_290_1099 269
222 3300039447 Ga0436361_0025217 Ga0436361_0025217_952_1761 269
223 3300041460 Ga0451802_0750801 Ga0451802_0750801_52_861 269
224 3300044658 Ga0466972_0127562 Ga0466972_0127562_187_996 269
225 3300048912 Ga0496109_0426141 Ga0496109_0426141_424_1233 269
226 3300048916 Ga0496113_0131858 Ga0496113_0131858_29_838 269
227 3300048928 Ga0496125_0108015 Ga0496125_0108015_407_1216 269
228 3300048928 Ga0496125_0209034 Ga0496125_0209034_229_1056 269
229 3300050494 nmdc:mga06z11_156212_c1 nmdc:mga06z11_156212_c1_42_851 269
230 3300050512 nmdc:mga0n895_141321_c1 nmdc:mga0n895_141321_c1_138_947 269
231 3300050513 nmdc:mga0rr50_101826_c1 nmdc:mga0rr50_101826_c1_673_1482 269
232 3300053087 Ga0500643_033237 Ga0500643_033237_248_1057 269
233 3300003354 JGI25160J50197_1003824 JGI25160J50197_10038246 270
234 3300003659 JGI25404J52841_10007911 JGI25404J52841_100079112 270
235 3300005467 Ga0070706_100038662 Ga0070706_1000386622 270
236 3300005468 Ga0070707_100016013 Ga0070707_1000160138 270
237 3300005471 Ga0070698_100012359 Ga0070698_1000123591 270
238 3300005536 Ga0070697_100073676 Ga0070697_1000736763 270
239 3300005536 Ga0070697_100074879 Ga0070697_1000748793 270
240 3300005548 Ga0070665_100051780 Ga0070665_1000517805 270
241 3300005577 Ga0068857_100187409 Ga0068857_1001874092 270
242 3300005937 Ga0081455_10047487 Ga0081455_100474872 270
243 3300005983 Ga0081540_1009052 Ga0081540_10090524 270
244 3300005985 Ga0081539_10041328 Ga0081539_100413282 270
245 3300006051 Ga0075364_10062739 Ga0075364_100627393 270
246 3300006177 Ga0075362_10172308 Ga0075362_101723081 270
247 3300021441 Ga0213871_10004267 Ga0213871_100042673 270
248 3300025284 Ga0209130_1000934 Ga0209130_100093413 270
249 3300025302 Ga0207426_1000301 Ga0207426_10003012 270
250 3300025920 Ga0207649_10146756 Ga0207649_101467562 270
251 3300026067 Ga0207678_10047174 Ga0207678_100471744 270
252 3300026116 Ga0207674_10225745 Ga0207674_102257452 270
253 3300031247 Ga0265340_10036339 Ga0265340_100363391 270
254 3300031249 Ga0265339_10006110 Ga0265339_100061108 270
255 3300039438 Ga0436360_0326591 Ga0436360_0326591_206_1021 270
256 3300041459 Ga0451800_0712582 Ga0451800_0712582_33_845 270
257 3300044684 Ga0466966_0058403 Ga0466966_0058403_926_1741 270
258 3300045049 Ga0466959_0075791 Ga0466959_0075791_211_1026 270
259 3300046524 Ga0495648_0011298 Ga0495648_0011298_2451_3263 270
260 3300048905 Ga0496102_0193281 Ga0496102_0193281_1074_1886 270
261 3300048924 Ga0496121_0197196 Ga0496121_0197196_62_907 270
262 3300048926 Ga0496123_0124647 Ga0496123_0124647_282_1127 270
263 3300048928 Ga0496125_0235869 Ga0496125_0235869_137_982 270
264 3300050489 nmdc:mga03683_54797_c1 nmdc:mga03683_54797_c1_802_1614 270
265 3300002244 JGI24742J22300_10015033 JGI24742J22300_100150332 271
266 3300005327 Ga0070658_10323661 Ga0070658_103236611 271
267 3300005328 Ga0070676_10149543 Ga0070676_101495431 271
268 3300005330 Ga0070690_100194040 Ga0070690_1001940401 271
269 3300005334 Ga0068869_100285194 Ga0068869_1002851942 271
270 3300005335 Ga0070666_10174630 Ga0070666_101746301 271
271 3300005347 Ga0070668_100017995 Ga0070668_1000179955 271
272 3300005347 Ga0070668_100271518 Ga0070668_1002715181 271
273 3300005353 Ga0070669_100072150 Ga0070669_1000721503 271
274 3300005356 Ga0070674_100122867 Ga0070674_1001228672 271
275 3300005365 Ga0070688_100309718 Ga0070688_1003097181 271
276 3300005440 Ga0070705_100132224 Ga0070705_1001322242 271
277 3300005455 Ga0070663_100100032 Ga0070663_1001000321 271
278 3300005455 Ga0070663_100109666 Ga0070663_1001096662 271
279 3300005455 Ga0070663_100438994 Ga0070663_1004389941 271
280 3300005456 Ga0070678_100283632 Ga0070678_1002836322 271
281 3300005457 Ga0070662_100079000 Ga0070662_1000790002 271
282 3300005458 Ga0070681_10061529 Ga0070681_100615293 271
283 3300005459 Ga0068867_100033985 Ga0068867_1000339853 271
284 3300005467 Ga0070706_100028002 Ga0070706_1000280025 271
285 3300005539 Ga0068853_100162257 Ga0068853_1001622573 271
286 3300005543 Ga0070672_100127233 Ga0070672_1001272332 271
287 3300005548 Ga0070665_100063825 Ga0070665_1000638254 271
288 3300005549 Ga0070704_100171373 Ga0070704_1001713732 271
289 3300005564 Ga0070664_100361163 Ga0070664_1003611632 271
290 3300005578 Ga0068854_100284014 Ga0068854_1002840142 271
291 3300005614 Ga0068856_100419193 Ga0068856_1004191932 271
292 3300005615 Ga0070702_100047676 Ga0070702_1000476762 271
293 3300005616 Ga0068852_100475475 Ga0068852_1004754752 271
294 3300005616 Ga0068852_100634717 Ga0068852_1006347171 271
295 3300005842 Ga0068858_100322788 Ga0068858_1003227882 271
296 3300005844 Ga0068862_100187768 Ga0068862_1001877682 271
297 3300005844 Ga0068862_100242781 Ga0068862_1002427813 271
298 3300005844 Ga0068862_100468429 Ga0068862_1004684292 271
299 3300005983 Ga0081540_1007564 Ga0081540_10075642 271
300 3300005983 Ga0081540_1024041 Ga0081540_10240413 271
301 3300006028 Ga0070717_10002386 Ga0070717_1000238618 271
302 3300006048 Ga0075363_100017233 Ga0075363_1000172333 271
303 3300006177 Ga0075362_10079173 Ga0075362_100791732 271
304 3300006844 Ga0075428_100049121 Ga0075428_1000491211 271
305 3300006852 Ga0075433_10661072 Ga0075433_106610721 271
306 3300006881 Ga0068865_100099651 Ga0068865_1000996512 271
307 3300006943 Ga0099822_1002166 Ga0099822_100216627 271
308 3300007788 Ga0099795_10008327 Ga0099795_100083272 271
309 3300009098 Ga0105245_10035550 Ga0105245_100355504 271
310 3300009101 Ga0105247_10070919 Ga0105247_100709192 271
311 3300009147 Ga0114129_10641816 Ga0114129_106418162 271
312 3300009148 Ga0105243_10130213 Ga0105243_101302132 271
313 3300009176 Ga0105242_10016328 Ga0105242_100163283 271
314 3300009177 Ga0105248_10154200 Ga0105248_101542001 271
315 3300009177 Ga0105248_10566555 Ga0105248_105665552 271
316 3300009553 Ga0105249_10032515 Ga0105249_100325153 271
317 3300009553 Ga0105249_10102923 Ga0105249_101029233 271
318 3300010375 Ga0105239_10068632 Ga0105239_100686324 271
319 3300010375 Ga0105239_10117205 Ga0105239_101172053 271
320 3300013296 Ga0157374_10058664 Ga0157374_100586642 271
321 3300013297 Ga0157378_10057089 Ga0157378_100570893 271
322 3300013308 Ga0157375_10404657 Ga0157375_104046572 271
323 3300014326 Ga0157380_10268303 Ga0157380_102683032 271
324 3300014326 Ga0157380_10285106 Ga0157380_102851062 271
325 3300014326 Ga0157380_10556111 Ga0157380_105561111 271
326 3300014745 Ga0157377_10044003 Ga0157377_100440032 271
327 3300014968 Ga0157379_10166547 Ga0157379_101665473 271
328 3300017792 Ga0163161_10229903 Ga0163161_102299031 271
329 3300025901 Ga0207688_10012610 Ga0207688_100126103 271
330 3300025907 Ga0207645_10097021 Ga0207645_100970211 271
331 3300025907 Ga0207645_10212424 Ga0207645_102124241 271
332 3300025908 Ga0207643_10150968 Ga0207643_101509683 271
333 3300025909 Ga0207705_10064077 Ga0207705_100640772 271
334 3300025910 Ga0207684_10292205 Ga0207684_102922051 271
335 3300025917 Ga0207660_10040819 Ga0207660_100408194 271
336 3300025920 Ga0207649_10056615 Ga0207649_100566153 271
337 3300025923 Ga0207681_10048649 Ga0207681_100486493 271
338 3300025927 Ga0207687_10020485 Ga0207687_100204852 271
339 3300025933 Ga0207706_10060267 Ga0207706_100602673 271
340 3300025937 Ga0207669_10098501 Ga0207669_100985012 271
341 3300025938 Ga0207704_10063069 Ga0207704_100630693 271
342 3300025940 Ga0207691_10040143 Ga0207691_100401433 271
343 3300025944 Ga0207661_10110085 Ga0207661_101100852 271
344 3300025945 Ga0207679_10164737 Ga0207679_101647372 271
345 3300025961 Ga0207712_10147002 Ga0207712_101470022 271
346 3300025972 Ga0207668_10130154 Ga0207668_101301542 271
347 3300025972 Ga0207668_10147809 Ga0207668_101478091 271
348 3300025972 Ga0207668_10284458 Ga0207668_102844582 271
349 3300026035 Ga0207703_10520984 Ga0207703_105209842 271
350 3300026067 Ga0207678_10044910 Ga0207678_100449103 271
351 3300026067 Ga0207678_10159021 Ga0207678_101590212 271
352 3300026067 Ga0207678_10234713 Ga0207678_102347132 271
353 3300026075 Ga0207708_10021294 Ga0207708_100212942 271
354 3300026078 Ga0207702_10289974 Ga0207702_102899741 271
355 3300026089 Ga0207648_10007491 Ga0207648_100074914 271
356 3300026118 Ga0207675_100011623 Ga0207675_1000116237 271
357 3300026121 Ga0207683_10023490 Ga0207683_100234905 271
358 3300027512 Ga0209179_1008463 Ga0209179_10084632 271
359 3300028379 Ga0268266_10035685 Ga0268266_100356855 271
360 3300028379 Ga0268266_10290839 Ga0268266_102908392 271
361 3300028380 Ga0268265_10076736 Ga0268265_100767362 271
362 3300028380 Ga0268265_10092348 Ga0268265_100923482 271
363 3300028380 Ga0268265_10112759 Ga0268265_101127592 271
364 3300028380 Ga0268265_10533373 Ga0268265_105333732 271
365 3300028786 Ga0307517_10000139 Ga0307517_10000139104 271
366 3300028794 Ga0307515_10154721 Ga0307515_101547212 271
367 3300028794 Ga0307515_10236335 Ga0307515_102363352 271
368 3300031235 Ga0265330_10003776 Ga0265330_100037762 271
369 3300031238 Ga0265332_10020782 Ga0265332_100207822 271
370 3300031239 Ga0265328_10018918 Ga0265328_100189183 271
371 3300031241 Ga0265325_10002588 Ga0265325_100025888 271
372 3300031250 Ga0265331_10004867 Ga0265331_100048674 271
373 3300031507 Ga0307509_10038026 Ga0307509_100380264 271
374 3300031595 Ga0265313_10021170 Ga0265313_100211702 271
375 3300031616 Ga0307508_10042362 Ga0307508_100423624 271
376 3300031616 Ga0307508_10128427 Ga0307508_101284272 271
377 3300031712 Ga0265342_10019343 Ga0265342_100193432 271
378 3300031712 Ga0265342_10145457 Ga0265342_101454571 271
379 3300031730 Ga0307516_10143629 Ga0307516_101436292 271
380 3300033179 Ga0307507_10018492 Ga0307507_100184925 271
381 3300033180 Ga0307510_10008205 Ga0307510_100082059 271
382 3300035083 Ga0373926_0048273 Ga0373926_0048273_458_1273 271
383 3300035111 Ga0373923_0012720 Ga0373923_0012720_667_1509 271
384 3300035118 Ga0373954_0016363 Ga0373954_0016363_622_1464 271
385 3300035119 Ga0373956_0002706 Ga0373956_0002706_3819_4661 271
386 3300035120 Ga0373957_0003773 Ga0373957_0003773_1711_2553 271
387 3300035172 Ga0373955_0026253 Ga0373955_0026253_314_1156 271
388 3300035410 Ga0373924_0007926 Ga0373924_0007926_519_1361 271
389 3300035692 Ga0373935_0021315 Ga0373935_0021315_488_1303 271
390 3300035695 Ga0373927_0079135 Ga0373927_0079135_754_1599 271
391 3300035725 Ga0373947_0061629 Ga0373947_0061629_205_1050 271
392 3300036401 Ga0373937_0019213 Ga0373937_0019213_519_1361 271
393 3300037068 Ga0373925_0182371 Ga0373925_0182371_233_1048 271
394 3300041413 Ga0439465_0042058 Ga0439465_0042058_172_987 271
395 3300046452 Ga0495617_105295 Ga0495617_105295_35_850 271
396 3300046454 Ga0495592_0032930 Ga0495592_0032930_315_1157 271
397 3300046454 Ga0495592_0044611 Ga0495592_0044611_1081_1926 271
398 3300046454 Ga0495592_0187145 Ga0495592_0187145_404_1219 271
399 3300046455 Ga0495603_0005569 Ga0495603_0005569_6570_7415 271
400 3300046455 Ga0495603_0013569 Ga0495603_0013569_4048_4863 271
401 3300046459 Ga0495629_0006932 Ga0495629_0006932_2094_2936 271
402 3300046459 Ga0495629_0026709 Ga0495629_0026709_1467_2312 271
403 3300046460 Ga0495638_0008466 Ga0495638_0008466_1512_2327 271
404 3300046460 Ga0495638_0098983 Ga0495638_0098983_559_1374 271
405 3300046461 Ga0495641_0007231 Ga0495641_0007231_5075_5920 271
406 3300046462 Ga0495651_0154486 Ga0495651_0154486_187_1029 271
407 3300046463 Ga0495653_0006024 Ga0495653_0006024_3109_3951 271
408 3300046472 Ga0495580_0064128 Ga0495580_0064128_1748_2563 271
409 3300046474 Ga0495605_0071012 Ga0495605_0071012_259_1074 271
410 3300046475 Ga0495639_0001090 Ga0495639_0001090_5469_6314 271
411 3300046476 Ga0495662_0003031 Ga0495662_0003031_3133_3978 271
412 3300046477 Ga0495664_0024431 Ga0495664_0024431_943_1758 271
413 3300046492 Ga0495585_0057182 Ga0495585_0057182_219_1034 271
414 3300046499 Ga0495594_0012745 Ga0495594_0012745_44_889 271
415 3300046511 Ga0495608_0028573 Ga0495608_0028573_187_1029 271
416 3300046513 Ga0495616_0080626 Ga0495616_0080626_341_1156 271
417 3300046516 Ga0495628_0051667 Ga0495628_0051667_773_1615 271
418 3300046517 Ga0495630_0041576 Ga0495630_0041576_575_1420 271
419 3300046519 Ga0495632_0144831 Ga0495632_0144831_117_932 271
420 3300046523 Ga0495644_0025750 Ga0495644_0025750_792_1607 271
421 3300046529 Ga0495652_0114560 Ga0495652_0114560_699_1541 271
422 3300046533 Ga0495640_0008246 Ga0495640_0008246_3281_4123 271
423 3300046533 Ga0495640_0021688 Ga0495640_0021688_1962_2807 271
424 3300046533 Ga0495640_0379236 Ga0495640_0379236_14_829 271
425 3300046536 Ga0495587_0019828 Ga0495587_0019828_2530_3372 271
426 3300046543 Ga0495645_0026110 Ga0495645_0026110_560_1402 271
427 3300046557 Ga0495622_0012388 Ga0495622_0012388_1858_2673 271
428 3300046557 Ga0495622_0043211 Ga0495622_0043211_613_1428 271
429 3300046559 Ga0495667_0004548 Ga0495667_0004548_3561_4403 271
430 3300046559 Ga0495667_0271774 Ga0495667_0271774_212_1027 271
431 3300046616 Ga0495668_0131731 Ga0495668_0131731_61_876 271
432 3300046642 Ga0495634_0055281 Ga0495634_0055281_752_1594 271
433 3300046660 Ga0495625_0243310 Ga0495625_0243310_320_1135 271
434 3300046663 Ga0495635_0011805 Ga0495635_0011805_2915_3760 271
435 3300046663 Ga0495635_0021577 Ga0495635_0021577_2000_2842 271
436 3300046674 Ga0495588_0043630 Ga0495588_0043630_1269_2084 271
437 3300046675 Ga0495657_0010590 Ga0495657_0010590_647_1489 271
438 3300046679 Ga0495623_0036244 Ga0495623_0036244_2004_2846 271
439 3300046680 Ga0495646_0006104 Ga0495646_0006104_1806_2648 271
440 3300046681 Ga0495647_0037285 Ga0495647_0037285_916_1761 271
441 3300046683 Ga0495658_0017308 Ga0495658_0017308_1844_2689 271
442 3300046684 Ga0495669_0002077 Ga0495669_0002077_492_1307 271
443 3300046684 Ga0495669_0044430 Ga0495669_0044430_804_1619 271
444 3300046689 Ga0495613_0041726 Ga0495613_0041726_785_1627 271
445 3300046689 Ga0495613_0089425 Ga0495613_0089425_659_1504 271
446 3300046694 Ga0495649_0077511 Ga0495649_0077511_381_1196 271
447 3300046809 Ga0495600_0008516 Ga0495600_0008516_2530_3372 271
448 3300047315 Ga0495581_0053082 Ga0495581_0053082_786_1631 271
449 3300047317 Ga0495604_0058403 Ga0495604_0058403_1806_2648 271
450 3300047318 Ga0495636_0163270 Ga0495636_0163270_136_951 271
451 3300047319 Ga0495674_0019734 Ga0495674_0019734_3822_4664 271
452 3300047322 Ga0495680_0157605 Ga0495680_0157605_187_1029 271
453 3300047444 Ga0495675_0035602 Ga0495675_0035602_1690_2532 271
454 3300047447 Ga0495685_064558 Ga0495685_064558_164_979 271
455 3300047471 Ga0495684_0008792 Ga0495684_0008792_3306_4148 271
456 3300047472 Ga0495686_0118714 Ga0495686_0118714_533_1348 271
457 3300047472 Ga0495686_0143592 Ga0495686_0143592_527_1342 271
458 3300047673 Ga0495593_0003242 Ga0495593_0003242_5982_6824 271
459 3300047673 Ga0495593_0007020 Ga0495593_0007020_3027_3872 271
460 3300048088 Ga0495602_0094867 Ga0495602_0094867_315_1157 271
461 3300048903 Ga0496100_0007844 Ga0496100_0007844_1921_2736 271
462 3300048903 Ga0496100_0305958 Ga0496100_0305958_274_1089 271
463 3300048904 Ga0496101_0030678 Ga0496101_0030678_464_1279 271
464 3300048905 Ga0496102_0001499 Ga0496102_0001499_8166_8981 271
465 3300048905 Ga0496102_0349946 Ga0496102_0349946_459_1274 271
466 3300048906 Ga0496103_0056075 Ga0496103_0056075_1068_1883 271
467 3300048906 Ga0496103_0070295 Ga0496103_0070295_884_1699 271
468 3300048907 Ga0496104_0006502 Ga0496104_0006502_8711_9526 271
469 3300048908 Ga0496105_0169607 Ga0496105_0169607_59_874 271
470 3300048908 Ga0496105_0419450 Ga0496105_0419450_154_969 271
471 3300048909 Ga0496106_0075960 Ga0496106_0075960_1221_2036 271
472 3300048910 Ga0496107_0009222 Ga0496107_0009222_5529_6344 271
473 3300048911 Ga0496108_0121296 Ga0496108_0121296_820_1635 271
474 3300048912 Ga0496109_0022302 Ga0496109_0022302_2950_3765 271
475 3300048914 Ga0496111_0150825 Ga0496111_0150825_317_1132 271
476 3300048915 Ga0496112_0159973 Ga0496112_0159973_609_1424 271
477 3300048917 Ga0496114_0005644 Ga0496114_0005644_6086_6901 271
478 3300048918 Ga0496115_0013014 Ga0496115_0013014_2578_3393 271
479 3300048920 Ga0496117_0032123 Ga0496117_0032123_1045_1860 271
480 3300048921 Ga0496118_0063618 Ga0496118_0063618_620_1435 271
481 3300048921 Ga0496118_0078833 Ga0496118_0078833_188_1003 271
482 3300048924 Ga0496121_0000923 Ga0496121_0000923_2553_3368 271
483 3300048924 Ga0496121_0005996 Ga0496121_0005996_12191_13006 271
484 3300048924 Ga0496121_0007289 Ga0496121_0007289_7719_8534 271
485 3300048924 Ga0496121_0071432 Ga0496121_0071432_1565_2380 271
486 3300048924 Ga0496121_0175111 Ga0496121_0175111_476_1291 271
487 3300048925 Ga0496122_0092410 Ga0496122_0092410_399_1214 271
488 3300048927 Ga0496124_0039178 Ga0496124_0039178_1820_2635 271
489 3300048927 Ga0496124_0106131 Ga0496124_0106131_252_1067 271
490 3300048928 Ga0496125_0000446 Ga0496125_0000446_66089_66904 271
491 3300048928 Ga0496125_0008194 Ga0496125_0008194_1064_1879 271
492 3300048929 Ga0496126_0008116 Ga0496126_0008116_3685_4500 271
493 3300048929 Ga0496126_0036184 Ga0496126_0036184_24_839 271
494 3300049572 Ga0501036_0188587 Ga0501036_0188587_189_1004 271
495 3300049574 Ga0501038_0228026 Ga0501038_0228026_46_861 271
496 3300050489 nmdc:mga03683_85804_c1 nmdc:mga03683_85804_c1_97_912 271
497 3300050491 nmdc:mga00v17_258703_c1 nmdc:mga00v17_258703_c1_126_941 271
498 3300050491 nmdc:mga00v17_50733_c1 nmdc:mga00v17_50733_c1_1144_1959 271
499 3300050492 nmdc:mga0yw44_155838_c1 nmdc:mga0yw44_155838_c1_23_838 271
500 3300050493 nmdc:mga0k408_130384_c1 nmdc:mga0k408_130384_c1_432_1247 271
501 3300050493 nmdc:mga0k408_85242_c1 nmdc:mga0k408_85242_c1_102_917 271
502 3300050496 nmdc:mga07m45_63823_c1 nmdc:mga07m45_63823_c1_1129_1944 271
503 3300050507 nmdc:mga05p37_62949_c1 nmdc:mga05p37_62949_c1_2995_3810 271
504 3300050511 nmdc:mga08y16_290882_c1 nmdc:mga08y16_290882_c1_832_1647 271
505 3300050516 nmdc:mga0sz30_15225_c1 nmdc:mga0sz30_15225_c1_630_1445 271
506 3300053077 Ga0495601_0030446 Ga0495601_0030446_1146_1988 271
507 3300053080 Ga0500635_0016194 Ga0500635_0016194_996_1811 271
508 3300053083 Ga0495655_0018320 Ga0495655_0018320_47_862 271
509 3300053085 Ga0495619_0005109 Ga0495619_0005109_2402_3244 271
510 3300053087 Ga0500643_043358 Ga0500643_043358_308_1123 271
511 3300053093 Ga0500651_0002542 Ga0500651_0002542_7290_8105 271
512 3300053094 Ga0500566_0000929 Ga0500566_0000929_5687_6502 271
513 3300053096 Ga0500641_0020884 Ga0500641_0020884_748_1563 271
514 3300053096 Ga0500641_0122672 Ga0500641_0122672_35_850 271
515 3300053102 Ga0500554_043556 Ga0500554_043556_558_1373 271
516 3300053119 Ga0500595_001913 Ga0500595_001913_7227_8042 271
517 3300053119 Ga0500595_002769 Ga0500595_002769_4433_5248 271
518 3300053119 Ga0500595_002988 Ga0500595_002988_4787_5602 271
519 3300053119 Ga0500595_021879 Ga0500595_021879_1431_2246 271
520 3300053119 Ga0500595_026652 Ga0500595_026652_822_1637 271
521 3300053130 Ga0500642_0053511 Ga0500642_0053511_492_1307 271
522 3300053130 Ga0500642_0117090 Ga0500642_0117090_334_1149 271
523 3300053136 Ga0500559_0066734 Ga0500559_0066734_568_1383 271
524 3300053142 Ga0500577_0000350 Ga0500577_0000350_8181_8996 271
525 3300053148 Ga0500590_042268 Ga0500590_042268_282_1097 271
526 3300053150 Ga0500603_027384 Ga0500603_027384_142_957 271
527 3300053156 Ga0500622_0048554 Ga0500622_0048554_957_1772 271
528 3300053162 Ga0500638_018535 Ga0500638_018535_2053_2868 271
529 3300053163 Ga0500639_179895 Ga0500639_179895_93_908 271
530 3300053177 Ga0500636_0087291 Ga0500636_0087291_842_1657 271
531 3300053177 Ga0500636_0154126 Ga0500636_0154126_199_1014 271
532 3300053178 Ga0500637_0042512 Ga0500637_0042512_296_1111 271
533 3300053178 Ga0500637_0069319 Ga0500637_0069319_378_1193 271
534 3300053727 Ga0500611_009623 Ga0500611_009623_326_1141 271
535 3300055283 Ga0500661_000488 Ga0500661_000488_1166_1981 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

43

199

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9365 2 231
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9352 2 234
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9347 2 228
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9346 2 231
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9339 2 231
ID Description Score Start End Superfamily
af_Q2G1L8_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9615 2 245 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9472 1 222 3.40.50.300
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.946 1 244 3.40.50.300
af_P16677_4_261_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9391 1 248 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9366 2 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1S2LLA8-F1-model_v4 Phosphonate ABC transporter ATP-binding protein 0.9785 1 240 GO:0005524
GO:0005886
GO:0015416
GO:0016887
AF-A0A1S2LLA8-F1-model_v4 Phosphonate ABC transporter ATP-binding protein 0.9588 1 240 GO:0005524
GO:0005886
GO:0015416
GO:0016887
AF-A0A2N2YX47-F1-model_v4 ABC transporter ATP-binding protein 0.9458 2 241 GO:0005524
GO:0016887
AF-A0A097B6U0-F1-model_v4 deleted 0.9439 2 239
AF-A0A1H2SJR7-F1-model_v4 Iron complex transport system ATP-binding protein 0.9433 2 241 GO:0005524
GO:0005886
GO:0006826
GO:0016887

Feature Viewer

pLDDT pTM Quality
86.59 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map