F460685
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 535 | 360 | 497 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_1314594|Ga0436364_1314594_216_1106 |
| Length | 296 |
| Sequence | LGCYLPRDIDSDKPLGEARQSGPGVLMLEIDSLSRNFGGRAAVAGVSLQIEKGSFVGIIGRSGAGKSTLLRLINRLLEPSAGRVVFDGADVTALRGRALRQWRARAAMVFQQFNLIGRLDVLTNVLIGRLAMVPAWRSLLRYWPDRDQAIALAALEQFDMAELAAQRADHLSGGQQQRVAIARALVQEPLLILADEPTASLDPHNTRVVMEALRRINRHFGITVICNLHSLDVARAYCDRLVGMAAGKIVFDDATAMLTDDAARALYGVASAGGDAMAASSADAPLPAHALGQPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 5 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 6 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 7 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 8 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 9 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 10 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 11 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 12 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 13 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 14 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 15 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 16 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 17 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 18 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 19 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 20 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 21 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 22 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 23 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 24 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 25 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 26 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 27 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 28 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 29 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 30 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 31 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 34 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 35 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 120 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 166 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 172 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 176 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 177 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 183 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 184 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 185 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 198 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 199 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 201 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 202 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 205 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 206 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 207 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 208 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 211 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 287 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 288 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 289 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 290 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 291 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 292 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 309 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 311 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 323 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 326 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 327 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 328 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 329 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 330 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 331 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 332 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 333 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 334 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 336 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 337 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 338 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 340 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 341 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 343 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 345 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 346 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 347 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 350 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 351 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 352 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 353 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 354 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 355 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 356 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 357 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 358 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 359 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 360 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.07 |
| Metatranscriptomes | 0 |
| Isolates | 6.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.14 |
| Nodule | 4.49 |
| Rhizoplane | 4.86 |
| Rhizosphere | 62.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10015033 | 3300002244 | Bacteria | 1301 |
| 2 | JGI25158J39367_1000165 | 3300002739 | Bacteria | 15739 |
| 3 | JGI25152J39213_1001185 | 3300002773 | Bacteria | 12013 |
| 4 | JGI25159J45721_1000586 | 3300002987 | Bacteria | 16363 |
| 5 | JGI25159J45721_1009163 | 3300002987 | Bacteria | 2637 |
| 6 | JGI25151J46595_10002045 | 3300003187 | Bacteria | 12604 |
| 7 | JGI25406J46586_10010195 | 3300003203 | Bacteria | 4178 |
| 8 | JGI25153J46596_10001784 | 3300003215 | Bacteria | 12763 |
| 9 | JGI25160J50197_1003605 | 3300003354 | Bacteria | 6874 |
| 10 | JGI25160J50197_1003824 | 3300003354 | Bacteria | 6614 |
| 11 | JGI25160J50197_1019666 | 3300003354 | Bacteria | 2063 |
| 12 | JGI25161J50226_1000093 | 3300003374 | Bacteria | 72639 |
| 13 | JGI25404J52841_10007911 | 3300003659 | Bacteria | 2255 |
| 14 | Ga0055526_1013476 | 3300003771 | Bacteria | 3454 |
| 15 | Ga0055528_1008093 | 3300003790 | Bacteria | 4557 |
| 16 | Ga0055540_1008429 | 3300003792 | Bacteria | 3715 |
| 17 | Ga0055543_1000264 | 3300004625 | Bacteria | 39219 |
| 18 | Ga0070658_10323661 | 3300005327 | Bacteria | 1317 |
| 19 | Ga0070676_10149543 | 3300005328 | Bacteria | 1494 |
| 20 | Ga0070690_100194040 | 3300005330 | Bacteria | 1409 |
| 21 | Ga0068869_100285194 | 3300005334 | Bacteria | 1329 |
| 22 | Ga0070666_10174630 | 3300005335 | Bacteria | 1506 |
| 23 | Ga0070682_100118079 | 3300005337 | Bacteria | 1777 |
| 24 | Ga0070689_100231001 | 3300005340 | Bacteria | 1521 |
| 25 | Ga0070661_100260977 | 3300005344 | Bacteria | 1339 |
| 26 | Ga0070668_100017995 | 3300005347 | Bacteria | 5301 |
| 27 | Ga0070668_100126848 | 3300005347 | Bacteria | 2044 |
| 28 | Ga0070668_100271518 | 3300005347 | Bacteria | 1413 |
| 29 | Ga0070669_100072150 | 3300005353 | Bacteria | 2556 |
| 30 | Ga0070674_100122867 | 3300005356 | Bacteria | 1924 |
| 31 | Ga0070688_100309718 | 3300005365 | Bacteria | 1144 |
| 32 | Ga0070688_100464405 | 3300005365 | Bacteria | 949 |
| 33 | Ga0070705_100132224 | 3300005440 | Bacteria | 1629 |
| 34 | Ga0070663_100056679 | 3300005455 | Bacteria | 2808 |
| 35 | Ga0070663_100100032 | 3300005455 | Bacteria | 2162 |
| 36 | Ga0070663_100109666 | 3300005455 | Bacteria | 2072 |
| 37 | Ga0070663_100438994 | 3300005455 | Bacteria | 1074 |
| 38 | Ga0070678_100283632 | 3300005456 | Bacteria | 1402 |
| 39 | Ga0070662_100079000 | 3300005457 | Bacteria | 2445 |
| 40 | Ga0070681_10061529 | 3300005458 | Bacteria | 3728 |
| 41 | Ga0068867_100033985 | 3300005459 | Bacteria | 3695 |
| 42 | Ga0068867_100677509 | 3300005459 | Bacteria | 908 |
| 43 | Ga0070706_100028002 | 3300005467 | Bacteria | 5184 |
| 44 | Ga0070706_100038662 | 3300005467 | Bacteria | 4404 |
| 45 | Ga0070707_100016013 | 3300005468 | Bacteria | 7034 |
| 46 | Ga0070698_100012359 | 3300005471 | Bacteria | 9039 |
| 47 | Ga0070697_100073676 | 3300005536 | Bacteria | 2804 |
| 48 | Ga0070697_100074879 | 3300005536 | Bacteria | 2782 |
| 49 | Ga0068853_100162257 | 3300005539 | Bacteria | 2018 |
| 50 | Ga0068853_100165547 | 3300005539 | Bacteria | 1998 |
| 51 | Ga0068853_100166991 | 3300005539 | Bacteria | 1989 |
| 52 | Ga0070672_100127233 | 3300005543 | Bacteria | 2091 |
| 53 | Ga0070693_100065055 | 3300005547 | Bacteria | 2130 |
| 54 | Ga0070665_100051780 | 3300005548 | Bacteria | 4117 |
| 55 | Ga0070665_100063825 | 3300005548 | Bacteria | 3693 |
| 56 | Ga0070665_100133587 | 3300005548 | Bacteria | 2483 |
| 57 | Ga0070704_100171373 | 3300005549 | Bacteria | 1727 |
| 58 | Ga0070664_100361163 | 3300005564 | Bacteria | 1323 |
| 59 | Ga0068857_100158668 | 3300005577 | Bacteria | 2052 |
| 60 | Ga0068857_100187409 | 3300005577 | Bacteria | 1884 |
| 61 | Ga0068854_100284014 | 3300005578 | Bacteria | 1334 |
| 62 | Ga0068856_100419193 | 3300005614 | Bacteria | 1359 |
| 63 | Ga0068856_100573463 | 3300005614 | Bacteria | 1150 |
| 64 | Ga0070702_100047676 | 3300005615 | Bacteria | 2435 |
| 65 | Ga0068852_100475475 | 3300005616 | Bacteria | 1241 |
| 66 | Ga0068852_100634717 | 3300005616 | Bacteria | 1075 |
| 67 | Ga0068859_100066364 | 3300005617 | Bacteria | 3643 |
| 68 | Ga0068861_100102623 | 3300005719 | Bacteria | 2277 |
| 69 | Ga0068863_100229587 | 3300005841 | Bacteria | 1790 |
| 70 | Ga0068863_100380806 | 3300005841 | Bacteria | 1377 |
| 71 | Ga0068858_100110545 | 3300005842 | Bacteria | 2566 |
| 72 | Ga0068858_100322788 | 3300005842 | Bacteria | 1476 |
| 73 | Ga0068858_100332219 | 3300005842 | Bacteria | 1454 |
| 74 | Ga0068860_100000401 | 3300005843 | Bacteria | 56564 |
| 75 | Ga0068860_100634458 | 3300005843 | Bacteria | 1075 |
| 76 | Ga0068862_100150043 | 3300005844 | Bacteria | 2074 |
| 77 | Ga0068862_100187768 | 3300005844 | Bacteria | 1858 |
| 78 | Ga0068862_100242781 | 3300005844 | Bacteria | 1638 |
| 79 | Ga0068862_100468429 | 3300005844 | Bacteria | 1190 |
| 80 | Ga0081455_10000015 | 3300005937 | Bacteria | 189655 |
| 81 | Ga0081455_10005028 | 3300005937 | Bacteria | 14622 |
| 82 | Ga0081455_10047487 | 3300005937 | Bacteria | 3718 |
| 83 | Ga0081540_1005314 | 3300005983 | Bacteria | 9633 |
| 84 | Ga0081540_1007564 | 3300005983 | Bacteria | 7723 |
| 85 | Ga0081540_1009052 | 3300005983 | Bacteria | 6881 |
| 86 | Ga0081540_1024041 | 3300005983 | Bacteria | 3545 |
| 87 | Ga0081539_10010306 | 3300005985 | Bacteria | 7619 |
| 88 | Ga0081539_10041328 | 3300005985 | Bacteria | 2696 |
| 89 | Ga0081539_10155618 | 3300005985 | Bacteria | 1095 |
| 90 | Ga0070717_10002386 | 3300006028 | Bacteria | 13244 |
| 91 | Ga0075368_10054001 | 3300006042 | Bacteria | 1600 |
| 92 | Ga0075363_100017233 | 3300006048 | Bacteria | 3579 |
| 93 | Ga0075364_10062739 | 3300006051 | Bacteria | 2439 |
| 94 | Ga0070716_100192733 | 3300006173 | Bacteria | 1348 |
| 95 | Ga0070712_100246052 | 3300006175 | Bacteria | 1426 |
| 96 | Ga0075362_10079173 | 3300006177 | Bacteria | 1512 |
| 97 | Ga0075362_10172308 | 3300006177 | Bacteria | 1046 |
| 98 | Ga0097621_100077484 | 3300006237 | Bacteria | 2759 |
| 99 | Ga0075428_100049121 | 3300006844 | Bacteria | 4629 |
| 100 | Ga0075431_100000872 | 3300006847 | Bacteria | 26496 |
| 101 | Ga0075433_10661072 | 3300006852 | Bacteria | 916 |
| 102 | Ga0075434_100144235 | 3300006871 | Bacteria | 2401 |
| 103 | Ga0068865_100099651 | 3300006881 | Bacteria | 2125 |
| 104 | Ga0097620_100066366 | 3300006931 | Bacteria | 3643 |
| 105 | Ga0099822_1002166 | 3300006943 | Bacteria | 24178 |
| 106 | Ga0075435_100236269 | 3300007076 | Bacteria | 1553 |
| 107 | Ga0075435_100413901 | 3300007076 | Bacteria | 1160 |
| 108 | Ga0099795_10008327 | 3300007788 | Bacteria | 2951 |
| 109 | Ga0105245_10025354 | 3300009098 | Bacteria | 5215 |
| 110 | Ga0105245_10035550 | 3300009098 | Bacteria | 4422 |
| 111 | Ga0105247_10011726 | 3300009101 | Bacteria | 5272 |
| 112 | Ga0105247_10070919 | 3300009101 | Bacteria | 2178 |
| 113 | Ga0105247_10200515 | 3300009101 | Bacteria | 1340 |
| 114 | Ga0114129_10641816 | 3300009147 | Bacteria | 1371 |
| 115 | Ga0114129_11192931 | 3300009147 | Bacteria | 948 |
| 116 | Ga0105243_10130213 | 3300009148 | Bacteria | 2133 |
| 117 | Ga0105242_10016328 | 3300009176 | Bacteria | 5773 |
| 118 | Ga0105248_10154200 | 3300009177 | Bacteria | 2592 |
| 119 | Ga0105248_10566555 | 3300009177 | Bacteria | 1281 |
| 120 | Ga0105237_10305385 | 3300009545 | Bacteria | 1594 |
| 121 | Ga0105238_10061312 | 3300009551 | Bacteria | 3764 |
| 122 | Ga0105249_10032515 | 3300009553 | Bacteria | 4720 |
| 123 | Ga0105249_10102923 | 3300009553 | Bacteria | 2688 |
| 124 | Ga0105239_10024361 | 3300010375 | Bacteria | 6667 |
| 125 | Ga0105239_10068632 | 3300010375 | Bacteria | 3896 |
| 126 | Ga0105239_10117205 | 3300010375 | Bacteria | 2956 |
| 127 | Ga0105239_10199233 | 3300010375 | Bacteria | 2243 |
| 128 | Ga0157374_10058664 | 3300013296 | Bacteria | 3597 |
| 129 | Ga0157378_10057089 | 3300013297 | Bacteria | 3479 |
| 130 | Ga0157378_10119272 | 3300013297 | Bacteria | 2429 |
| 131 | Ga0157375_10404657 | 3300013308 | Bacteria | 1531 |
| 132 | Ga0157380_10268303 | 3300014326 | Bacteria | 1554 |
| 133 | Ga0157380_10285106 | 3300014326 | Bacteria | 1513 |
| 134 | Ga0157380_10556111 | 3300014326 | Bacteria | 1126 |
| 135 | Ga0157377_10044003 | 3300014745 | Bacteria | 2488 |
| 136 | Ga0157379_10166547 | 3300014968 | Bacteria | 1989 |
| 137 | Ga0163161_10229903 | 3300017792 | Bacteria | 1439 |
| 138 | Ga0213872_10126196 | 3300021361 | Bacteria | 1129 |
| 139 | Ga0213876_10018976 | 3300021384 | Bacteria | 3633 |
| 140 | Ga0213875_10000003 | 3300021388 | Bacteria | 719367 |
| 141 | Ga0213875_10002033 | 3300021388 | Bacteria | 12447 |
| 142 | Ga0213871_10004267 | 3300021441 | Bacteria | 2846 |
| 143 | Ga0213871_10019297 | 3300021441 | Bacteria | 1677 |
| 144 | Ga0209436_100007 | 3300025208 | Bacteria | 149841 |
| 145 | Ga0209673_1005611 | 3300025273 | Bacteria | 6269 |
| 146 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 147 | Ga0209130_1000934 | 3300025284 | Bacteria | 23359 |
| 148 | Ga0209130_1000945 | 3300025284 | Bacteria | 23096 |
| 149 | Ga0209025_1000215 | 3300025294 | Bacteria | 138335 |
| 150 | Ga0209564_1002242 | 3300025295 | Bacteria | 15926 |
| 151 | Ga0209758_1009318 | 3300025297 | Bacteria | 6130 |
| 152 | Ga0209758_1037139 | 3300025297 | Bacteria | 1887 |
| 153 | Ga0209256_1005394 | 3300025299 | Bacteria | 7394 |
| 154 | Ga0207426_1000045 | 3300025302 | Bacteria | 422847 |
| 155 | Ga0207426_1000301 | 3300025302 | Bacteria | 96798 |
| 156 | Ga0207426_1000860 | 3300025302 | Bacteria | 31819 |
| 157 | Ga0209257_1027994 | 3300025304 | Bacteria | 1863 |
| 158 | Ga0207692_10148134 | 3300025898 | Bacteria | 1342 |
| 159 | Ga0207710_10080122 | 3300025900 | Bacteria | 1514 |
| 160 | Ga0207688_10012610 | 3300025901 | Bacteria | 4600 |
| 161 | Ga0207645_10097021 | 3300025907 | Bacteria | 1899 |
| 162 | Ga0207645_10212424 | 3300025907 | Bacteria | 1275 |
| 163 | Ga0207643_10150968 | 3300025908 | Bacteria | 1393 |
| 164 | Ga0207705_10064077 | 3300025909 | Bacteria | 2656 |
| 165 | Ga0207684_10292205 | 3300025910 | Bacteria | 1405 |
| 166 | Ga0207660_10040819 | 3300025917 | Bacteria | 3250 |
| 167 | Ga0207657_10332870 | 3300025919 | Bacteria | 1199 |
| 168 | Ga0207649_10056615 | 3300025920 | Bacteria | 2449 |
| 169 | Ga0207649_10146756 | 3300025920 | Bacteria | 1620 |
| 170 | Ga0207681_10048649 | 3300025923 | Bacteria | 2863 |
| 171 | Ga0207694_10171026 | 3300025924 | Bacteria | 1759 |
| 172 | Ga0207694_10371886 | 3300025924 | Bacteria | 1185 |
| 173 | Ga0207687_10020485 | 3300025927 | Bacteria | 4387 |
| 174 | Ga0207687_10034456 | 3300025927 | Bacteria | 3438 |
| 175 | Ga0207690_10355491 | 3300025932 | Bacteria | 1159 |
| 176 | Ga0207706_10035606 | 3300025933 | Bacteria | 4425 |
| 177 | Ga0207706_10060267 | 3300025933 | Bacteria | 3342 |
| 178 | Ga0207669_10098501 | 3300025937 | Bacteria | 1925 |
| 179 | Ga0207704_10063069 | 3300025938 | Bacteria | 2308 |
| 180 | Ga0207691_10040143 | 3300025940 | Bacteria | 4326 |
| 181 | Ga0207691_10170618 | 3300025940 | Bacteria | 1905 |
| 182 | Ga0207689_10215185 | 3300025942 | Bacteria | 1588 |
| 183 | Ga0207661_10110085 | 3300025944 | Bacteria | 2328 |
| 184 | Ga0207679_10164737 | 3300025945 | Bacteria | 1819 |
| 185 | Ga0207712_10147002 | 3300025961 | Bacteria | 1816 |
| 186 | Ga0207668_10053351 | 3300025972 | Bacteria | 2801 |
| 187 | Ga0207668_10130154 | 3300025972 | Bacteria | 1920 |
| 188 | Ga0207668_10147809 | 3300025972 | Bacteria | 1815 |
| 189 | Ga0207668_10284458 | 3300025972 | Bacteria | 1357 |
| 190 | Ga0207703_10068200 | 3300026035 | Bacteria | 2930 |
| 191 | Ga0207703_10520984 | 3300026035 | Bacteria | 1118 |
| 192 | Ga0207703_10706878 | 3300026035 | Bacteria | 959 |
| 193 | Ga0207639_10499052 | 3300026041 | Bacteria | 1112 |
| 194 | Ga0207639_10651902 | 3300026041 | Bacteria | 974 |
| 195 | Ga0207678_10044910 | 3300026067 | Bacteria | 3821 |
| 196 | Ga0207678_10047174 | 3300026067 | Bacteria | 3726 |
| 197 | Ga0207678_10070966 | 3300026067 | Bacteria | 2986 |
| 198 | Ga0207678_10159021 | 3300026067 | Bacteria | 1929 |
| 199 | Ga0207678_10167246 | 3300026067 | Bacteria | 1878 |
| 200 | Ga0207678_10234713 | 3300026067 | Bacteria | 1570 |
| 201 | Ga0207708_10021294 | 3300026075 | Bacteria | 4889 |
| 202 | Ga0207702_10289974 | 3300026078 | Bacteria | 1550 |
| 203 | Ga0207702_10426509 | 3300026078 | Bacteria | 1283 |
| 204 | Ga0207648_10007491 | 3300026089 | Bacteria | 10723 |
| 205 | Ga0207674_10225745 | 3300026116 | Bacteria | 1821 |
| 206 | Ga0207675_100011623 | 3300026118 | Bacteria | 8231 |
| 207 | Ga0207683_10023490 | 3300026121 | Bacteria | 5305 |
| 208 | Ga0209179_1008463 | 3300027512 | Bacteria | 1735 |
| 209 | Ga0268266_10035685 | 3300028379 | Bacteria | 4229 |
| 210 | Ga0268266_10290839 | 3300028379 | Bacteria | 1521 |
| 211 | Ga0268265_10076736 | 3300028380 | Bacteria | 2622 |
| 212 | Ga0268265_10092348 | 3300028380 | Bacteria | 2422 |
| 213 | Ga0268265_10112759 | 3300028380 | Bacteria | 2223 |
| 214 | Ga0268265_10533373 | 3300028380 | Bacteria | 1111 |
| 215 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 216 | Ga0307517_10000139 | 3300028786 | Bacteria | 111985 |
| 217 | Ga0307515_10154721 | 3300028794 | Bacteria | 2374 |
| 218 | Ga0307515_10236335 | 3300028794 | Bacteria | 1608 |
| 219 | Ga0265338_10007116 | 3300028800 | Bacteria | 14011 |
| 220 | Ga0265330_10003776 | 3300031235 | Bacteria | 7817 |
| 221 | Ga0265332_10020782 | 3300031238 | Bacteria | 2900 |
| 222 | Ga0265328_10018918 | 3300031239 | Bacteria | 2650 |
| 223 | Ga0265325_10002588 | 3300031241 | Bacteria | 12133 |
| 224 | Ga0265340_10036339 | 3300031247 | Bacteria | 2442 |
| 225 | Ga0265339_10006110 | 3300031249 | Bacteria | 7947 |
| 226 | Ga0265331_10004867 | 3300031250 | Bacteria | 8268 |
| 227 | Ga0307513_10337460 | 3300031456 | Bacteria | 1259 |
| 228 | Ga0307509_10038026 | 3300031507 | Bacteria | 5254 |
| 229 | Ga0307509_10090209 | 3300031507 | Bacteria | 3141 |
| 230 | Ga0265313_10021170 | 3300031595 | Bacteria | 3563 |
| 231 | Ga0307508_10042362 | 3300031616 | Bacteria | 4084 |
| 232 | Ga0307508_10128427 | 3300031616 | Bacteria | 2138 |
| 233 | Ga0265342_10019343 | 3300031712 | Bacteria | 4391 |
| 234 | Ga0265342_10145457 | 3300031712 | Bacteria | 1320 |
| 235 | Ga0307516_10143629 | 3300031730 | Bacteria | 2153 |
| 236 | Ga0307413_10165434 | 3300031824 | Bacteria | 1559 |
| 237 | Ga0307507_10018492 | 3300033179 | Bacteria | 7918 |
| 238 | Ga0307510_10008205 | 3300033180 | Bacteria | 12438 |
| 239 | Ga0307510_10108156 | 3300033180 | Bacteria | 2536 |
| 240 | Ga0373926_0048273 | 3300035083 | Bacteria | 1531 |
| 241 | Ga0373923_0012720 | 3300035111 | Bacteria | 3120 |
| 242 | Ga0373953_0002925 | 3300035117 | Bacteria | 5220 |
| 243 | Ga0373954_0016363 | 3300035118 | Bacteria | 3318 |
| 244 | Ga0373954_0048524 | 3300035118 | Bacteria | 1989 |
| 245 | Ga0373956_0002706 | 3300035119 | Bacteria | 7174 |
| 246 | Ga0373957_0003773 | 3300035120 | Bacteria | 4537 |
| 247 | Ga0373955_0026253 | 3300035172 | Bacteria | 2998 |
| 248 | Ga0373955_0036192 | 3300035172 | Bacteria | 2618 |
| 249 | Ga0373924_0002474 | 3300035410 | Bacteria | 6210 |
| 250 | Ga0373924_0007926 | 3300035410 | Bacteria | 3844 |
| 251 | Ga0373935_0021315 | 3300035692 | Bacteria | 3966 |
| 252 | Ga0373935_0107367 | 3300035692 | Bacteria | 1848 |
| 253 | Ga0373927_0079135 | 3300035695 | Bacteria | 2129 |
| 254 | Ga0373927_0092207 | 3300035695 | Bacteria | 1968 |
| 255 | Ga0373933_0011908 | 3300035724 | Bacteria | 4802 |
| 256 | Ga0373947_0061629 | 3300035725 | Bacteria | 2280 |
| 257 | Ga0373937_0019213 | 3300036401 | Bacteria | 6117 |
| 258 | Ga0373937_0060138 | 3300036401 | Bacteria | 3491 |
| 259 | Ga0316582_0204169 | 3300036647 | Bacteria | 1349 |
| 260 | Ga0316584_0017283 | 3300036712 | Bacteria | 5182 |
| 261 | Ga0373925_0182371 | 3300037068 | Bacteria | 1662 |
| 262 | Ga0436364_0416519 | 3300037853 | Bacteria | 115750 |
| 263 | Ga0436364_0735894 | 3300037853 | Bacteria | 1400 |
| 264 | Ga0436364_0875435 | 3300037853 | Bacteria | 49936 |
| 265 | Ga0436364_1012512 | 3300037853 | Bacteria | 984 |
| 266 | Ga0436364_1077806 | 3300037853 | Bacteria | 2225 |
| 267 | Ga0436364_1314594 | 3300037853 | Bacteria | 1308 |
| 268 | Ga0400488_16929 | 3300038741 | Bacteria | 2834 |
| 269 | Ga0400483_124412 | 3300039062 | Bacteria | 5863 |
| 270 | Ga0400483_138863 | 3300039062 | Bacteria | 12841 |
| 271 | Ga0400483_227660 | 3300039062 | Bacteria | 13230 |
| 272 | Ga0400483_275483 | 3300039062 | Bacteria | 1194 |
| 273 | Ga0400483_285611 | 3300039062 | Bacteria | 2847 |
| 274 | Ga0436365_0241419 | 3300039437 | Bacteria | 1878 |
| 275 | Ga0436365_0762112 | 3300039437 | Bacteria | 3214 |
| 276 | Ga0436365_1762481 | 3300039437 | Bacteria | 2038 |
| 277 | Ga0436360_0326591 | 3300039438 | Bacteria | 4014 |
| 278 | Ga0436360_0994756 | 3300039438 | Bacteria | 898 |
| 279 | Ga0436360_1133014 | 3300039438 | Bacteria | 2203 |
| 280 | Ga0436361_0025217 | 3300039447 | Bacteria | 4148 |
| 281 | Ga0436361_0684437 | 3300039447 | Bacteria | 4824 |
| 282 | Ga0436361_0759151 | 3300039447 | Bacteria | 1505 |
| 283 | Ga0436363_0335493 | 3300039450 | Bacteria | 1668 |
| 284 | Ga0436363_1545047 | 3300039450 | Bacteria | 4016 |
| 285 | Ga0439465_0042058 | 3300041413 | Bacteria | 1480 |
| 286 | Ga0451800_0712582 | 3300041459 | Bacteria | 1043 |
| 287 | Ga0451802_0750801 | 3300041460 | Bacteria | 1031 |
| 288 | Ga0439431_0072103 | 3300041997 | Bacteria | 921 |
| 289 | Ga0466972_0127562 | 3300044658 | Bacteria | 1198 |
| 290 | Ga0466966_0058403 | 3300044684 | Bacteria | 2438 |
| 291 | Ga0466960_0182294 | 3300044901 | Bacteria | 1139 |
| 292 | Ga0466959_0075791 | 3300045049 | Bacteria | 2430 |
| 293 | Ga0451576_0002032 | 3300045051 | Bacteria | 31949 |
| 294 | Ga0495617_105295 | 3300046452 | Bacteria | 915 |
| 295 | Ga0495592_0032930 | 3300046454 | Bacteria | 3909 |
| 296 | Ga0495592_0044611 | 3300046454 | Bacteria | 3312 |
| 297 | Ga0495592_0187145 | 3300046454 | Bacteria | 1406 |
| 298 | Ga0495603_0005569 | 3300046455 | Bacteria | 7520 |
| 299 | Ga0495603_0013569 | 3300046455 | Bacteria | 4930 |
| 300 | Ga0495629_0006932 | 3300046459 | Bacteria | 8359 |
| 301 | Ga0495629_0026709 | 3300046459 | Bacteria | 4100 |
| 302 | Ga0495638_0008466 | 3300046460 | Bacteria | 7292 |
| 303 | Ga0495638_0098983 | 3300046460 | Bacteria | 1746 |
| 304 | Ga0495641_0007231 | 3300046461 | Bacteria | 6983 |
| 305 | Ga0495651_0154486 | 3300046462 | Bacteria | 1650 |
| 306 | Ga0495653_0006024 | 3300046463 | Bacteria | 9932 |
| 307 | Ga0495580_0064128 | 3300046472 | Bacteria | 2576 |
| 308 | Ga0495605_0071012 | 3300046474 | Bacteria | 1645 |
| 309 | Ga0495639_0001090 | 3300046475 | Bacteria | 12231 |
| 310 | Ga0495662_0003031 | 3300046476 | Bacteria | 8476 |
| 311 | Ga0495664_0024431 | 3300046477 | Bacteria | 3513 |
| 312 | Ga0495585_0057182 | 3300046492 | Bacteria | 2153 |
| 313 | Ga0495594_0012745 | 3300046499 | Bacteria | 4386 |
| 314 | Ga0495608_0023285 | 3300046511 | Bacteria | 4246 |
| 315 | Ga0495608_0028573 | 3300046511 | Bacteria | 3789 |
| 316 | Ga0495616_0080626 | 3300046513 | Bacteria | 1558 |
| 317 | Ga0495628_0051667 | 3300046516 | Bacteria | 3249 |
| 318 | Ga0495630_0041576 | 3300046517 | Bacteria | 3433 |
| 319 | Ga0495632_0144831 | 3300046519 | Bacteria | 1100 |
| 320 | Ga0495643_0008427 | 3300046522 | Bacteria | 6525 |
| 321 | Ga0495644_0025750 | 3300046523 | Bacteria | 2232 |
| 322 | Ga0495648_0011298 | 3300046524 | Bacteria | 6737 |
| 323 | Ga0495652_0114560 | 3300046529 | Bacteria | 2162 |
| 324 | Ga0495640_0008246 | 3300046533 | Bacteria | 8177 |
| 325 | Ga0495640_0021688 | 3300046533 | Bacteria | 4708 |
| 326 | Ga0495640_0114897 | 3300046533 | Bacteria | 1755 |
| 327 | Ga0495640_0379236 | 3300046533 | Bacteria | 870 |
| 328 | Ga0495587_0019828 | 3300046536 | Bacteria | 4157 |
| 329 | Ga0495587_0034503 | 3300046536 | Bacteria | 3051 |
| 330 | Ga0495645_0026110 | 3300046543 | Bacteria | 4239 |
| 331 | Ga0495622_0012388 | 3300046557 | Bacteria | 3948 |
| 332 | Ga0495622_0043211 | 3300046557 | Bacteria | 2096 |
| 333 | Ga0495667_0004548 | 3300046559 | Bacteria | 9365 |
| 334 | Ga0495667_0016130 | 3300046559 | Bacteria | 5048 |
| 335 | Ga0495667_0271774 | 3300046559 | Bacteria | 1077 |
| 336 | Ga0495668_0131731 | 3300046616 | Bacteria | 1368 |
| 337 | Ga0495634_0055281 | 3300046642 | Bacteria | 2654 |
| 338 | Ga0495625_0243310 | 3300046660 | Bacteria | 1170 |
| 339 | Ga0495635_0011805 | 3300046663 | Bacteria | 6125 |
| 340 | Ga0495635_0021577 | 3300046663 | Bacteria | 4488 |
| 341 | Ga0495588_0043630 | 3300046674 | Bacteria | 2295 |
| 342 | Ga0495657_0010590 | 3300046675 | Bacteria | 6929 |
| 343 | Ga0495623_0036244 | 3300046679 | Bacteria | 3160 |
| 344 | Ga0495646_0006104 | 3300046680 | Bacteria | 7639 |
| 345 | Ga0495647_0037285 | 3300046681 | Bacteria | 1834 |
| 346 | Ga0495658_0017308 | 3300046683 | Bacteria | 3722 |
| 347 | Ga0495669_0002077 | 3300046684 | Bacteria | 8198 |
| 348 | Ga0495669_0044430 | 3300046684 | Bacteria | 1979 |
| 349 | Ga0495613_0041726 | 3300046689 | Bacteria | 3397 |
| 350 | Ga0495613_0089425 | 3300046689 | Bacteria | 2231 |
| 351 | Ga0495649_0077511 | 3300046694 | Bacteria | 1779 |
| 352 | Ga0495600_0008516 | 3300046809 | Bacteria | 6304 |
| 353 | Ga0495581_0053082 | 3300047315 | Bacteria | 2341 |
| 354 | Ga0495604_0058403 | 3300047317 | Bacteria | 2962 |
| 355 | Ga0495636_0163270 | 3300047318 | Bacteria | 1004 |
| 356 | Ga0495674_0019734 | 3300047319 | Bacteria | 6252 |
| 357 | Ga0495680_0029385 | 3300047322 | Bacteria | 4501 |
| 358 | Ga0495680_0157605 | 3300047322 | Bacteria | 1650 |
| 359 | Ga0495675_0035602 | 3300047444 | Bacteria | 3178 |
| 360 | Ga0495675_0035829 | 3300047444 | Bacteria | 3168 |
| 361 | Ga0495685_064558 | 3300047447 | Bacteria | 1231 |
| 362 | Ga0495684_0008792 | 3300047471 | Bacteria | 7805 |
| 363 | Ga0495686_0118714 | 3300047472 | Bacteria | 1579 |
| 364 | Ga0495686_0143592 | 3300047472 | Bacteria | 1407 |
| 365 | Ga0495593_0003242 | 3300047673 | Bacteria | 9755 |
| 366 | Ga0495593_0007020 | 3300047673 | Bacteria | 6603 |
| 367 | Ga0495602_0094867 | 3300048088 | Bacteria | 2464 |
| 368 | Ga0496100_0007844 | 3300048903 | Bacteria | 5925 |
| 369 | Ga0496100_0305958 | 3300048903 | Bacteria | 1191 |
| 370 | Ga0496101_0030678 | 3300048904 | Bacteria | 3772 |
| 371 | Ga0496102_0001499 | 3300048905 | Bacteria | 20618 |
| 372 | Ga0496102_0193281 | 3300048905 | Bacteria | 1918 |
| 373 | Ga0496102_0349946 | 3300048905 | Bacteria | 1391 |
| 374 | Ga0496103_0056075 | 3300048906 | Bacteria | 2445 |
| 375 | Ga0496103_0070295 | 3300048906 | Bacteria | 2190 |
| 376 | Ga0496104_0006502 | 3300048907 | Bacteria | 10279 |
| 377 | Ga0496105_0169607 | 3300048908 | Bacteria | 1789 |
| 378 | Ga0496105_0419450 | 3300048908 | Bacteria | 1060 |
| 379 | Ga0496106_0000237 | 3300048909 | Bacteria | 38613 |
| 380 | Ga0496106_0075960 | 3300048909 | Bacteria | 2574 |
| 381 | Ga0496107_0009222 | 3300048910 | Bacteria | 6838 |
| 382 | Ga0496108_0121296 | 3300048911 | Bacteria | 2242 |
| 383 | Ga0496109_0022302 | 3300048912 | Bacteria | 5607 |
| 384 | Ga0496109_0426141 | 3300048912 | Bacteria | 1253 |
| 385 | Ga0496110_0053680 | 3300048913 | Bacteria | 3544 |
| 386 | Ga0496111_0150825 | 3300048914 | Bacteria | 1724 |
| 387 | Ga0496112_0159973 | 3300048915 | Bacteria | 2218 |
| 388 | Ga0496113_0131858 | 3300048916 | Bacteria | 1962 |
| 389 | Ga0496114_0005644 | 3300048917 | Bacteria | 9812 |
| 390 | Ga0496115_0013014 | 3300048918 | Bacteria | 6280 |
| 391 | Ga0496117_0032123 | 3300048920 | Bacteria | 3994 |
| 392 | Ga0496118_0063618 | 3300048921 | Bacteria | 2713 |
| 393 | Ga0496118_0078833 | 3300048921 | Bacteria | 2328 |
| 394 | Ga0496121_0000923 | 3300048924 | Bacteria | 53102 |
| 395 | Ga0496121_0005996 | 3300048924 | Bacteria | 15351 |
| 396 | Ga0496121_0007289 | 3300048924 | Bacteria | 13381 |
| 397 | Ga0496121_0009595 | 3300048924 | Bacteria | 11088 |
| 398 | Ga0496121_0071432 | 3300048924 | Bacteria | 2791 |
| 399 | Ga0496121_0155388 | 3300048924 | Bacteria | 1679 |
| 400 | Ga0496121_0175111 | 3300048924 | Bacteria | 1554 |
| 401 | Ga0496121_0197196 | 3300048924 | Bacteria | 1438 |
| 402 | Ga0496121_0297450 | 3300048924 | Bacteria | 1097 |
| 403 | Ga0496122_0042325 | 3300048925 | Bacteria | 3585 |
| 404 | Ga0496122_0092410 | 3300048925 | Bacteria | 2057 |
| 405 | Ga0496123_0124647 | 3300048926 | Bacteria | 1440 |
| 406 | Ga0496124_0039178 | 3300048927 | Bacteria | 4110 |
| 407 | Ga0496124_0081547 | 3300048927 | Bacteria | 2658 |
| 408 | Ga0496124_0106131 | 3300048927 | Bacteria | 2268 |
| 409 | Ga0496124_0109872 | 3300048927 | Bacteria | 2221 |
| 410 | Ga0496125_0000314 | 3300048928 | Bacteria | 95420 |
| 411 | Ga0496125_0000446 | 3300048928 | Bacteria | 75321 |
| 412 | Ga0496125_0008194 | 3300048928 | Bacteria | 10996 |
| 413 | Ga0496125_0083913 | 3300048928 | Bacteria | 2421 |
| 414 | Ga0496125_0108015 | 3300048928 | Bacteria | 2026 |
| 415 | Ga0496125_0209034 | 3300048928 | Bacteria | 1269 |
| 416 | Ga0496125_0235869 | 3300048928 | Bacteria | 1165 |
| 417 | Ga0496126_0008116 | 3300048929 | Bacteria | 11369 |
| 418 | Ga0496126_0036184 | 3300048929 | Bacteria | 4618 |
| 419 | Ga0496126_0269269 | 3300048929 | Bacteria | 1414 |
| 420 | Ga0501031_0179009 | 3300049568 | Bacteria | 1385 |
| 421 | Ga0501032_0045722 | 3300049569 | Bacteria | 2960 |
| 422 | Ga0501034_0129011 | 3300049571 | Bacteria | 2512 |
| 423 | Ga0501036_0053356 | 3300049572 | Bacteria | 3424 |
| 424 | Ga0501036_0188587 | 3300049572 | Bacteria | 1735 |
| 425 | Ga0501038_0084628 | 3300049574 | Bacteria | 2668 |
| 426 | Ga0501038_0228026 | 3300049574 | Bacteria | 1484 |
| 427 | Ga0501047_0119485 | 3300049581 | Bacteria | 2518 |
| 428 | Ga0501047_0171396 | 3300049581 | Bacteria | 2039 |
| 429 | Ga0501068_0020701 | 3300049584 | Bacteria | 3837 |
| 430 | Ga0501074_0508805 | 3300049590 | Bacteria | 853 |
| 431 | Ga0501076_0213047 | 3300049592 | Bacteria | 1579 |
| 432 | Ga0501077_0118808 | 3300049593 | Bacteria | 1675 |
| 433 | Ga0501080_0084231 | 3300049742 | Bacteria | 2954 |
| 434 | Ga0501083_0068826 | 3300049744 | Bacteria | 2355 |
| 435 | Ga0501035_0091564 | 3300049822 | Bacteria | 2676 |
| 436 | nmdc:mga03683_54797_c1 | 3300050489 | Bacteria | 1673 |
| 437 | nmdc:mga03683_85804_c1 | 3300050489 | Bacteria | 1366 |
| 438 | nmdc:mga00v17_258703_c1 | 3300050491 | Bacteria | 1129 |
| 439 | nmdc:mga00v17_50733_c1 | 3300050491 | Bacteria | 2522 |
| 440 | nmdc:mga0yw44_155838_c1 | 3300050492 | Bacteria | 1493 |
| 441 | nmdc:mga0k408_130384_c1 | 3300050493 | Bacteria | 1492 |
| 442 | nmdc:mga0k408_85242_c1 | 3300050493 | Bacteria | 1854 |
| 443 | nmdc:mga06z11_156212_c1 | 3300050494 | Bacteria | 1301 |
| 444 | nmdc:mga07m45_63823_c1 | 3300050496 | Bacteria | 2089 |
| 445 | nmdc:mga05p37_62949_c1 | 3300050507 | Bacteria | 4565 |
| 446 | nmdc:mga09592_62539_c1 | 3300050508 | Bacteria | 3150 |
| 447 | nmdc:mga0qj67_91630_c1 | 3300050509 | Bacteria | 2443 |
| 448 | nmdc:mga06r32_1263_c1 | 3300050510 | Bacteria | 22731 |
| 449 | nmdc:mga08y16_290882_c1 | 3300050511 | Bacteria | 1684 |
| 450 | nmdc:mga0n895_141321_c1 | 3300050512 | Bacteria | 2436 |
| 451 | nmdc:mga0rr50_101826_c1 | 3300050513 | Bacteria | 2258 |
| 452 | nmdc:mga0rr50_37652_c1 | 3300050513 | Bacteria | 3494 |
| 453 | nmdc:mga0sz30_15225_c1 | 3300050516 | Bacteria | 3038 |
| 454 | Ga0495601_0030446 | 3300053077 | Bacteria | 3351 |
| 455 | Ga0495601_0300616 | 3300053077 | Bacteria | 1045 |
| 456 | Ga0500635_0016194 | 3300053080 | Bacteria | 2213 |
| 457 | Ga0495655_0018320 | 3300053083 | Bacteria | 1537 |
| 458 | Ga0495619_0005109 | 3300053085 | Bacteria | 8331 |
| 459 | Ga0495619_0010563 | 3300053085 | Bacteria | 5810 |
| 460 | Ga0500643_033237 | 3300053087 | Bacteria | 1561 |
| 461 | Ga0500643_043358 | 3300053087 | Bacteria | 1312 |
| 462 | Ga0500651_0002542 | 3300053093 | Bacteria | 9673 |
| 463 | Ga0500651_0046289 | 3300053093 | Bacteria | 2736 |
| 464 | Ga0500566_0000929 | 3300053094 | Bacteria | 16757 |
| 465 | Ga0500641_0020884 | 3300053096 | Bacteria | 2489 |
| 466 | Ga0500641_0122672 | 3300053096 | Bacteria | 1120 |
| 467 | Ga0500554_043556 | 3300053102 | Bacteria | 1387 |
| 468 | Ga0500572_000432 | 3300053111 | Bacteria | 14752 |
| 469 | Ga0500595_001913 | 3300053119 | Bacteria | 10731 |
| 470 | Ga0500595_002769 | 3300053119 | Bacteria | 8442 |
| 471 | Ga0500595_002988 | 3300053119 | Bacteria | 8040 |
| 472 | Ga0500595_021879 | 3300053119 | Bacteria | 2275 |
| 473 | Ga0500595_026652 | 3300053119 | Bacteria | 1989 |
| 474 | Ga0500642_0053511 | 3300053130 | Bacteria | 1790 |
| 475 | Ga0500642_0117090 | 3300053130 | Bacteria | 1245 |
| 476 | Ga0500559_0000381 | 3300053136 | Bacteria | 32402 |
| 477 | Ga0500559_0066734 | 3300053136 | Bacteria | 1614 |
| 478 | Ga0500568_0003894 | 3300053139 | Bacteria | 8127 |
| 479 | Ga0500577_0000350 | 3300053142 | Bacteria | 11834 |
| 480 | Ga0500590_042268 | 3300053148 | Bacteria | 2341 |
| 481 | Ga0500603_027384 | 3300053150 | Bacteria | 1448 |
| 482 | Ga0500616_0000333 | 3300053153 | Bacteria | 67555 |
| 483 | Ga0500622_0000134 | 3300053156 | Bacteria | 78418 |
| 484 | Ga0500622_0048554 | 3300053156 | Bacteria | 2190 |
| 485 | Ga0500633_0004366 | 3300053160 | Bacteria | 3232 |
| 486 | Ga0500638_018535 | 3300053162 | Bacteria | 3248 |
| 487 | Ga0500639_014110 | 3300053163 | Bacteria | 4202 |
| 488 | Ga0500639_179895 | 3300053163 | Bacteria | 936 |
| 489 | Ga0500636_0043127 | 3300053177 | Bacteria | 2664 |
| 490 | Ga0500636_0087291 | 3300053177 | Bacteria | 1790 |
| 491 | Ga0500636_0154126 | 3300053177 | Bacteria | 1259 |
| 492 | Ga0500637_0042512 | 3300053178 | Bacteria | 2569 |
| 493 | Ga0500637_0069319 | 3300053178 | Bacteria | 2027 |
| 494 | Ga0500611_009623 | 3300053727 | Bacteria | 1539 |
| 495 | Ga0500596_003159 | 3300053735 | Bacteria | 3163 |
| 496 | Ga0500661_000488 | 3300055283 | Bacteria | 7345 |
| 497 | Ga0501082_0205500 | 3300060353 | Bacteria | 1713 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035724 | Ga0373933_0011908 | Ga0373933_0011908_1776_2468 | 217 |
| 2 | 3300006175 | Ga0070712_100246052 | Ga0070712_1002460522 | 233 |
| 3 | 3300025898 | Ga0207692_10148134 | Ga0207692_101481342 | 233 |
| 4 | 3300028800 | Ga0265338_10007116 | Ga0265338_100071165 | 236 |
| 5 | 3300049581 | Ga0501047_0119485 | Ga0501047_0119485_1733_2470 | 240 |
| 6 | 3300049590 | Ga0501074_0508805 | Ga0501074_0508805_45_776 | 240 |
| 7 | 3300060353 | Ga0501082_0205500 | Ga0501082_0205500_28_765 | 240 |
| 8 | 3300009147 | Ga0114129_11192931 | Ga0114129_111929311 | 241 |
| 9 | 3300007076 | Ga0075435_100236269 | Ga0075435_1002362691 | 242 |
| 10 | 3300050513 | nmdc:mga0rr50_37652_c1 | nmdc:mga0rr50_37652_c1_640_1437 | 242 |
| 11 | 3300033180 | Ga0307510_10108156 | Ga0307510_101081562 | 244 |
| 12 | 3300035117 | Ga0373953_0002925 | Ga0373953_0002925_1134_1919 | 245 |
| 13 | 3300035118 | Ga0373954_0048524 | Ga0373954_0048524_50_835 | 245 |
| 14 | 3300035172 | Ga0373955_0036192 | Ga0373955_0036192_1193_1978 | 245 |
| 15 | 3300035410 | Ga0373924_0002474 | Ga0373924_0002474_1700_2485 | 245 |
| 16 | 3300035692 | Ga0373935_0107367 | Ga0373935_0107367_874_1659 | 245 |
| 17 | 3300035695 | Ga0373927_0092207 | Ga0373927_0092207_1014_1799 | 245 |
| 18 | 3300036401 | Ga0373937_0060138 | Ga0373937_0060138_2671_3456 | 245 |
| 19 | 3300046511 | Ga0495608_0023285 | Ga0495608_0023285_504_1289 | 245 |
| 20 | 3300046533 | Ga0495640_0114897 | Ga0495640_0114897_183_968 | 245 |
| 21 | 3300046536 | Ga0495587_0034503 | Ga0495587_0034503_133_918 | 245 |
| 22 | 3300046559 | Ga0495667_0016130 | Ga0495667_0016130_3391_4176 | 245 |
| 23 | 3300047322 | Ga0495680_0029385 | Ga0495680_0029385_1588_2373 | 245 |
| 24 | 3300047444 | Ga0495675_0035829 | Ga0495675_0035829_1770_2555 | 245 |
| 25 | 3300053077 | Ga0495601_0300616 | Ga0495601_0300616_36_821 | 245 |
| 26 | 3300053085 | Ga0495619_0010563 | Ga0495619_0010563_1534_2319 | 245 |
| 27 | 3300003354 | JGI25160J50197_1003605 | JGI25160J50197_10036055 | 249 |
| 28 | 3300037853 | Ga0436364_1012512 | Ga0436364_1012512_79_837 | 250 |
| 29 | 3300048913 | Ga0496110_0053680 | Ga0496110_0053680_2512_3327 | 250 |
| 30 | 3300048927 | Ga0496124_0081547 | Ga0496124_0081547_1175_1990 | 250 |
| 31 | 3300048928 | Ga0496125_0000314 | Ga0496125_0000314_59616_60431 | 250 |
| 32 | 3300053111 | Ga0500572_000432 | Ga0500572_000432_5284_6042 | 250 |
| 33 | 3300053136 | Ga0500559_0000381 | Ga0500559_0000381_767_1525 | 250 |
| 34 | 3300053163 | Ga0500639_014110 | Ga0500639_014110_3338_4096 | 250 |
| 35 | 3300053735 | Ga0500596_003159 | Ga0500596_003159_2324_3082 | 250 |
| 36 | 3300044901 | Ga0466960_0182294 | Ga0466960_0182294_32_826 | 251 |
| 37 | 3300003203 | JGI25406J46586_10010195 | JGI25406J46586_100101952 | 253 |
| 38 | 3300005985 | Ga0081539_10010306 | Ga0081539_100103062 | 253 |
| 39 | iso_pu_bacteria | 8019586578 | 8019596048 | 253 |
| 40 | 3300053177 | Ga0500636_0043127 | Ga0500636_0043127_1677_2492 | 254 |
| 41 | 3300041997 | Ga0439431_0072103 | Ga0439431_0072103_26_793 | 255 |
| 42 | 3300048925 | Ga0496122_0042325 | Ga0496122_0042325_21_806 | 256 |
| 43 | iso_pu_bacteria | 2687453129 | 2687578224 | 259 |
| 44 | 3300036647 | Ga0316582_0204169 | Ga0316582_0204169_182_988 | 260 |
| 45 | 3300036712 | Ga0316584_0017283 | Ga0316584_0017283_849_1655 | 260 |
| 46 | 3300039062 | Ga0400483_124412 | Ga0400483_124412_444_1241 | 261 |
| 47 | 3300039062 | Ga0400483_138863 | Ga0400483_138863_6230_7027 | 261 |
| 48 | 3300039062 | Ga0400483_227660 | Ga0400483_227660_701_1498 | 261 |
| 49 | 3300039062 | Ga0400483_285611 | Ga0400483_285611_586_1383 | 261 |
| 50 | 3300039437 | Ga0436365_0241419 | Ga0436365_0241419_979_1773 | 262 |
| 51 | 3300039450 | Ga0436363_0335493 | Ga0436363_0335493_744_1547 | 262 |
| 52 | 3300006847 | Ga0075431_100000872 | Ga0075431_10000087226 | 263 |
| 53 | 3300050508 | nmdc:mga09592_62539_c1 | nmdc:mga09592_62539_c1_41_859 | 263 |
| 54 | 3300050509 | nmdc:mga0qj67_91630_c1 | nmdc:mga0qj67_91630_c1_1604_2422 | 263 |
| 55 | 3300050510 | nmdc:mga06r32_1263_c1 | nmdc:mga06r32_1263_c1_9746_10564 | 263 |
| 56 | 3300021384 | Ga0213876_10018976 | Ga0213876_100189762 | 264 |
| 57 | 3300021388 | Ga0213875_10000003 | Ga0213875_1000000396 | 264 |
| 58 | 3300037853 | Ga0436364_0875435 | Ga0436364_0875435_21153_21965 | 264 |
| 59 | 3300039437 | Ga0436365_0762112 | Ga0436365_0762112_1907_2719 | 264 |
| 60 | iso_pu_bacteria | 2510917026 | 2511172769 | 264 |
| 61 | iso_pu_bacteria | 2821443989 | 2821444457 | 264 |
| 62 | iso_pu_bacteria | 2844533157 | 2844536529 | 264 |
| 63 | iso_pu_bacteria | 2889790730 | 2889791326 | 264 |
| 64 | iso_pu_bacteria | 2889914905 | 2889920371 | 264 |
| 65 | iso_pu_bacteria | 2919171160 | 2919173875 | 264 |
| 66 | iso_pu_bacteria | 2922361189 | 2922362550 | 264 |
| 67 | iso_pu_bacteria | 3005409236 | 3005413978 | 264 |
| 68 | 3300031456 | Ga0307513_10337460 | Ga0307513_103374602 | 265 |
| 69 | 3300039447 | Ga0436361_0684437 | Ga0436361_0684437_3605_4402 | 265 |
| 70 | 3300049592 | Ga0501076_0213047 | Ga0501076_0213047_718_1530 | 265 |
| 71 | 3300049593 | Ga0501077_0118808 | Ga0501077_0118808_143_955 | 265 |
| 72 | iso_pu_bacteria | 2513237104 | 2513714776 | 265 |
| 73 | iso_pu_bacteria | 2876761206 | 2876765903 | 265 |
| 74 | iso_pu_bacteria | 641522639 | 641643114 | 265 |
| 75 | iso_pu_bacteria | 8016539877 | 8016543441 | 265 |
| 76 | iso_pu_bacteria | 8016557553 | 8016558266 | 265 |
| 77 | iso_pu_bacteria | 8016566248 | 8016568842 | 265 |
| 78 | iso_pu_bacteria | 8016575299 | 8016581489 | 265 |
| 79 | iso_pu_bacteria | 8016595262 | 8016596263 | 265 |
| 80 | iso_pu_bacteria | 8016603502 | 8016607173 | 265 |
| 81 | iso_pu_bacteria | 8019530166 | 8019538824 | 265 |
| 82 | 3300002987 | JGI25159J45721_1009163 | JGI25159J45721_10091632 | 266 |
| 83 | 3300003187 | JGI25151J46595_10002045 | JGI25151J46595_100020454 | 266 |
| 84 | 3300003354 | JGI25160J50197_1019666 | JGI25160J50197_10196662 | 266 |
| 85 | 3300005539 | Ga0068853_100165547 | Ga0068853_1001655471 | 266 |
| 86 | 3300010375 | Ga0105239_10199233 | Ga0105239_101992333 | 266 |
| 87 | 3300025284 | Ga0209130_1000945 | Ga0209130_100094523 | 266 |
| 88 | 3300025294 | Ga0209025_1000215 | Ga0209025_1000215109 | 266 |
| 89 | 3300025297 | Ga0209758_1009318 | Ga0209758_10093184 | 266 |
| 90 | 3300025302 | Ga0207426_1000860 | Ga0207426_10008604 | 266 |
| 91 | 3300039438 | Ga0436360_0994756 | Ga0436360_0994756_75_875 | 266 |
| 92 | 3300039450 | Ga0436363_1545047 | Ga0436363_1545047_2845_3651 | 266 |
| 93 | 3300045051 | Ga0451576_0002032 | Ga0451576_0002032_16770_17582 | 266 |
| 94 | iso_pu_bacteria | 2508501128 | 2509152068 | 266 |
| 95 | iso_pu_bacteria | 2513237141 | 2513888256 | 266 |
| 96 | iso_pu_bacteria | 2751185800 | 2753359436 | 266 |
| 97 | iso_pu_bacteria | 2854911287 | 2854911939 | 266 |
| 98 | iso_pu_bacteria | 643348564 | 643601853 | 266 |
| 99 | 3300005841 | Ga0068863_100229587 | Ga0068863_1002295872 | 267 |
| 100 | 3300005843 | Ga0068860_100000401 | Ga0068860_10000040136 | 267 |
| 101 | 3300021361 | Ga0213872_10126196 | Ga0213872_101261962 | 267 |
| 102 | 3300021388 | Ga0213875_10002033 | Ga0213875_100020332 | 267 |
| 103 | 3300026035 | Ga0207703_10706878 | Ga0207703_107068782 | 267 |
| 104 | 3300028381 | Ga0268264_10000020 | Ga0268264_10000020230 | 267 |
| 105 | 3300031507 | Ga0307509_10090209 | Ga0307509_100902094 | 267 |
| 106 | 3300037853 | Ga0436364_0416519 | Ga0436364_0416519_12092_12901 | 267 |
| 107 | 3300039447 | Ga0436361_0759151 | Ga0436361_0759151_33_842 | 267 |
| 108 | 3300048924 | Ga0496121_0297450 | Ga0496121_0297450_232_1035 | 267 |
| 109 | iso_pu_bacteria | 2513237101 | 2513697953 | 267 |
| 110 | iso_pu_bacteria | 2667528175 | 2671120129 | 267 |
| 111 | iso_pu_bacteria | 2721755755 | 2723846859 | 267 |
| 112 | iso_pu_bacteria | 2791355197 | 2793066309 | 267 |
| 113 | iso_pu_bacteria | 2874604998 | 2874611181 | 267 |
| 114 | iso_pu_bacteria | 2876808645 | 2876810548 | 267 |
| 115 | iso_pu_bacteria | 2879110137 | 2879114406 | 267 |
| 116 | iso_pu_bacteria | 2889033259 | 2889038345 | 267 |
| 117 | iso_pu_bacteria | 2903748898 | 2903752099 | 267 |
| 118 | iso_pu_bacteria | 2908756301 | 2908764672 | 267 |
| 119 | iso_pu_bacteria | 2922425934 | 2922431872 | 267 |
| 120 | iso_pu_bacteria | 8006984368 | 8006987507 | 267 |
| 121 | iso_pu_bacteria | 8006994254 | 8006995008 | 267 |
| 122 | 3300002739 | JGI25158J39367_1000165 | JGI25158J39367_100016513 | 268 |
| 123 | 3300002773 | JGI25152J39213_1001185 | JGI25152J39213_100118510 | 268 |
| 124 | 3300002987 | JGI25159J45721_1000586 | JGI25159J45721_10005863 | 268 |
| 125 | 3300003215 | JGI25153J46596_10001784 | JGI25153J46596_100017843 | 268 |
| 126 | 3300003374 | JGI25161J50226_1000093 | JGI25161J50226_100009341 | 268 |
| 127 | 3300003771 | Ga0055526_1013476 | Ga0055526_10134764 | 268 |
| 128 | 3300003790 | Ga0055528_1008093 | Ga0055528_10080936 | 268 |
| 129 | 3300003792 | Ga0055540_1008429 | Ga0055540_10084294 | 268 |
| 130 | 3300004625 | Ga0055543_1000264 | Ga0055543_100026421 | 268 |
| 131 | 3300005842 | Ga0068858_100332219 | Ga0068858_1003322191 | 268 |
| 132 | 3300005937 | Ga0081455_10000015 | Ga0081455_10000015124 | 268 |
| 133 | 3300005937 | Ga0081455_10005028 | Ga0081455_1000502810 | 268 |
| 134 | 3300009101 | Ga0105247_10011726 | Ga0105247_100117263 | 268 |
| 135 | 3300009551 | Ga0105238_10061312 | Ga0105238_100613123 | 268 |
| 136 | 3300010375 | Ga0105239_10024361 | Ga0105239_100243617 | 268 |
| 137 | 3300025208 | Ga0209436_100007 | Ga0209436_10000773 | 268 |
| 138 | 3300025273 | Ga0209673_1005611 | Ga0209673_10056115 | 268 |
| 139 | 3300025284 | Ga0209130_1000001 | Ga0209130_1000001697 | 268 |
| 140 | 3300025295 | Ga0209564_1002242 | Ga0209564_10022424 | 268 |
| 141 | 3300025297 | Ga0209758_1037139 | Ga0209758_10371392 | 268 |
| 142 | 3300025299 | Ga0209256_1005394 | Ga0209256_10053946 | 268 |
| 143 | 3300025302 | Ga0207426_1000045 | Ga0207426_1000045306 | 268 |
| 144 | 3300025304 | Ga0209257_1027994 | Ga0209257_10279942 | 268 |
| 145 | 3300025924 | Ga0207694_10171026 | Ga0207694_101710262 | 268 |
| 146 | 3300026035 | Ga0207703_10068200 | Ga0207703_100682003 | 268 |
| 147 | 3300026041 | Ga0207639_10499052 | Ga0207639_104990521 | 268 |
| 148 | 3300026078 | Ga0207702_10426509 | Ga0207702_104265091 | 268 |
| 149 | 3300037853 | Ga0436364_0735894 | Ga0436364_0735894_129_977 | 268 |
| 150 | 3300037853 | Ga0436364_1314594 | Ga0436364_1314594_216_1106 | 268 |
| 151 | 3300039437 | Ga0436365_1762481 | Ga0436365_1762481_930_1742 | 268 |
| 152 | 3300046522 | Ga0495643_0008427 | Ga0495643_0008427_3849_4670 | 268 |
| 153 | 3300048909 | Ga0496106_0000237 | Ga0496106_0000237_11648_12496 | 268 |
| 154 | 3300048924 | Ga0496121_0009595 | Ga0496121_0009595_9020_9841 | 268 |
| 155 | 3300048924 | Ga0496121_0155388 | Ga0496121_0155388_222_1028 | 268 |
| 156 | 3300048927 | Ga0496124_0109872 | Ga0496124_0109872_1044_1865 | 268 |
| 157 | 3300048928 | Ga0496125_0083913 | Ga0496125_0083913_1422_2231 | 268 |
| 158 | 3300048929 | Ga0496126_0269269 | Ga0496126_0269269_150_971 | 268 |
| 159 | 3300049568 | Ga0501031_0179009 | Ga0501031_0179009_89_910 | 268 |
| 160 | 3300049569 | Ga0501032_0045722 | Ga0501032_0045722_1350_2171 | 268 |
| 161 | 3300049571 | Ga0501034_0129011 | Ga0501034_0129011_1126_1941 | 268 |
| 162 | 3300049572 | Ga0501036_0053356 | Ga0501036_0053356_1574_2395 | 268 |
| 163 | 3300049574 | Ga0501038_0084628 | Ga0501038_0084628_1798_2613 | 268 |
| 164 | 3300049581 | Ga0501047_0171396 | Ga0501047_0171396_588_1403 | 268 |
| 165 | 3300049584 | Ga0501068_0020701 | Ga0501068_0020701_28_849 | 268 |
| 166 | 3300049742 | Ga0501080_0084231 | Ga0501080_0084231_1223_2038 | 268 |
| 167 | 3300049744 | Ga0501083_0068826 | Ga0501083_0068826_312_1133 | 268 |
| 168 | 3300049822 | Ga0501035_0091564 | Ga0501035_0091564_1713_2534 | 268 |
| 169 | 3300053093 | Ga0500651_0046289 | Ga0500651_0046289_353_1201 | 268 |
| 170 | 3300053139 | Ga0500568_0003894 | Ga0500568_0003894_4441_5289 | 268 |
| 171 | 3300053153 | Ga0500616_0000333 | Ga0500616_0000333_29597_30475 | 268 |
| 172 | 3300053156 | Ga0500622_0000134 | Ga0500622_0000134_42863_43684 | 268 |
| 173 | 3300053160 | Ga0500633_0004366 | Ga0500633_0004366_786_1634 | 268 |
| 174 | 3300005337 | Ga0070682_100118079 | Ga0070682_1001180792 | 269 |
| 175 | 3300005340 | Ga0070689_100231001 | Ga0070689_1002310012 | 269 |
| 176 | 3300005344 | Ga0070661_100260977 | Ga0070661_1002609772 | 269 |
| 177 | 3300005347 | Ga0070668_100126848 | Ga0070668_1001268481 | 269 |
| 178 | 3300005365 | Ga0070688_100464405 | Ga0070688_1004644051 | 269 |
| 179 | 3300005455 | Ga0070663_100056679 | Ga0070663_1000566793 | 269 |
| 180 | 3300005459 | Ga0068867_100677509 | Ga0068867_1006775091 | 269 |
| 181 | 3300005539 | Ga0068853_100166991 | Ga0068853_1001669912 | 269 |
| 182 | 3300005547 | Ga0070693_100065055 | Ga0070693_1000650552 | 269 |
| 183 | 3300005548 | Ga0070665_100133587 | Ga0070665_1001335872 | 269 |
| 184 | 3300005577 | Ga0068857_100158668 | Ga0068857_1001586681 | 269 |
| 185 | 3300005614 | Ga0068856_100573463 | Ga0068856_1005734632 | 269 |
| 186 | 3300005617 | Ga0068859_100066364 | Ga0068859_1000663643 | 269 |
| 187 | 3300005719 | Ga0068861_100102623 | Ga0068861_1001026232 | 269 |
| 188 | 3300005841 | Ga0068863_100380806 | Ga0068863_1003808062 | 269 |
| 189 | 3300005842 | Ga0068858_100110545 | Ga0068858_1001105453 | 269 |
| 190 | 3300005843 | Ga0068860_100634458 | Ga0068860_1006344582 | 269 |
| 191 | 3300005844 | Ga0068862_100150043 | Ga0068862_1001500432 | 269 |
| 192 | 3300005983 | Ga0081540_1005314 | Ga0081540_10053145 | 269 |
| 193 | 3300005985 | Ga0081539_10155618 | Ga0081539_101556182 | 269 |
| 194 | 3300006042 | Ga0075368_10054001 | Ga0075368_100540012 | 269 |
| 195 | 3300006173 | Ga0070716_100192733 | Ga0070716_1001927332 | 269 |
| 196 | 3300006237 | Ga0097621_100077484 | Ga0097621_1000774843 | 269 |
| 197 | 3300006871 | Ga0075434_100144235 | Ga0075434_1001442353 | 269 |
| 198 | 3300006931 | Ga0097620_100066366 | Ga0097620_1000663663 | 269 |
| 199 | 3300007076 | Ga0075435_100413901 | Ga0075435_1004139011 | 269 |
| 200 | 3300009098 | Ga0105245_10025354 | Ga0105245_100253543 | 269 |
| 201 | 3300009101 | Ga0105247_10200515 | Ga0105247_102005152 | 269 |
| 202 | 3300009545 | Ga0105237_10305385 | Ga0105237_103053852 | 269 |
| 203 | 3300013297 | Ga0157378_10119272 | Ga0157378_101192722 | 269 |
| 204 | 3300021441 | Ga0213871_10019297 | Ga0213871_100192972 | 269 |
| 205 | 3300025900 | Ga0207710_10080122 | Ga0207710_100801222 | 269 |
| 206 | 3300025919 | Ga0207657_10332870 | Ga0207657_103328702 | 269 |
| 207 | 3300025924 | Ga0207694_10371886 | Ga0207694_103718862 | 269 |
| 208 | 3300025927 | Ga0207687_10034456 | Ga0207687_100344562 | 269 |
| 209 | 3300025932 | Ga0207690_10355491 | Ga0207690_103554912 | 269 |
| 210 | 3300025933 | Ga0207706_10035606 | Ga0207706_100356062 | 269 |
| 211 | 3300025940 | Ga0207691_10170618 | Ga0207691_101706182 | 269 |
| 212 | 3300025942 | Ga0207689_10215185 | Ga0207689_102151852 | 269 |
| 213 | 3300025972 | Ga0207668_10053351 | Ga0207668_100533513 | 269 |
| 214 | 3300026041 | Ga0207639_10651902 | Ga0207639_106519021 | 269 |
| 215 | 3300026067 | Ga0207678_10070966 | Ga0207678_100709663 | 269 |
| 216 | 3300026067 | Ga0207678_10167246 | Ga0207678_101672461 | 269 |
| 217 | 3300031824 | Ga0307413_10165434 | Ga0307413_101654342 | 269 |
| 218 | 3300037853 | Ga0436364_1077806 | Ga0436364_1077806_293_1108 | 269 |
| 219 | 3300038741 | Ga0400488_16929 | Ga0400488_16929_1774_2595 | 269 |
| 220 | 3300039062 | Ga0400483_275483 | Ga0400483_275483_311_1141 | 269 |
| 221 | 3300039438 | Ga0436360_1133014 | Ga0436360_1133014_290_1099 | 269 |
| 222 | 3300039447 | Ga0436361_0025217 | Ga0436361_0025217_952_1761 | 269 |
| 223 | 3300041460 | Ga0451802_0750801 | Ga0451802_0750801_52_861 | 269 |
| 224 | 3300044658 | Ga0466972_0127562 | Ga0466972_0127562_187_996 | 269 |
| 225 | 3300048912 | Ga0496109_0426141 | Ga0496109_0426141_424_1233 | 269 |
| 226 | 3300048916 | Ga0496113_0131858 | Ga0496113_0131858_29_838 | 269 |
| 227 | 3300048928 | Ga0496125_0108015 | Ga0496125_0108015_407_1216 | 269 |
| 228 | 3300048928 | Ga0496125_0209034 | Ga0496125_0209034_229_1056 | 269 |
| 229 | 3300050494 | nmdc:mga06z11_156212_c1 | nmdc:mga06z11_156212_c1_42_851 | 269 |
| 230 | 3300050512 | nmdc:mga0n895_141321_c1 | nmdc:mga0n895_141321_c1_138_947 | 269 |
| 231 | 3300050513 | nmdc:mga0rr50_101826_c1 | nmdc:mga0rr50_101826_c1_673_1482 | 269 |
| 232 | 3300053087 | Ga0500643_033237 | Ga0500643_033237_248_1057 | 269 |
| 233 | 3300003354 | JGI25160J50197_1003824 | JGI25160J50197_10038246 | 270 |
| 234 | 3300003659 | JGI25404J52841_10007911 | JGI25404J52841_100079112 | 270 |
| 235 | 3300005467 | Ga0070706_100038662 | Ga0070706_1000386622 | 270 |
| 236 | 3300005468 | Ga0070707_100016013 | Ga0070707_1000160138 | 270 |
| 237 | 3300005471 | Ga0070698_100012359 | Ga0070698_1000123591 | 270 |
| 238 | 3300005536 | Ga0070697_100073676 | Ga0070697_1000736763 | 270 |
| 239 | 3300005536 | Ga0070697_100074879 | Ga0070697_1000748793 | 270 |
| 240 | 3300005548 | Ga0070665_100051780 | Ga0070665_1000517805 | 270 |
| 241 | 3300005577 | Ga0068857_100187409 | Ga0068857_1001874092 | 270 |
| 242 | 3300005937 | Ga0081455_10047487 | Ga0081455_100474872 | 270 |
| 243 | 3300005983 | Ga0081540_1009052 | Ga0081540_10090524 | 270 |
| 244 | 3300005985 | Ga0081539_10041328 | Ga0081539_100413282 | 270 |
| 245 | 3300006051 | Ga0075364_10062739 | Ga0075364_100627393 | 270 |
| 246 | 3300006177 | Ga0075362_10172308 | Ga0075362_101723081 | 270 |
| 247 | 3300021441 | Ga0213871_10004267 | Ga0213871_100042673 | 270 |
| 248 | 3300025284 | Ga0209130_1000934 | Ga0209130_100093413 | 270 |
| 249 | 3300025302 | Ga0207426_1000301 | Ga0207426_10003012 | 270 |
| 250 | 3300025920 | Ga0207649_10146756 | Ga0207649_101467562 | 270 |
| 251 | 3300026067 | Ga0207678_10047174 | Ga0207678_100471744 | 270 |
| 252 | 3300026116 | Ga0207674_10225745 | Ga0207674_102257452 | 270 |
| 253 | 3300031247 | Ga0265340_10036339 | Ga0265340_100363391 | 270 |
| 254 | 3300031249 | Ga0265339_10006110 | Ga0265339_100061108 | 270 |
| 255 | 3300039438 | Ga0436360_0326591 | Ga0436360_0326591_206_1021 | 270 |
| 256 | 3300041459 | Ga0451800_0712582 | Ga0451800_0712582_33_845 | 270 |
| 257 | 3300044684 | Ga0466966_0058403 | Ga0466966_0058403_926_1741 | 270 |
| 258 | 3300045049 | Ga0466959_0075791 | Ga0466959_0075791_211_1026 | 270 |
| 259 | 3300046524 | Ga0495648_0011298 | Ga0495648_0011298_2451_3263 | 270 |
| 260 | 3300048905 | Ga0496102_0193281 | Ga0496102_0193281_1074_1886 | 270 |
| 261 | 3300048924 | Ga0496121_0197196 | Ga0496121_0197196_62_907 | 270 |
| 262 | 3300048926 | Ga0496123_0124647 | Ga0496123_0124647_282_1127 | 270 |
| 263 | 3300048928 | Ga0496125_0235869 | Ga0496125_0235869_137_982 | 270 |
| 264 | 3300050489 | nmdc:mga03683_54797_c1 | nmdc:mga03683_54797_c1_802_1614 | 270 |
| 265 | 3300002244 | JGI24742J22300_10015033 | JGI24742J22300_100150332 | 271 |
| 266 | 3300005327 | Ga0070658_10323661 | Ga0070658_103236611 | 271 |
| 267 | 3300005328 | Ga0070676_10149543 | Ga0070676_101495431 | 271 |
| 268 | 3300005330 | Ga0070690_100194040 | Ga0070690_1001940401 | 271 |
| 269 | 3300005334 | Ga0068869_100285194 | Ga0068869_1002851942 | 271 |
| 270 | 3300005335 | Ga0070666_10174630 | Ga0070666_101746301 | 271 |
| 271 | 3300005347 | Ga0070668_100017995 | Ga0070668_1000179955 | 271 |
| 272 | 3300005347 | Ga0070668_100271518 | Ga0070668_1002715181 | 271 |
| 273 | 3300005353 | Ga0070669_100072150 | Ga0070669_1000721503 | 271 |
| 274 | 3300005356 | Ga0070674_100122867 | Ga0070674_1001228672 | 271 |
| 275 | 3300005365 | Ga0070688_100309718 | Ga0070688_1003097181 | 271 |
| 276 | 3300005440 | Ga0070705_100132224 | Ga0070705_1001322242 | 271 |
| 277 | 3300005455 | Ga0070663_100100032 | Ga0070663_1001000321 | 271 |
| 278 | 3300005455 | Ga0070663_100109666 | Ga0070663_1001096662 | 271 |
| 279 | 3300005455 | Ga0070663_100438994 | Ga0070663_1004389941 | 271 |
| 280 | 3300005456 | Ga0070678_100283632 | Ga0070678_1002836322 | 271 |
| 281 | 3300005457 | Ga0070662_100079000 | Ga0070662_1000790002 | 271 |
| 282 | 3300005458 | Ga0070681_10061529 | Ga0070681_100615293 | 271 |
| 283 | 3300005459 | Ga0068867_100033985 | Ga0068867_1000339853 | 271 |
| 284 | 3300005467 | Ga0070706_100028002 | Ga0070706_1000280025 | 271 |
| 285 | 3300005539 | Ga0068853_100162257 | Ga0068853_1001622573 | 271 |
| 286 | 3300005543 | Ga0070672_100127233 | Ga0070672_1001272332 | 271 |
| 287 | 3300005548 | Ga0070665_100063825 | Ga0070665_1000638254 | 271 |
| 288 | 3300005549 | Ga0070704_100171373 | Ga0070704_1001713732 | 271 |
| 289 | 3300005564 | Ga0070664_100361163 | Ga0070664_1003611632 | 271 |
| 290 | 3300005578 | Ga0068854_100284014 | Ga0068854_1002840142 | 271 |
| 291 | 3300005614 | Ga0068856_100419193 | Ga0068856_1004191932 | 271 |
| 292 | 3300005615 | Ga0070702_100047676 | Ga0070702_1000476762 | 271 |
| 293 | 3300005616 | Ga0068852_100475475 | Ga0068852_1004754752 | 271 |
| 294 | 3300005616 | Ga0068852_100634717 | Ga0068852_1006347171 | 271 |
| 295 | 3300005842 | Ga0068858_100322788 | Ga0068858_1003227882 | 271 |
| 296 | 3300005844 | Ga0068862_100187768 | Ga0068862_1001877682 | 271 |
| 297 | 3300005844 | Ga0068862_100242781 | Ga0068862_1002427813 | 271 |
| 298 | 3300005844 | Ga0068862_100468429 | Ga0068862_1004684292 | 271 |
| 299 | 3300005983 | Ga0081540_1007564 | Ga0081540_10075642 | 271 |
| 300 | 3300005983 | Ga0081540_1024041 | Ga0081540_10240413 | 271 |
| 301 | 3300006028 | Ga0070717_10002386 | Ga0070717_1000238618 | 271 |
| 302 | 3300006048 | Ga0075363_100017233 | Ga0075363_1000172333 | 271 |
| 303 | 3300006177 | Ga0075362_10079173 | Ga0075362_100791732 | 271 |
| 304 | 3300006844 | Ga0075428_100049121 | Ga0075428_1000491211 | 271 |
| 305 | 3300006852 | Ga0075433_10661072 | Ga0075433_106610721 | 271 |
| 306 | 3300006881 | Ga0068865_100099651 | Ga0068865_1000996512 | 271 |
| 307 | 3300006943 | Ga0099822_1002166 | Ga0099822_100216627 | 271 |
| 308 | 3300007788 | Ga0099795_10008327 | Ga0099795_100083272 | 271 |
| 309 | 3300009098 | Ga0105245_10035550 | Ga0105245_100355504 | 271 |
| 310 | 3300009101 | Ga0105247_10070919 | Ga0105247_100709192 | 271 |
| 311 | 3300009147 | Ga0114129_10641816 | Ga0114129_106418162 | 271 |
| 312 | 3300009148 | Ga0105243_10130213 | Ga0105243_101302132 | 271 |
| 313 | 3300009176 | Ga0105242_10016328 | Ga0105242_100163283 | 271 |
| 314 | 3300009177 | Ga0105248_10154200 | Ga0105248_101542001 | 271 |
| 315 | 3300009177 | Ga0105248_10566555 | Ga0105248_105665552 | 271 |
| 316 | 3300009553 | Ga0105249_10032515 | Ga0105249_100325153 | 271 |
| 317 | 3300009553 | Ga0105249_10102923 | Ga0105249_101029233 | 271 |
| 318 | 3300010375 | Ga0105239_10068632 | Ga0105239_100686324 | 271 |
| 319 | 3300010375 | Ga0105239_10117205 | Ga0105239_101172053 | 271 |
| 320 | 3300013296 | Ga0157374_10058664 | Ga0157374_100586642 | 271 |
| 321 | 3300013297 | Ga0157378_10057089 | Ga0157378_100570893 | 271 |
| 322 | 3300013308 | Ga0157375_10404657 | Ga0157375_104046572 | 271 |
| 323 | 3300014326 | Ga0157380_10268303 | Ga0157380_102683032 | 271 |
| 324 | 3300014326 | Ga0157380_10285106 | Ga0157380_102851062 | 271 |
| 325 | 3300014326 | Ga0157380_10556111 | Ga0157380_105561111 | 271 |
| 326 | 3300014745 | Ga0157377_10044003 | Ga0157377_100440032 | 271 |
| 327 | 3300014968 | Ga0157379_10166547 | Ga0157379_101665473 | 271 |
| 328 | 3300017792 | Ga0163161_10229903 | Ga0163161_102299031 | 271 |
| 329 | 3300025901 | Ga0207688_10012610 | Ga0207688_100126103 | 271 |
| 330 | 3300025907 | Ga0207645_10097021 | Ga0207645_100970211 | 271 |
| 331 | 3300025907 | Ga0207645_10212424 | Ga0207645_102124241 | 271 |
| 332 | 3300025908 | Ga0207643_10150968 | Ga0207643_101509683 | 271 |
| 333 | 3300025909 | Ga0207705_10064077 | Ga0207705_100640772 | 271 |
| 334 | 3300025910 | Ga0207684_10292205 | Ga0207684_102922051 | 271 |
| 335 | 3300025917 | Ga0207660_10040819 | Ga0207660_100408194 | 271 |
| 336 | 3300025920 | Ga0207649_10056615 | Ga0207649_100566153 | 271 |
| 337 | 3300025923 | Ga0207681_10048649 | Ga0207681_100486493 | 271 |
| 338 | 3300025927 | Ga0207687_10020485 | Ga0207687_100204852 | 271 |
| 339 | 3300025933 | Ga0207706_10060267 | Ga0207706_100602673 | 271 |
| 340 | 3300025937 | Ga0207669_10098501 | Ga0207669_100985012 | 271 |
| 341 | 3300025938 | Ga0207704_10063069 | Ga0207704_100630693 | 271 |
| 342 | 3300025940 | Ga0207691_10040143 | Ga0207691_100401433 | 271 |
| 343 | 3300025944 | Ga0207661_10110085 | Ga0207661_101100852 | 271 |
| 344 | 3300025945 | Ga0207679_10164737 | Ga0207679_101647372 | 271 |
| 345 | 3300025961 | Ga0207712_10147002 | Ga0207712_101470022 | 271 |
| 346 | 3300025972 | Ga0207668_10130154 | Ga0207668_101301542 | 271 |
| 347 | 3300025972 | Ga0207668_10147809 | Ga0207668_101478091 | 271 |
| 348 | 3300025972 | Ga0207668_10284458 | Ga0207668_102844582 | 271 |
| 349 | 3300026035 | Ga0207703_10520984 | Ga0207703_105209842 | 271 |
| 350 | 3300026067 | Ga0207678_10044910 | Ga0207678_100449103 | 271 |
| 351 | 3300026067 | Ga0207678_10159021 | Ga0207678_101590212 | 271 |
| 352 | 3300026067 | Ga0207678_10234713 | Ga0207678_102347132 | 271 |
| 353 | 3300026075 | Ga0207708_10021294 | Ga0207708_100212942 | 271 |
| 354 | 3300026078 | Ga0207702_10289974 | Ga0207702_102899741 | 271 |
| 355 | 3300026089 | Ga0207648_10007491 | Ga0207648_100074914 | 271 |
| 356 | 3300026118 | Ga0207675_100011623 | Ga0207675_1000116237 | 271 |
| 357 | 3300026121 | Ga0207683_10023490 | Ga0207683_100234905 | 271 |
| 358 | 3300027512 | Ga0209179_1008463 | Ga0209179_10084632 | 271 |
| 359 | 3300028379 | Ga0268266_10035685 | Ga0268266_100356855 | 271 |
| 360 | 3300028379 | Ga0268266_10290839 | Ga0268266_102908392 | 271 |
| 361 | 3300028380 | Ga0268265_10076736 | Ga0268265_100767362 | 271 |
| 362 | 3300028380 | Ga0268265_10092348 | Ga0268265_100923482 | 271 |
| 363 | 3300028380 | Ga0268265_10112759 | Ga0268265_101127592 | 271 |
| 364 | 3300028380 | Ga0268265_10533373 | Ga0268265_105333732 | 271 |
| 365 | 3300028786 | Ga0307517_10000139 | Ga0307517_10000139104 | 271 |
| 366 | 3300028794 | Ga0307515_10154721 | Ga0307515_101547212 | 271 |
| 367 | 3300028794 | Ga0307515_10236335 | Ga0307515_102363352 | 271 |
| 368 | 3300031235 | Ga0265330_10003776 | Ga0265330_100037762 | 271 |
| 369 | 3300031238 | Ga0265332_10020782 | Ga0265332_100207822 | 271 |
| 370 | 3300031239 | Ga0265328_10018918 | Ga0265328_100189183 | 271 |
| 371 | 3300031241 | Ga0265325_10002588 | Ga0265325_100025888 | 271 |
| 372 | 3300031250 | Ga0265331_10004867 | Ga0265331_100048674 | 271 |
| 373 | 3300031507 | Ga0307509_10038026 | Ga0307509_100380264 | 271 |
| 374 | 3300031595 | Ga0265313_10021170 | Ga0265313_100211702 | 271 |
| 375 | 3300031616 | Ga0307508_10042362 | Ga0307508_100423624 | 271 |
| 376 | 3300031616 | Ga0307508_10128427 | Ga0307508_101284272 | 271 |
| 377 | 3300031712 | Ga0265342_10019343 | Ga0265342_100193432 | 271 |
| 378 | 3300031712 | Ga0265342_10145457 | Ga0265342_101454571 | 271 |
| 379 | 3300031730 | Ga0307516_10143629 | Ga0307516_101436292 | 271 |
| 380 | 3300033179 | Ga0307507_10018492 | Ga0307507_100184925 | 271 |
| 381 | 3300033180 | Ga0307510_10008205 | Ga0307510_100082059 | 271 |
| 382 | 3300035083 | Ga0373926_0048273 | Ga0373926_0048273_458_1273 | 271 |
| 383 | 3300035111 | Ga0373923_0012720 | Ga0373923_0012720_667_1509 | 271 |
| 384 | 3300035118 | Ga0373954_0016363 | Ga0373954_0016363_622_1464 | 271 |
| 385 | 3300035119 | Ga0373956_0002706 | Ga0373956_0002706_3819_4661 | 271 |
| 386 | 3300035120 | Ga0373957_0003773 | Ga0373957_0003773_1711_2553 | 271 |
| 387 | 3300035172 | Ga0373955_0026253 | Ga0373955_0026253_314_1156 | 271 |
| 388 | 3300035410 | Ga0373924_0007926 | Ga0373924_0007926_519_1361 | 271 |
| 389 | 3300035692 | Ga0373935_0021315 | Ga0373935_0021315_488_1303 | 271 |
| 390 | 3300035695 | Ga0373927_0079135 | Ga0373927_0079135_754_1599 | 271 |
| 391 | 3300035725 | Ga0373947_0061629 | Ga0373947_0061629_205_1050 | 271 |
| 392 | 3300036401 | Ga0373937_0019213 | Ga0373937_0019213_519_1361 | 271 |
| 393 | 3300037068 | Ga0373925_0182371 | Ga0373925_0182371_233_1048 | 271 |
| 394 | 3300041413 | Ga0439465_0042058 | Ga0439465_0042058_172_987 | 271 |
| 395 | 3300046452 | Ga0495617_105295 | Ga0495617_105295_35_850 | 271 |
| 396 | 3300046454 | Ga0495592_0032930 | Ga0495592_0032930_315_1157 | 271 |
| 397 | 3300046454 | Ga0495592_0044611 | Ga0495592_0044611_1081_1926 | 271 |
| 398 | 3300046454 | Ga0495592_0187145 | Ga0495592_0187145_404_1219 | 271 |
| 399 | 3300046455 | Ga0495603_0005569 | Ga0495603_0005569_6570_7415 | 271 |
| 400 | 3300046455 | Ga0495603_0013569 | Ga0495603_0013569_4048_4863 | 271 |
| 401 | 3300046459 | Ga0495629_0006932 | Ga0495629_0006932_2094_2936 | 271 |
| 402 | 3300046459 | Ga0495629_0026709 | Ga0495629_0026709_1467_2312 | 271 |
| 403 | 3300046460 | Ga0495638_0008466 | Ga0495638_0008466_1512_2327 | 271 |
| 404 | 3300046460 | Ga0495638_0098983 | Ga0495638_0098983_559_1374 | 271 |
| 405 | 3300046461 | Ga0495641_0007231 | Ga0495641_0007231_5075_5920 | 271 |
| 406 | 3300046462 | Ga0495651_0154486 | Ga0495651_0154486_187_1029 | 271 |
| 407 | 3300046463 | Ga0495653_0006024 | Ga0495653_0006024_3109_3951 | 271 |
| 408 | 3300046472 | Ga0495580_0064128 | Ga0495580_0064128_1748_2563 | 271 |
| 409 | 3300046474 | Ga0495605_0071012 | Ga0495605_0071012_259_1074 | 271 |
| 410 | 3300046475 | Ga0495639_0001090 | Ga0495639_0001090_5469_6314 | 271 |
| 411 | 3300046476 | Ga0495662_0003031 | Ga0495662_0003031_3133_3978 | 271 |
| 412 | 3300046477 | Ga0495664_0024431 | Ga0495664_0024431_943_1758 | 271 |
| 413 | 3300046492 | Ga0495585_0057182 | Ga0495585_0057182_219_1034 | 271 |
| 414 | 3300046499 | Ga0495594_0012745 | Ga0495594_0012745_44_889 | 271 |
| 415 | 3300046511 | Ga0495608_0028573 | Ga0495608_0028573_187_1029 | 271 |
| 416 | 3300046513 | Ga0495616_0080626 | Ga0495616_0080626_341_1156 | 271 |
| 417 | 3300046516 | Ga0495628_0051667 | Ga0495628_0051667_773_1615 | 271 |
| 418 | 3300046517 | Ga0495630_0041576 | Ga0495630_0041576_575_1420 | 271 |
| 419 | 3300046519 | Ga0495632_0144831 | Ga0495632_0144831_117_932 | 271 |
| 420 | 3300046523 | Ga0495644_0025750 | Ga0495644_0025750_792_1607 | 271 |
| 421 | 3300046529 | Ga0495652_0114560 | Ga0495652_0114560_699_1541 | 271 |
| 422 | 3300046533 | Ga0495640_0008246 | Ga0495640_0008246_3281_4123 | 271 |
| 423 | 3300046533 | Ga0495640_0021688 | Ga0495640_0021688_1962_2807 | 271 |
| 424 | 3300046533 | Ga0495640_0379236 | Ga0495640_0379236_14_829 | 271 |
| 425 | 3300046536 | Ga0495587_0019828 | Ga0495587_0019828_2530_3372 | 271 |
| 426 | 3300046543 | Ga0495645_0026110 | Ga0495645_0026110_560_1402 | 271 |
| 427 | 3300046557 | Ga0495622_0012388 | Ga0495622_0012388_1858_2673 | 271 |
| 428 | 3300046557 | Ga0495622_0043211 | Ga0495622_0043211_613_1428 | 271 |
| 429 | 3300046559 | Ga0495667_0004548 | Ga0495667_0004548_3561_4403 | 271 |
| 430 | 3300046559 | Ga0495667_0271774 | Ga0495667_0271774_212_1027 | 271 |
| 431 | 3300046616 | Ga0495668_0131731 | Ga0495668_0131731_61_876 | 271 |
| 432 | 3300046642 | Ga0495634_0055281 | Ga0495634_0055281_752_1594 | 271 |
| 433 | 3300046660 | Ga0495625_0243310 | Ga0495625_0243310_320_1135 | 271 |
| 434 | 3300046663 | Ga0495635_0011805 | Ga0495635_0011805_2915_3760 | 271 |
| 435 | 3300046663 | Ga0495635_0021577 | Ga0495635_0021577_2000_2842 | 271 |
| 436 | 3300046674 | Ga0495588_0043630 | Ga0495588_0043630_1269_2084 | 271 |
| 437 | 3300046675 | Ga0495657_0010590 | Ga0495657_0010590_647_1489 | 271 |
| 438 | 3300046679 | Ga0495623_0036244 | Ga0495623_0036244_2004_2846 | 271 |
| 439 | 3300046680 | Ga0495646_0006104 | Ga0495646_0006104_1806_2648 | 271 |
| 440 | 3300046681 | Ga0495647_0037285 | Ga0495647_0037285_916_1761 | 271 |
| 441 | 3300046683 | Ga0495658_0017308 | Ga0495658_0017308_1844_2689 | 271 |
| 442 | 3300046684 | Ga0495669_0002077 | Ga0495669_0002077_492_1307 | 271 |
| 443 | 3300046684 | Ga0495669_0044430 | Ga0495669_0044430_804_1619 | 271 |
| 444 | 3300046689 | Ga0495613_0041726 | Ga0495613_0041726_785_1627 | 271 |
| 445 | 3300046689 | Ga0495613_0089425 | Ga0495613_0089425_659_1504 | 271 |
| 446 | 3300046694 | Ga0495649_0077511 | Ga0495649_0077511_381_1196 | 271 |
| 447 | 3300046809 | Ga0495600_0008516 | Ga0495600_0008516_2530_3372 | 271 |
| 448 | 3300047315 | Ga0495581_0053082 | Ga0495581_0053082_786_1631 | 271 |
| 449 | 3300047317 | Ga0495604_0058403 | Ga0495604_0058403_1806_2648 | 271 |
| 450 | 3300047318 | Ga0495636_0163270 | Ga0495636_0163270_136_951 | 271 |
| 451 | 3300047319 | Ga0495674_0019734 | Ga0495674_0019734_3822_4664 | 271 |
| 452 | 3300047322 | Ga0495680_0157605 | Ga0495680_0157605_187_1029 | 271 |
| 453 | 3300047444 | Ga0495675_0035602 | Ga0495675_0035602_1690_2532 | 271 |
| 454 | 3300047447 | Ga0495685_064558 | Ga0495685_064558_164_979 | 271 |
| 455 | 3300047471 | Ga0495684_0008792 | Ga0495684_0008792_3306_4148 | 271 |
| 456 | 3300047472 | Ga0495686_0118714 | Ga0495686_0118714_533_1348 | 271 |
| 457 | 3300047472 | Ga0495686_0143592 | Ga0495686_0143592_527_1342 | 271 |
| 458 | 3300047673 | Ga0495593_0003242 | Ga0495593_0003242_5982_6824 | 271 |
| 459 | 3300047673 | Ga0495593_0007020 | Ga0495593_0007020_3027_3872 | 271 |
| 460 | 3300048088 | Ga0495602_0094867 | Ga0495602_0094867_315_1157 | 271 |
| 461 | 3300048903 | Ga0496100_0007844 | Ga0496100_0007844_1921_2736 | 271 |
| 462 | 3300048903 | Ga0496100_0305958 | Ga0496100_0305958_274_1089 | 271 |
| 463 | 3300048904 | Ga0496101_0030678 | Ga0496101_0030678_464_1279 | 271 |
| 464 | 3300048905 | Ga0496102_0001499 | Ga0496102_0001499_8166_8981 | 271 |
| 465 | 3300048905 | Ga0496102_0349946 | Ga0496102_0349946_459_1274 | 271 |
| 466 | 3300048906 | Ga0496103_0056075 | Ga0496103_0056075_1068_1883 | 271 |
| 467 | 3300048906 | Ga0496103_0070295 | Ga0496103_0070295_884_1699 | 271 |
| 468 | 3300048907 | Ga0496104_0006502 | Ga0496104_0006502_8711_9526 | 271 |
| 469 | 3300048908 | Ga0496105_0169607 | Ga0496105_0169607_59_874 | 271 |
| 470 | 3300048908 | Ga0496105_0419450 | Ga0496105_0419450_154_969 | 271 |
| 471 | 3300048909 | Ga0496106_0075960 | Ga0496106_0075960_1221_2036 | 271 |
| 472 | 3300048910 | Ga0496107_0009222 | Ga0496107_0009222_5529_6344 | 271 |
| 473 | 3300048911 | Ga0496108_0121296 | Ga0496108_0121296_820_1635 | 271 |
| 474 | 3300048912 | Ga0496109_0022302 | Ga0496109_0022302_2950_3765 | 271 |
| 475 | 3300048914 | Ga0496111_0150825 | Ga0496111_0150825_317_1132 | 271 |
| 476 | 3300048915 | Ga0496112_0159973 | Ga0496112_0159973_609_1424 | 271 |
| 477 | 3300048917 | Ga0496114_0005644 | Ga0496114_0005644_6086_6901 | 271 |
| 478 | 3300048918 | Ga0496115_0013014 | Ga0496115_0013014_2578_3393 | 271 |
| 479 | 3300048920 | Ga0496117_0032123 | Ga0496117_0032123_1045_1860 | 271 |
| 480 | 3300048921 | Ga0496118_0063618 | Ga0496118_0063618_620_1435 | 271 |
| 481 | 3300048921 | Ga0496118_0078833 | Ga0496118_0078833_188_1003 | 271 |
| 482 | 3300048924 | Ga0496121_0000923 | Ga0496121_0000923_2553_3368 | 271 |
| 483 | 3300048924 | Ga0496121_0005996 | Ga0496121_0005996_12191_13006 | 271 |
| 484 | 3300048924 | Ga0496121_0007289 | Ga0496121_0007289_7719_8534 | 271 |
| 485 | 3300048924 | Ga0496121_0071432 | Ga0496121_0071432_1565_2380 | 271 |
| 486 | 3300048924 | Ga0496121_0175111 | Ga0496121_0175111_476_1291 | 271 |
| 487 | 3300048925 | Ga0496122_0092410 | Ga0496122_0092410_399_1214 | 271 |
| 488 | 3300048927 | Ga0496124_0039178 | Ga0496124_0039178_1820_2635 | 271 |
| 489 | 3300048927 | Ga0496124_0106131 | Ga0496124_0106131_252_1067 | 271 |
| 490 | 3300048928 | Ga0496125_0000446 | Ga0496125_0000446_66089_66904 | 271 |
| 491 | 3300048928 | Ga0496125_0008194 | Ga0496125_0008194_1064_1879 | 271 |
| 492 | 3300048929 | Ga0496126_0008116 | Ga0496126_0008116_3685_4500 | 271 |
| 493 | 3300048929 | Ga0496126_0036184 | Ga0496126_0036184_24_839 | 271 |
| 494 | 3300049572 | Ga0501036_0188587 | Ga0501036_0188587_189_1004 | 271 |
| 495 | 3300049574 | Ga0501038_0228026 | Ga0501038_0228026_46_861 | 271 |
| 496 | 3300050489 | nmdc:mga03683_85804_c1 | nmdc:mga03683_85804_c1_97_912 | 271 |
| 497 | 3300050491 | nmdc:mga00v17_258703_c1 | nmdc:mga00v17_258703_c1_126_941 | 271 |
| 498 | 3300050491 | nmdc:mga00v17_50733_c1 | nmdc:mga00v17_50733_c1_1144_1959 | 271 |
| 499 | 3300050492 | nmdc:mga0yw44_155838_c1 | nmdc:mga0yw44_155838_c1_23_838 | 271 |
| 500 | 3300050493 | nmdc:mga0k408_130384_c1 | nmdc:mga0k408_130384_c1_432_1247 | 271 |
| 501 | 3300050493 | nmdc:mga0k408_85242_c1 | nmdc:mga0k408_85242_c1_102_917 | 271 |
| 502 | 3300050496 | nmdc:mga07m45_63823_c1 | nmdc:mga07m45_63823_c1_1129_1944 | 271 |
| 503 | 3300050507 | nmdc:mga05p37_62949_c1 | nmdc:mga05p37_62949_c1_2995_3810 | 271 |
| 504 | 3300050511 | nmdc:mga08y16_290882_c1 | nmdc:mga08y16_290882_c1_832_1647 | 271 |
| 505 | 3300050516 | nmdc:mga0sz30_15225_c1 | nmdc:mga0sz30_15225_c1_630_1445 | 271 |
| 506 | 3300053077 | Ga0495601_0030446 | Ga0495601_0030446_1146_1988 | 271 |
| 507 | 3300053080 | Ga0500635_0016194 | Ga0500635_0016194_996_1811 | 271 |
| 508 | 3300053083 | Ga0495655_0018320 | Ga0495655_0018320_47_862 | 271 |
| 509 | 3300053085 | Ga0495619_0005109 | Ga0495619_0005109_2402_3244 | 271 |
| 510 | 3300053087 | Ga0500643_043358 | Ga0500643_043358_308_1123 | 271 |
| 511 | 3300053093 | Ga0500651_0002542 | Ga0500651_0002542_7290_8105 | 271 |
| 512 | 3300053094 | Ga0500566_0000929 | Ga0500566_0000929_5687_6502 | 271 |
| 513 | 3300053096 | Ga0500641_0020884 | Ga0500641_0020884_748_1563 | 271 |
| 514 | 3300053096 | Ga0500641_0122672 | Ga0500641_0122672_35_850 | 271 |
| 515 | 3300053102 | Ga0500554_043556 | Ga0500554_043556_558_1373 | 271 |
| 516 | 3300053119 | Ga0500595_001913 | Ga0500595_001913_7227_8042 | 271 |
| 517 | 3300053119 | Ga0500595_002769 | Ga0500595_002769_4433_5248 | 271 |
| 518 | 3300053119 | Ga0500595_002988 | Ga0500595_002988_4787_5602 | 271 |
| 519 | 3300053119 | Ga0500595_021879 | Ga0500595_021879_1431_2246 | 271 |
| 520 | 3300053119 | Ga0500595_026652 | Ga0500595_026652_822_1637 | 271 |
| 521 | 3300053130 | Ga0500642_0053511 | Ga0500642_0053511_492_1307 | 271 |
| 522 | 3300053130 | Ga0500642_0117090 | Ga0500642_0117090_334_1149 | 271 |
| 523 | 3300053136 | Ga0500559_0066734 | Ga0500559_0066734_568_1383 | 271 |
| 524 | 3300053142 | Ga0500577_0000350 | Ga0500577_0000350_8181_8996 | 271 |
| 525 | 3300053148 | Ga0500590_042268 | Ga0500590_042268_282_1097 | 271 |
| 526 | 3300053150 | Ga0500603_027384 | Ga0500603_027384_142_957 | 271 |
| 527 | 3300053156 | Ga0500622_0048554 | Ga0500622_0048554_957_1772 | 271 |
| 528 | 3300053162 | Ga0500638_018535 | Ga0500638_018535_2053_2868 | 271 |
| 529 | 3300053163 | Ga0500639_179895 | Ga0500639_179895_93_908 | 271 |
| 530 | 3300053177 | Ga0500636_0087291 | Ga0500636_0087291_842_1657 | 271 |
| 531 | 3300053177 | Ga0500636_0154126 | Ga0500636_0154126_199_1014 | 271 |
| 532 | 3300053178 | Ga0500637_0042512 | Ga0500637_0042512_296_1111 | 271 |
| 533 | 3300053178 | Ga0500637_0069319 | Ga0500637_0069319_378_1193 | 271 |
| 534 | 3300053727 | Ga0500611_009623 | Ga0500611_009623_326_1141 | 271 |
| 535 | 3300055283 | Ga0500661_000488 | Ga0500661_000488_1166_1981 | 271 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9365 | 2 | 231 |
| 7cha-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with amppnp | 0.9352 | 2 | 234 |
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9347 | 2 | 228 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9346 | 2 | 231 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9339 | 2 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1L8_1_252_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9615 | 2 | 245 | 3.40.50.300 |
| af_P0A9R7_1_220_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9472 | 1 | 222 | 3.40.50.300 |
| af_Q57554_4_248_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.946 | 1 | 244 | 3.40.50.300 |
| af_P16677_4_261_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9391 | 1 | 248 | 3.40.50.300 |
| af_P0AAI1_7_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9366 | 2 | 228 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1S2LLA8-F1-model_v4 | Phosphonate ABC transporter ATP-binding protein | 0.9785 | 1 | 240 |
GO:0005524
GO:0005886 GO:0015416 GO:0016887 |
| AF-A0A1S2LLA8-F1-model_v4 | Phosphonate ABC transporter ATP-binding protein | 0.9588 | 1 | 240 |
GO:0005524
GO:0005886 GO:0015416 GO:0016887 |
| AF-A0A2N2YX47-F1-model_v4 | ABC transporter ATP-binding protein | 0.9458 | 2 | 241 |
GO:0005524
GO:0016887 |
| AF-A0A097B6U0-F1-model_v4 | deleted | 0.9439 | 2 | 239 |
|
| AF-A0A1H2SJR7-F1-model_v4 | Iron complex transport system ATP-binding protein | 0.9433 | 2 | 241 |
GO:0005524
GO:0005886 GO:0006826 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar