F460683

General Info

Members Datasets Scaffolds Average Seq Length
535 229 1070 413

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0025753|Ga0373923_0025753_351_1796
Length 481
Sequence MQSVEIGDREATLDTAGFDKLPEQWIVVRGARSPPLEPSVVDGYAVLSNATCAKSDSTYAERAPSGRNEKMATDGALPGCLAGVRVLDLTQFEAGPSCTEALAWLGAEVVKVENPKGGEAGRFLSHGSSGQGQDSWYFLLFNANKKSVTVNLKSERGLELVKSMAKRADVMVENFAPGAIERLGLGYEVVRAVNPSIVYAQVKGFGTGGPYENNLAFDMIAQATGGVMSITGERDGPPLKPGVTLGDTGTGMLLAISILAALYRRRGTGQGERIEIAMQDAMLQYIRVALSTQATHGVAAQRNGAKVVLGFAVPSGIYPCKPGGLNDYVYVYTSRTNPAHWRRLLEVIGREDLIGDPRFDTGVARQEHEPEIDDMIAAWTRLHDKREAMRVLGGAGVPAGAIFDTMELTDEADFERRGILQTMEHPTAGAFKMPGWPVRFGGRTPMVKPAPLLGQHTNEVLGEWLGLDADQIERLGKDNVI

Samples

Sample ID Description Type Environment
1 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 2.99
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 9.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373923_0025753 3300035111 Unclassified 2334
2 JGI25405J52794_10008178 3300003911 Bacteria 1947
3 Ga0058862_12536762 3300004803 Unclassified 1609
4 Ga0065707_10133138 3300005295 Bacteria 1886
5 Ga0065707_10142782 3300005295 Bacteria 1741
6 Ga0070680_100007875 3300005336 Bacteria 8124
7 Ga0070689_100130508 3300005340 Bacteria 2015
8 Ga0070691_10008857 3300005341 Bacteria 4607
9 Ga0070691_10090667 3300005341 Bacteria 1507
10 Ga0070668_100045815 3300005347 Bacteria 3356
11 Ga0070703_10003079 3300005406 Bacteria 4767
12 Ga0070703_10040009 3300005406 Bacteria 1456
13 Ga0070709_10099123 3300005434 Bacteria 1938
14 Ga0070714_100015036 3300005435 Bacteria 6222
15 Ga0070714_100082535 3300005435 Bacteria 2800
16 Ga0070714_100164550 3300005435 Bacteria 2009
17 Ga0070714_100244701 3300005435 Bacteria 1656
18 Ga0070713_100012886 3300005436 Bacteria 6151
19 Ga0070713_100079161 3300005436 Bacteria 2799
20 Ga0070713_100330027 3300005436 Bacteria 1411
21 Ga0070710_10006748 3300005437 Bacteria 5533
22 Ga0070710_10061982 3300005437 Bacteria 2132
23 Ga0070710_10062457 3300005437 Bacteria 2124
24 Ga0070701_10081850 3300005438 Bacteria 1750
25 Ga0070701_10112433 3300005438 Bacteria 1523
26 Ga0070711_100005180 3300005439 Bacteria 7774
27 Ga0070711_100036551 3300005439 Bacteria 3291
28 Ga0070705_100000168 3300005440 Bacteria 38074
29 Ga0070705_100084452 3300005440 Bacteria 1959
30 Ga0070700_100000385 3300005441 Bacteria 22652
31 Ga0070694_100000419 3300005444 Bacteria 23148
32 Ga0070694_100078859 3300005444 Bacteria 2285
33 Ga0070708_100036178 3300005445 Bacteria 4306
34 Ga0070708_100039278 3300005445 Bacteria 4140
35 Ga0070708_100068200 3300005445 Bacteria 3196
36 Ga0070708_100074926 3300005445 Bacteria 3054
37 Ga0070708_100075354 3300005445 Unclassified 3045
38 Ga0070708_100130367 3300005445 Bacteria 2326
39 Ga0070662_100022439 3300005457 Bacteria 4322
40 Ga0070681_10156699 3300005458 Bacteria 2202
41 Ga0070706_100035731 3300005467 Bacteria 4588
42 Ga0070706_100038462 3300005467 Bacteria 4415
43 Ga0070706_100049394 3300005467 Bacteria 3882
44 Ga0070706_100246508 3300005467 Bacteria 1668
45 Ga0070707_100017831 3300005468 Bacteria 6674
46 Ga0070707_100058307 3300005468 Bacteria 3703
47 Ga0070707_100139080 3300005468 Bacteria 2363
48 Ga0070698_100006325 3300005471 Bacteria 12859
49 Ga0070698_100026008 3300005471 Bacteria 6097
50 Ga0070698_100039213 3300005471 Bacteria 4876
51 Ga0070699_100000942 3300005518 Bacteria 27147
52 Ga0070699_100008877 3300005518 Bacteria 8704
53 Ga0070699_100021795 3300005518 Bacteria 5523
54 Ga0070699_100162880 3300005518 Bacteria 1974
55 Ga0070697_100005982 3300005536 Bacteria 9406
56 Ga0070697_100031092 3300005536 Bacteria 4292
57 Ga0070697_100038810 3300005536 Bacteria 3848
58 Ga0070697_100086681 3300005536 Unclassified 2584
59 Ga0070697_100289673 3300005536 Bacteria 1406
60 Ga0070697_100348938 3300005536 Bacteria 1278
61 Ga0070695_100001252 3300005545 Bacteria 13964
62 Ga0070696_100000036 3300005546 Bacteria 62324
63 Ga0070665_100111353 3300005548 Bacteria 2740
64 Ga0070704_100003406 3300005549 Bacteria 9107
65 Ga0070704_100013170 3300005549 Bacteria 5125
66 Ga0068857_100003558 3300005577 Bacteria 13035
67 Ga0068857_100324278 3300005577 Bacteria 1423
68 Ga0068854_100132415 3300005578 Bacteria 1905
69 Ga0070702_100004678 3300005615 Bacteria 6277
70 Ga0068859_100008868 3300005617 Bacteria 10153
71 Ga0068859_100151408 3300005617 Bacteria 2395
72 Ga0068859_100178087 3300005617 Bacteria 2208
73 Ga0068864_100165777 3300005618 Bacteria 2011
74 Ga0068861_100125373 3300005719 Bacteria 2077
75 Ga0068860_100000758 3300005843 Bacteria 36435
76 Ga0068862_100001849 3300005844 Bacteria 19183
77 Ga0068862_100062168 3300005844 Bacteria 3211
78 Ga0068862_100118179 3300005844 Bacteria 2334
79 Ga0068862_100199830 3300005844 Bacteria 1802
80 Ga0081455_10000029 3300005937 Bacteria 155672
81 Ga0081455_10008507 3300005937 Bacteria 10660
82 Ga0081455_10016441 3300005937 Bacteria 7144
83 Ga0081455_10044095 3300005937 Bacteria 3895
84 Ga0081455_10091762 3300005937 Bacteria 2459
85 Ga0081455_10170058 3300005937 Bacteria 1661
86 Ga0081538_10016075 3300005981 Bacteria 5755
87 Ga0081538_10028524 3300005981 Bacteria 3836
88 Ga0081540_1000048 3300005983 Bacteria 127924
89 Ga0081540_1028075 3300005983 Bacteria 3170
90 Ga0081540_1028436 3300005983 Bacteria 3140
91 Ga0081540_1032896 3300005983 Bacteria 2823
92 Ga0081540_1075143 3300005983 Unclassified 1545
93 Ga0081539_10060963 3300005985 Bacteria 2069
94 Ga0081539_10062471 3300005985 Bacteria 2036
95 Ga0070717_10010206 3300006028 Bacteria 7074
96 Ga0070717_10029715 3300006028 Bacteria 4388
97 Ga0075365_10009022 3300006038 Bacteria 5703
98 Ga0070715_10058922 3300006163 Bacteria 1678
99 Ga0070715_10068757 3300006163 Bacteria 1576
100 Ga0070716_100014301 3300006173 Bacteria 4064
101 Ga0070716_100033746 3300006173 Bacteria 2801
102 Ga0070712_100003449 3300006175 Bacteria 9731
103 Ga0070712_100032883 3300006175 Bacteria 3505
104 Ga0070712_100068655 3300006175 Bacteria 2526
105 Ga0097621_100187419 3300006237 Unclassified 1790
106 Ga0075428_100001527 3300006844 Bacteria 24754
107 Ga0075428_100010340 3300006844 Bacteria 10356
108 Ga0075428_100013241 3300006844 Bacteria 9176
109 Ga0075428_100038628 3300006844 Bacteria 5254
110 Ga0075428_100072069 3300006844 Bacteria 3775
111 Ga0075430_100010707 3300006846 Bacteria 7772
112 Ga0075430_100014405 3300006846 Bacteria 6738
113 Ga0075431_100004543 3300006847 Bacteria 13627
114 Ga0075431_100036678 3300006847 Bacteria 5050
115 Ga0075431_100039881 3300006847 Bacteria 4838
116 Ga0075431_100065330 3300006847 Bacteria 3757
117 Ga0075431_100131595 3300006847 Bacteria 2580
118 Ga0075431_100153329 3300006847 Bacteria 2372
119 Ga0075431_100160028 3300006847 Bacteria 2315
120 Ga0075433_10003363 3300006852 Bacteria 12363
121 Ga0075433_10054293 3300006852 Bacteria 3495
122 Ga0075433_10110733 3300006852 Bacteria 2436
123 Ga0075433_10115320 3300006852 Bacteria 2383
124 Ga0075434_100003494 3300006871 Bacteria 14055
125 Ga0075434_100016581 3300006871 Bacteria 7084
126 Ga0075434_100154036 3300006871 Bacteria 2318
127 Ga0075429_100010351 3300006880 Bacteria 8069
128 Ga0075429_100011787 3300006880 Bacteria 7579
129 Ga0075429_100012835 3300006880 Bacteria 7267
130 Ga0075429_100015266 3300006880 Bacteria 6655
131 Ga0075429_100049126 3300006880 Bacteria 3669
132 Ga0075429_100169134 3300006880 Bacteria 1915
133 Ga0075429_100189789 3300006880 Bacteria 1800
134 Ga0075429_100218835 3300006880 Bacteria 1668
135 Ga0097620_100008868 3300006931 Bacteria 10153
136 Ga0097620_100151402 3300006931 Bacteria 2395
137 Ga0097620_100178082 3300006931 Bacteria 2208
138 Ga0075435_100010323 3300007076 Bacteria 6825
139 Ga0075435_100037857 3300007076 Unclassified 3844
140 Ga0075435_100041257 3300007076 Bacteria 3689
141 Ga0099794_10025201 3300007265 Bacteria 2737
142 Ga0105240_10224979 3300009093 Unclassified 2184
143 Ga0111539_10003941 3300009094 Bacteria 19514
144 Ga0111539_10005401 3300009094 Bacteria 16534
145 Ga0111539_10014473 3300009094 Bacteria 9847
146 Ga0111539_10015972 3300009094 Bacteria 9327
147 Ga0111539_10021302 3300009094 Bacteria 7982
148 Ga0111539_10035914 3300009094 Bacteria 5999
149 Ga0111539_10046239 3300009094 Bacteria 5206
150 Ga0111539_10231873 3300009094 Bacteria 2150
151 Ga0114129_10078746 3300009147 Bacteria 4584
152 Ga0114129_10099059 3300009147 Bacteria 4034
153 Ga0114129_10133312 3300009147 Bacteria 3411
154 Ga0114129_10263431 3300009147 Bacteria 2309
155 Ga0114129_10273049 3300009147 Bacteria 2261
156 Ga0114129_10394598 3300009147 Bacteria 1824
157 Ga0114129_10570315 3300009147 Bacteria 1470
158 Ga0105243_10144508 3300009148 Bacteria 2034
159 Ga0105248_10013418 3300009177 Bacteria 9018
160 Ga0105249_10041585 3300009553 Bacteria 4179
161 Ga0105249_10147706 3300009553 Bacteria 2260
162 Ga0099796_10011689 3300010159 Bacteria 2457
163 Ga0163162_10083534 3300013306 Bacteria 3268
164 Ga0163162_10373463 3300013306 Bacteria 1559
165 Ga0163162_10470508 3300013306 Bacteria 1388
166 Ga0157375_10083479 3300013308 Bacteria 3240
167 Ga0157375_10391411 3300013308 Bacteria 1557
168 Ga0163163_10193543 3300014325 Bacteria 2082
169 Ga0157380_10070960 3300014326 Bacteria 2816
170 Ga0157380_10326536 3300014326 Bacteria 1425
171 Ga0182008_10008891 3300014497 Bacteria 5449
172 Ga0157379_10166631 3300014968 Bacteria 1989
173 Ga0157379_10372636 3300014968 Bacteria 1309
174 Ga0157376_10005231 3300014969 Bacteria 9061
175 Ga0206354_11109142 3300020081 Bacteria 1511
176 Ga0213875_10000040 3300021388 Bacteria 156362
177 Ga0213875_10005765 3300021388 Bacteria 6594
178 Ga0228598_1000978 3300024227 Bacteria 6227
179 Ga0207653_10009711 3300025885 Bacteria 3001
180 Ga0207692_10060852 3300025898 Unclassified 1954
181 Ga0207685_10043139 3300025905 Bacteria 1698
182 Ga0207699_10042617 3300025906 Bacteria 2631
183 Ga0207699_10085771 3300025906 Bacteria 1965
184 Ga0207699_10144986 3300025906 Bacteria 1564
185 Ga0207684_10010021 3300025910 Bacteria 8350
186 Ga0207684_10014997 3300025910 Bacteria 6670
187 Ga0207684_10041578 3300025910 Bacteria 3896
188 Ga0207684_10055118 3300025910 Bacteria 3373
189 Ga0207693_10003102 3300025915 Bacteria 14315
190 Ga0207693_10005772 3300025915 Bacteria 10265
191 Ga0207663_10025511 3300025916 Bacteria 3418
192 Ga0207663_10100524 3300025916 Bacteria 1941
193 Ga0207663_10113099 3300025916 Bacteria 1845
194 Ga0207646_10017430 3300025922 Bacteria 6722
195 Ga0207646_10034864 3300025922 Bacteria 4549
196 Ga0207700_10038921 3300025928 Bacteria 3456
197 Ga0207700_10068997 3300025928 Bacteria 2711
198 Ga0207700_10070240 3300025928 Unclassified 2691
199 Ga0207664_10144308 3300025929 Unclassified 2017
200 Ga0207670_10091909 3300025936 Bacteria 2147
201 Ga0207665_10014743 3300025939 Bacteria 5141
202 Ga0207665_10023770 3300025939 Bacteria 4036
203 Ga0207665_10041147 3300025939 Bacteria 3085
204 Ga0207711_10025823 3300025941 Bacteria 4926
205 Ga0207712_10003701 3300025961 Bacteria 9649
206 Ga0207712_10157174 3300025961 Bacteria 1762
207 Ga0207712_10216536 3300025961 Bacteria 1529
208 Ga0207640_10154875 3300025981 Bacteria 1688
209 Ga0207708_10004871 3300026075 Bacteria 9901
210 Ga0207676_10247325 3300026095 Bacteria 1603
211 Ga0207674_10003588 3300026116 Bacteria 18917
212 Ga0207674_10273149 3300026116 Bacteria 1638
213 Ga0207675_100193792 3300026118 Bacteria 1950
214 Ga0207675_100260672 3300026118 Bacteria 1680
215 Ga0207675_100305144 3300026118 Bacteria 1551
216 Ga0207428_10000118 3300027907 Bacteria 107695
217 Ga0207428_10000190 3300027907 Bacteria 85215
218 Ga0207428_10020682 3300027907 Bacteria 5584
219 Ga0207428_10033427 3300027907 Bacteria 4224
220 Ga0207428_10077730 3300027907 Bacteria 2598
221 Ga0268265_10001993 3300028380 Bacteria 16163
222 Ga0268265_10060240 3300028380 Bacteria 2908
223 Ga0268264_10000704 3300028381 Bacteria 38564
224 Ga0265316_10119564 3300031344 Bacteria 1990
225 Ga0373950_0004548 3300034818 Bacteria 2035
226 Ga0373926_0011034 3300035083 Unclassified 3036
227 Ga0373934_0004212 3300035086 Bacteria 5308
228 Ga0373923_0000338 3300035111 Bacteria 10565
229 Ga0373936_0011734 3300035113 Unclassified 3323
230 Ga0373939_0007075 3300035114 Unclassified 2716
231 Ga0373954_0002145 3300035118 Bacteria 8192
232 Ga0373954_0014164 3300035118 Bacteria 3555
233 Ga0373956_0011166 3300035119 Bacteria 3698
234 Ga0373956_0027994 3300035119 Unclassified 2451
235 Ga0373956_0065170 3300035119 Unclassified 1655
236 Ga0373957_0020298 3300035120 Bacteria 2346
237 Ga0373957_0029497 3300035120 Bacteria 2004
238 Ga0373960_0003603 3300035121 Bacteria 3510
239 Ga0373960_0017850 3300035121 Bacteria 1843
240 Ga0373960_0033722 3300035121 Bacteria 1445
241 Ga0373943_0068588 3300035170 Bacteria 1791
242 Ga0373946_0064562 3300035171 Bacteria 1566
243 Ga0373955_0001825 3300035172 Bacteria 9164
244 Ga0373955_0005433 3300035172 Bacteria 5727
245 Ga0373955_0005508 3300035172 Bacteria 5694
246 Ga0373955_0030489 3300035172 Bacteria 2816
247 Ga0373942_0012262 3300035207 Unclassified 2044
248 Ga0373924_0004580 3300035410 Bacteria 4836
249 Ga0373924_0026194 3300035410 Unclassified 2311
250 Ga0373924_0040826 3300035410 Unclassified 1900
251 Ga0373931_0000155 3300035691 Bacteria 29791
252 Ga0373931_0145450 3300035691 Unclassified 1377
253 Ga0373927_0023781 3300035695 Bacteria 4010
254 Ga0373927_0042698 3300035695 Bacteria 2938
255 Ga0373933_0002999 3300035724 Bacteria 9409
256 Ga0373933_0003046 3300035724 Bacteria 9347
257 Ga0373933_0004902 3300035724 Bacteria 7304
258 Ga0373947_0030828 3300035725 Bacteria 3153
259 Ga0373947_0100647 3300035725 Bacteria 1816
260 Ga0373937_0009235 3300036401 Bacteria 8560
261 Ga0373937_0012636 3300036401 Bacteria 7432
262 Ga0373937_0024940 3300036401 Bacteria 5397
263 Ga0373937_0079281 3300036401 Unclassified 3035
264 Ga0373937_0084776 3300036401 Bacteria 2931
265 Ga0373937_0113128 3300036401 Bacteria 2525
266 Ga0373925_0006276 3300037068 Bacteria 8760
267 Ga0373925_0037185 3300037068 Bacteria 3593
268 Ga0373925_0044188 3300037068 Bacteria 3308
269 Ga0373925_0067708 3300037068 Bacteria 2694
270 Ga0373925_0151804 3300037068 Bacteria 1820
271 Ga0373925_0177916 3300037068 Unclassified 1682
272 Ga0395899_0069486 3300037312 Bacteria 2579
273 Ga0395900_0001852 3300037418 Bacteria 24121
274 Ga0395898_0009827 3300037466 Bacteria 10029
275 Ga0395898_0067455 3300037466 Bacteria 3463
276 Ga0436364_0368943 3300037853 Bacteria 3072
277 Ga0436364_0387740 3300037853 Bacteria 4265
278 Ga0436364_0411364 3300037853 Bacteria 19778
279 Ga0436364_0586291 3300037853 Bacteria 97560
280 Ga0436364_0635552 3300037853 Bacteria 3479
281 Ga0395901_0030225 3300038443 Bacteria 5581
282 Ga0395901_0130496 3300038443 Bacteria 2640
283 Ga0436365_0797345 3300039437 Bacteria 3182
284 Ga0436365_0849775 3300039437 Bacteria 1309
285 Ga0436360_0783119 3300039438 Bacteria 8685
286 Ga0436360_1074859 3300039438 Unclassified 2093
287 Ga0436360_1133768 3300039438 Bacteria 1696
288 Ga0436361_0026690 3300039447 Bacteria 2446
289 Ga0436361_0673994 3300039447 Bacteria 1399
290 Ga0436363_0481999 3300039450 Unclassified 2786
291 Ga0436363_1134064 3300039450 Unclassified 2392
292 Ga0436363_1635646 3300039450 Bacteria 3703
293 Ga0436362_0715101 3300039453 Bacteria 2541
294 Ga0453683_0084354 3300044673 Bacteria 1990
295 Ga0466963_0109422 3300044694 Bacteria 1896
296 Ga0451576_0097068 3300045051 Bacteria 3065
297 Ga0466967_0127118 3300045976 Bacteria 2362
298 Ga0495592_0005252 3300046454 Bacteria 9542
299 Ga0495592_0032853 3300046454 Bacteria 3914
300 Ga0495592_0139590 3300046454 Bacteria 1687
301 Ga0495603_0039566 3300046455 Unclassified 2824
302 Ga0495629_0000622 3300046459 Bacteria 28827
303 Ga0495629_0004148 3300046459 Bacteria 10871
304 Ga0495629_0011575 3300046459 Bacteria 6407
305 Ga0495641_0024325 3300046461 Unclassified 2991
306 Ga0495651_0002105 3300046462 Bacteria 15367
307 Ga0495651_0005740 3300046462 Bacteria 9461
308 Ga0495651_0020450 3300046462 Bacteria 5139
309 Ga0495653_0004115 3300046463 Bacteria 11765
310 Ga0495653_0009155 3300046463 Bacteria 8096
311 Ga0495653_0014492 3300046463 Bacteria 6432
312 Ga0495580_0001503 3300046472 Bacteria 20499
313 Ga0495580_0042395 3300046472 Unclassified 3242
314 Ga0495582_0003798 3300046473 Bacteria 8505
315 Ga0495582_0024702 3300046473 Bacteria 3289
316 Ga0495639_0009088 3300046475 Unclassified 4260
317 Ga0495662_0003125 3300046476 Bacteria 8351
318 Ga0495664_0001322 3300046477 Bacteria 13014
319 Ga0495664_0002227 3300046477 Bacteria 10376
320 Ga0495584_0030752 3300046491 Bacteria 2719
321 Ga0495585_0078957 3300046492 Unclassified 1785
322 Ga0495594_0059812 3300046499 Unclassified 2107
323 Ga0495608_0000334 3300046511 Bacteria 33101
324 Ga0495608_0068734 3300046511 Bacteria 2316
325 Ga0495608_0103015 3300046511 Bacteria 1839
326 Ga0495618_0003061 3300046514 Bacteria 10550
327 Ga0495618_0016893 3300046514 Bacteria 4471
328 Ga0495628_0017393 3300046516 Bacteria 5988
329 Ga0495628_0060245 3300046516 Bacteria 2978
330 Ga0495628_0118154 3300046516 Unclassified 2036
331 Ga0495628_0122465 3300046516 Bacteria 1994
332 Ga0495630_0072677 3300046517 Bacteria 2589
333 Ga0495666_0025482 3300046526 Unclassified 2920
334 Ga0495652_0010713 3300046529 Bacteria 8307
335 Ga0495652_0014091 3300046529 Bacteria 7181
336 Ga0495652_0223100 3300046529 Bacteria 1415
337 Ga0495665_0030038 3300046531 Unclassified 2908
338 Ga0495640_0005703 3300046533 Bacteria 9897
339 Ga0495640_0029197 3300046533 Bacteria 3963
340 Ga0495640_0029406 3300046533 Bacteria 3946
341 Ga0495640_0047423 3300046533 Unclassified 2974
342 Ga0495586_0046526 3300046535 Unclassified 2339
343 Ga0495587_0002243 3300046536 Bacteria 12921
344 Ga0495587_0006904 3300046536 Bacteria 7383
345 Ga0495587_0008466 3300046536 Bacteria 6612
346 Ga0495587_0023172 3300046536 Bacteria 3817
347 Ga0495587_0026447 3300046536 Unclassified 3539
348 Ga0495645_0014868 3300046543 Bacteria 5530
349 Ga0495645_0025546 3300046543 Bacteria 4287
350 Ga0495622_0023621 3300046557 Unclassified 2867
351 Ga0495667_0002608 3300046559 Bacteria 12034
352 Ga0495667_0007119 3300046559 Bacteria 7584
353 Ga0495667_0009047 3300046559 Bacteria 6768
354 Ga0495667_0043575 3300046559 Unclassified 2973
355 Ga0495634_0006613 3300046642 Bacteria 8793
356 Ga0495634_0036686 3300046642 Bacteria 3351
357 Ga0495635_0005890 3300046663 Bacteria 8546
358 Ga0495635_0005942 3300046663 Bacteria 8516
359 Ga0495635_0016601 3300046663 Bacteria 5143
360 Ga0495635_0028614 3300046663 Bacteria 3874
361 Ga0495659_0032515 3300046664 Bacteria 1826
362 Ga0495657_0012347 3300046675 Bacteria 6347
363 Ga0495657_0015820 3300046675 Bacteria 5510
364 Ga0495657_0056386 3300046675 Bacteria 2616
365 Ga0495599_0007501 3300046678 Bacteria 6612
366 Ga0495599_0014752 3300046678 Unclassified 4838
367 Ga0495599_0033073 3300046678 Bacteria 3248
368 Ga0495623_0004310 3300046679 Bacteria 9365
369 Ga0495646_0003704 3300046680 Bacteria 9543
370 Ga0495646_0013785 3300046680 Bacteria 5140
371 Ga0495613_0028835 3300046689 Bacteria 4128
372 Ga0495613_0049840 3300046689 Bacteria 3089
373 Ga0495624_0033446 3300046690 Unclassified 3329
374 Ga0495624_0073590 3300046690 Bacteria 2124
375 Ga0495624_0088878 3300046690 Unclassified 1907
376 Ga0495670_0057035 3300046691 Bacteria 1960
377 Ga0495600_0005188 3300046809 Bacteria 7831
378 Ga0495600_0008751 3300046809 Bacteria 6230
379 Ga0495600_0132618 3300046809 Bacteria 1619
380 Ga0495604_0005715 3300047317 Bacteria 9865
381 Ga0495604_0012765 3300047317 Bacteria 6687
382 Ga0495604_0023769 3300047317 Bacteria 4891
383 Ga0495604_0123668 3300047317 Bacteria 1869
384 Ga0495636_0048598 3300047318 Bacteria 1773
385 Ga0495674_0003607 3300047319 Bacteria 15057
386 Ga0495674_0006616 3300047319 Bacteria 11107
387 Ga0495674_0010302 3300047319 Bacteria 8850
388 Ga0495674_0110850 3300047319 Bacteria 2327
389 Ga0495680_0009797 3300047322 Bacteria 8591
390 Ga0495680_0023799 3300047322 Bacteria 5089
391 Ga0495680_0027726 3300047322 Bacteria 4648
392 Ga0495675_0002705 3300047444 Bacteria 10625
393 Ga0495675_0013326 3300047444 Bacteria 5189
394 Ga0495675_0064628 3300047444 Bacteria 2314
395 Ga0495684_0001336 3300047471 Bacteria 19848
396 Ga0495684_0048349 3300047471 Bacteria 3253
397 Ga0495684_0073579 3300047471 Unclassified 2596
398 Ga0495593_0006372 3300047673 Bacteria 6922
399 Ga0495602_0004741 3300048088 Bacteria 14214
400 Ga0495602_0013793 3300048088 Bacteria 8240
401 Ga0495602_0040159 3300048088 Bacteria 4296
402 Ga0496102_0090843 3300048905 Bacteria 2826
403 Ga0496104_0004901 3300048907 Bacteria 11674
404 Ga0496104_0105383 3300048907 Unclassified 2702
405 Ga0496104_0152073 3300048907 Unclassified 2221
406 Ga0496105_0210103 3300048908 Unclassified 1586
407 Ga0496106_0012757 3300048909 Bacteria 6204
408 Ga0496106_0063562 3300048909 Bacteria 2806
409 Ga0496106_0066846 3300048909 Bacteria 2739
410 Ga0496107_0000617 3300048910 Bacteria 19921
411 Ga0496107_0123646 3300048910 Bacteria 1906
412 Ga0496109_0241801 3300048912 Bacteria 1699
413 Ga0496111_0041227 3300048914 Bacteria 3313
414 Ga0496114_0067291 3300048917 Bacteria 3005
415 Ga0496115_0015353 3300048918 Bacteria 5808
416 Ga0496115_0016980 3300048918 Bacteria 5551
417 Ga0496115_0284741 3300048918 Bacteria 1356
418 Ga0496119_0013608 3300048922 Bacteria 6460
419 Ga0501033_0074860 3300049570 Bacteria 2486
420 Ga0501034_0007426 3300049571 Bacteria 11666
421 Ga0501034_0068464 3300049571 Bacteria 3559
422 Ga0501034_0083380 3300049571 Bacteria 3198
423 Ga0501036_0000242 3300049572 Bacteria 36845
424 Ga0501036_0025763 3300049572 Bacteria 4963
425 Ga0501037_0041194 3300049573 Bacteria 3396
426 Ga0501038_0118709 3300049574 Bacteria 2183
427 Ga0501039_0004465 3300049575 Bacteria 10560
428 Ga0501040_0024053 3300049576 Bacteria 4087
429 Ga0501042_0136467 3300049578 Bacteria 1769
430 Ga0501043_0016378 3300049579 Bacteria 5812
431 Ga0501043_0038643 3300049579 Bacteria 3752
432 Ga0501046_0028292 3300049580 Bacteria 4566
433 Ga0501047_0000073 3300049581 Bacteria 125990
434 Ga0501048_0000014 3300049582 Bacteria 75001
435 Ga0501068_0036452 3300049584 Bacteria 2940
436 Ga0501068_0154563 3300049584 Bacteria 1443
437 Ga0501069_0019659 3300049585 Bacteria 3654
438 Ga0501069_0060436 3300049585 Bacteria 2115
439 Ga0501070_0021605 3300049586 Bacteria 5397
440 Ga0501070_0028141 3300049586 Bacteria 4713
441 Ga0501072_0338984 3300049588 Bacteria 1194
442 Ga0501073_0124972 3300049589 Bacteria 1783
443 Ga0501074_0015045 3300049590 Bacteria 5628
444 Ga0501076_0087119 3300049592 Bacteria 2510
445 Ga0501077_0056423 3300049593 Bacteria 2493
446 Ga0501079_0064328 3300049741 Bacteria 2829
447 Ga0501079_0097660 3300049741 Bacteria 2277
448 Ga0501080_0000187 3300049742 Bacteria 45224
449 Ga0501080_0012496 3300049742 Bacteria 7786
450 Ga0501083_0000139 3300049744 Bacteria 49384
451 Ga0501083_0024817 3300049744 Bacteria 4152
452 Ga0501035_0000923 3300049822 Bacteria 31113
453 Ga0501044_0002061 3300049823 Bacteria 23167
454 Ga0501044_0067771 3300049823 Bacteria 3635
455 Ga0501044_0161586 3300049823 Bacteria 2216
456 Ga0501045_0122749 3300049824 Bacteria 1929
457 nmdc:mga0yw44_7651_c1 3300050492 Bacteria 5329
458 nmdc:mga05p37_10134_c1 3300050507 Bacteria 11188
459 nmdc:mga05p37_15407_c1 3300050507 Bacteria 9186
460 nmdc:mga05p37_16845_c1 3300050507 Bacteria 8810
461 nmdc:mga05p37_19055_c1 3300050507 Bacteria 8300
462 nmdc:mga05p37_5293_c1 3300050507 Bacteria 15146
463 nmdc:mga05p37_54891_c1 3300050507 Bacteria 4900
464 nmdc:mga05p37_7808_c1 3300050507 Bacteria 12631
465 nmdc:mga09592_147069_c1 3300050508 Bacteria 2032
466 nmdc:mga09592_19123_c1 3300050508 Bacteria 5622
467 nmdc:mga09592_191767_c1 3300050508 Bacteria 1769
468 nmdc:mga09592_43335_c1 3300050508 Bacteria 3788
469 nmdc:mga09592_47462_c1 3300050508 Bacteria 3619
470 nmdc:mga09592_622_c1 3300050508 Bacteria 27059
471 nmdc:mga09592_68004_c1 3300050508 Bacteria 3022
472 nmdc:mga09592_7271_c1 3300050508 Bacteria 8998
473 nmdc:mga0qj67_15792_c1 3300050509 Bacteria 5720
474 nmdc:mga0qj67_341448_c1 3300050509 Bacteria 1211
475 nmdc:mga0qj67_37635_c1 3300050509 Bacteria 3792
476 nmdc:mga0qj67_67977_c1 3300050509 Bacteria 2840
477 nmdc:mga0qj67_88604_c1 3300050509 Bacteria 2485
478 nmdc:mga06r32_103737_c1 3300050510 Bacteria 2792
479 nmdc:mga06r32_122107_c1 3300050510 Bacteria 2570
480 nmdc:mga06r32_13316_c1 3300050510 Bacteria 7449
481 nmdc:mga06r32_165520_c1 3300050510 Bacteria 2194
482 nmdc:mga06r32_249032_c1 3300050510 Bacteria 1764
483 nmdc:mga06r32_266283_c1 3300050510 Bacteria 1701
484 nmdc:mga06r32_36412_c1 3300050510 Bacteria 4649
485 nmdc:mga06r32_4212_c1 3300050510 Bacteria 12885
486 nmdc:mga08y16_15679_c1 3300050511 Bacteria 7970
487 nmdc:mga08y16_168529_c1 3300050511 Bacteria 2275
488 nmdc:mga08y16_2391_c1 3300050511 Bacteria 19266
489 nmdc:mga08y16_291813_c1 3300050511 Unclassified 1681
490 nmdc:mga08y16_3943_c1 3300050511 Bacteria 15461
491 nmdc:mga08y16_41053_c1 3300050511 Bacteria 4847
492 nmdc:mga08y16_57887_c1 3300050511 Bacteria 4050
493 nmdc:mga08y16_8897_c1 3300050511 Bacteria 10543
494 nmdc:mga0n895_14085_c1 3300050512 Bacteria 7249
495 nmdc:mga0n895_171483_c1 3300050512 Bacteria 2202
496 nmdc:mga0n895_261665_c1 3300050512 Bacteria 1756
497 nmdc:mga0n895_64051_c1 3300050512 Bacteria 3636
498 nmdc:mga0n895_803_c1 3300050512 Bacteria 22459
499 nmdc:mga0rr50_143680_c1 3300050513 Bacteria 1922
500 nmdc:mga0rr50_20874_c1 3300050513 Bacteria 4459
501 nmdc:mga0rr50_30296_c2 3300050513 Unclassified 3026
502 nmdc:mga0rr50_32176_c1 3300050513 Bacteria 3734
503 nmdc:mga0a205_110_c1 3300050515 Bacteria 47857
504 nmdc:mga0a205_140553_c1 3300050515 Bacteria 2315
505 nmdc:mga0a205_221560_c1 3300050515 Bacteria 1777
506 nmdc:mga0a205_58264_c1 3300050515 Bacteria 3730
507 nmdc:mga0a205_60953_c1 3300050515 Bacteria 3644
508 nmdc:mga0a205_756_c1 3300050515 Bacteria 26070
509 nmdc:mga0a205_8603_c1 3300050515 Bacteria 9288
510 nmdc:mga0sz30_59186_c1 3300050516 Unclassified 1634
511 Ga0495601_0006790 3300053077 Bacteria 6703
512 Ga0495601_0011105 3300053077 Bacteria 5382
513 Ga0495601_0012070 3300053077 Bacteria 5179
514 Ga0495601_0013082 3300053077 Bacteria 4987
515 Ga0495601_0019145 3300053077 Bacteria 4172
516 Ga0495601_0044588 3300053077 Bacteria 2787
517 Ga0495612_0001955 3300053078 Bacteria 8487
518 Ga0495612_0002662 3300053078 Bacteria 7370
519 Ga0495612_0007325 3300053078 Unclassified 4512
520 Ga0495612_0009159 3300053078 Bacteria 4016
521 Ga0495595_0002153 3300053084 Bacteria 7651
522 Ga0495595_0029386 3300053084 Bacteria 2459
523 Ga0495619_0000275 3300053085 Bacteria 37064
524 Ga0495619_0002608 3300053085 Bacteria 11772
525 Ga0495619_0003005 3300053085 Bacteria 10949
526 Ga0495619_0003930 3300053085 Bacteria 9550
527 Ga0495619_0029569 3300053085 Unclassified 3540
528 Ga0495619_0054797 3300053085 Unclassified 2640
529 Ga0501082_0042661 3300060353 Bacteria 3910
530 Ga0501082_0156642 3300060353 Bacteria 1979
531 Ga0501082_0349059 3300060353 Bacteria 1290
532 Ga0530510_0000216 3300061734 Bacteria 35741
533 Ga0530510_0008762 3300061734 Bacteria 7075
534 Ga0530510_0041783 3300061734 Bacteria 3311
535 Ga0530510_0259624 3300061734 Bacteria 1295
536 Ga0373923_0025753
537 JGI25405J52794_10008178
538 Ga0058862_12536762
539 Ga0065707_10133138
540 Ga0065707_10142782
541 Ga0070680_100007875
542 Ga0070689_100130508
543 Ga0070691_10008857
544 Ga0070691_10090667
545 Ga0070668_100045815
546 Ga0070703_10003079
547 Ga0070703_10040009
548 Ga0070709_10099123
549 Ga0070714_100015036
550 Ga0070714_100082535
551 Ga0070714_100164550
552 Ga0070714_100244701
553 Ga0070713_100012886
554 Ga0070713_100079161
555 Ga0070713_100330027
556 Ga0070710_10006748
557 Ga0070710_10061982
558 Ga0070710_10062457
559 Ga0070701_10081850
560 Ga0070701_10112433
561 Ga0070711_100005180
562 Ga0070711_100036551
563 Ga0070705_100000168
564 Ga0070705_100084452
565 Ga0070700_100000385
566 Ga0070694_100000419
567 Ga0070694_100078859
568 Ga0070708_100036178
569 Ga0070708_100039278
570 Ga0070708_100068200
571 Ga0070708_100074926
572 Ga0070708_100075354
573 Ga0070708_100130367
574 Ga0070662_100022439
575 Ga0070681_10156699
576 Ga0070706_100035731
577 Ga0070706_100038462
578 Ga0070706_100049394
579 Ga0070706_100246508
580 Ga0070707_100017831
581 Ga0070707_100058307
582 Ga0070707_100139080
583 Ga0070698_100006325
584 Ga0070698_100026008
585 Ga0070698_100039213
586 Ga0070699_100000942
587 Ga0070699_100008877
588 Ga0070699_100021795
589 Ga0070699_100162880
590 Ga0070697_100005982
591 Ga0070697_100031092
592 Ga0070697_100038810
593 Ga0070697_100086681
594 Ga0070697_100289673
595 Ga0070697_100348938
596 Ga0070695_100001252
597 Ga0070696_100000036
598 Ga0070665_100111353
599 Ga0070704_100003406
600 Ga0070704_100013170
601 Ga0068857_100003558
602 Ga0068857_100324278
603 Ga0068854_100132415
604 Ga0070702_100004678
605 Ga0068859_100008868
606 Ga0068859_100151408
607 Ga0068859_100178087
608 Ga0068864_100165777
609 Ga0068861_100125373
610 Ga0068860_100000758
611 Ga0068862_100001849
612 Ga0068862_100062168
613 Ga0068862_100118179
614 Ga0068862_100199830
615 Ga0081455_10000029
616 Ga0081455_10008507
617 Ga0081455_10016441
618 Ga0081455_10044095
619 Ga0081455_10091762
620 Ga0081455_10170058
621 Ga0081538_10016075
622 Ga0081538_10028524
623 Ga0081540_1000048
624 Ga0081540_1028075
625 Ga0081540_1028436
626 Ga0081540_1032896
627 Ga0081540_1075143
628 Ga0081539_10060963
629 Ga0081539_10062471
630 Ga0070717_10010206
631 Ga0070717_10029715
632 Ga0075365_10009022
633 Ga0070715_10058922
634 Ga0070715_10068757
635 Ga0070716_100014301
636 Ga0070716_100033746
637 Ga0070712_100003449
638 Ga0070712_100032883
639 Ga0070712_100068655
640 Ga0097621_100187419
641 Ga0075428_100001527
642 Ga0075428_100010340
643 Ga0075428_100013241
644 Ga0075428_100038628
645 Ga0075428_100072069
646 Ga0075430_100010707
647 Ga0075430_100014405
648 Ga0075431_100004543
649 Ga0075431_100036678
650 Ga0075431_100039881
651 Ga0075431_100065330
652 Ga0075431_100131595
653 Ga0075431_100153329
654 Ga0075431_100160028
655 Ga0075433_10003363
656 Ga0075433_10054293
657 Ga0075433_10110733
658 Ga0075433_10115320
659 Ga0075434_100003494
660 Ga0075434_100016581
661 Ga0075434_100154036
662 Ga0075429_100010351
663 Ga0075429_100011787
664 Ga0075429_100012835
665 Ga0075429_100015266
666 Ga0075429_100049126
667 Ga0075429_100169134
668 Ga0075429_100189789
669 Ga0075429_100218835
670 Ga0097620_100008868
671 Ga0097620_100151402
672 Ga0097620_100178082
673 Ga0075435_100010323
674 Ga0075435_100037857
675 Ga0075435_100041257
676 Ga0099794_10025201
677 Ga0105240_10224979
678 Ga0111539_10003941
679 Ga0111539_10005401
680 Ga0111539_10014473
681 Ga0111539_10015972
682 Ga0111539_10021302
683 Ga0111539_10035914
684 Ga0111539_10046239
685 Ga0111539_10231873
686 Ga0114129_10078746
687 Ga0114129_10099059
688 Ga0114129_10133312
689 Ga0114129_10263431
690 Ga0114129_10273049
691 Ga0114129_10394598
692 Ga0114129_10570315
693 Ga0105243_10144508
694 Ga0105248_10013418
695 Ga0105249_10041585
696 Ga0105249_10147706
697 Ga0099796_10011689
698 Ga0163162_10083534
699 Ga0163162_10373463
700 Ga0163162_10470508
701 Ga0157375_10083479
702 Ga0157375_10391411
703 Ga0163163_10193543
704 Ga0157380_10070960
705 Ga0157380_10326536
706 Ga0182008_10008891
707 Ga0157379_10166631
708 Ga0157379_10372636
709 Ga0157376_10005231
710 Ga0206354_11109142
711 Ga0213875_10000040
712 Ga0213875_10005765
713 Ga0228598_1000978
714 Ga0207653_10009711
715 Ga0207692_10060852
716 Ga0207685_10043139
717 Ga0207699_10042617
718 Ga0207699_10085771
719 Ga0207699_10144986
720 Ga0207684_10010021
721 Ga0207684_10014997
722 Ga0207684_10041578
723 Ga0207684_10055118
724 Ga0207693_10003102
725 Ga0207693_10005772
726 Ga0207663_10025511
727 Ga0207663_10100524
728 Ga0207663_10113099
729 Ga0207646_10017430
730 Ga0207646_10034864
731 Ga0207700_10038921
732 Ga0207700_10068997
733 Ga0207700_10070240
734 Ga0207664_10144308
735 Ga0207670_10091909
736 Ga0207665_10014743
737 Ga0207665_10023770
738 Ga0207665_10041147
739 Ga0207711_10025823
740 Ga0207712_10003701
741 Ga0207712_10157174
742 Ga0207712_10216536
743 Ga0207640_10154875
744 Ga0207708_10004871
745 Ga0207676_10247325
746 Ga0207674_10003588
747 Ga0207674_10273149
748 Ga0207675_100193792
749 Ga0207675_100260672
750 Ga0207675_100305144
751 Ga0207428_10000118
752 Ga0207428_10000190
753 Ga0207428_10020682
754 Ga0207428_10033427
755 Ga0207428_10077730
756 Ga0268265_10001993
757 Ga0268265_10060240
758 Ga0268264_10000704
759 Ga0265316_10119564
760 Ga0373950_0004548
761 Ga0373926_0011034
762 Ga0373934_0004212
763 Ga0373923_0000338
764 Ga0373936_0011734
765 Ga0373939_0007075
766 Ga0373954_0002145
767 Ga0373954_0014164
768 Ga0373956_0011166
769 Ga0373956_0027994
770 Ga0373956_0065170
771 Ga0373957_0020298
772 Ga0373957_0029497
773 Ga0373960_0003603
774 Ga0373960_0017850
775 Ga0373960_0033722
776 Ga0373943_0068588
777 Ga0373946_0064562
778 Ga0373955_0001825
779 Ga0373955_0005433
780 Ga0373955_0005508
781 Ga0373955_0030489
782 Ga0373942_0012262
783 Ga0373924_0004580
784 Ga0373924_0026194
785 Ga0373924_0040826
786 Ga0373931_0000155
787 Ga0373931_0145450
788 Ga0373927_0023781
789 Ga0373927_0042698
790 Ga0373933_0002999
791 Ga0373933_0003046
792 Ga0373933_0004902
793 Ga0373947_0030828
794 Ga0373947_0100647
795 Ga0373937_0009235
796 Ga0373937_0012636
797 Ga0373937_0024940
798 Ga0373937_0079281
799 Ga0373937_0084776
800 Ga0373937_0113128
801 Ga0373925_0006276
802 Ga0373925_0037185
803 Ga0373925_0044188
804 Ga0373925_0067708
805 Ga0373925_0151804
806 Ga0373925_0177916
807 Ga0395899_0069486
808 Ga0395900_0001852
809 Ga0395898_0009827
810 Ga0395898_0067455
811 Ga0436364_0368943
812 Ga0436364_0387740
813 Ga0436364_0411364
814 Ga0436364_0586291
815 Ga0436364_0635552
816 Ga0395901_0030225
817 Ga0395901_0130496
818 Ga0436365_0797345
819 Ga0436365_0849775
820 Ga0436360_0783119
821 Ga0436360_1074859
822 Ga0436360_1133768
823 Ga0436361_0026690
824 Ga0436361_0673994
825 Ga0436363_0481999
826 Ga0436363_1134064
827 Ga0436363_1635646
828 Ga0436362_0715101
829 Ga0453683_0084354
830 Ga0466963_0109422
831 Ga0451576_0097068
832 Ga0466967_0127118
833 Ga0495592_0005252
834 Ga0495592_0032853
835 Ga0495592_0139590
836 Ga0495603_0039566
837 Ga0495629_0000622
838 Ga0495629_0004148
839 Ga0495629_0011575
840 Ga0495641_0024325
841 Ga0495651_0002105
842 Ga0495651_0005740
843 Ga0495651_0020450
844 Ga0495653_0004115
845 Ga0495653_0009155
846 Ga0495653_0014492
847 Ga0495580_0001503
848 Ga0495580_0042395
849 Ga0495582_0003798
850 Ga0495582_0024702
851 Ga0495639_0009088
852 Ga0495662_0003125
853 Ga0495664_0001322
854 Ga0495664_0002227
855 Ga0495584_0030752
856 Ga0495585_0078957
857 Ga0495594_0059812
858 Ga0495608_0000334
859 Ga0495608_0068734
860 Ga0495608_0103015
861 Ga0495618_0003061
862 Ga0495618_0016893
863 Ga0495628_0017393
864 Ga0495628_0060245
865 Ga0495628_0118154
866 Ga0495628_0122465
867 Ga0495630_0072677
868 Ga0495666_0025482
869 Ga0495652_0010713
870 Ga0495652_0014091
871 Ga0495652_0223100
872 Ga0495665_0030038
873 Ga0495640_0005703
874 Ga0495640_0029197
875 Ga0495640_0029406
876 Ga0495640_0047423
877 Ga0495586_0046526
878 Ga0495587_0002243
879 Ga0495587_0006904
880 Ga0495587_0008466
881 Ga0495587_0023172
882 Ga0495587_0026447
883 Ga0495645_0014868
884 Ga0495645_0025546
885 Ga0495622_0023621
886 Ga0495667_0002608
887 Ga0495667_0007119
888 Ga0495667_0009047
889 Ga0495667_0043575
890 Ga0495634_0006613
891 Ga0495634_0036686
892 Ga0495635_0005890
893 Ga0495635_0005942
894 Ga0495635_0016601
895 Ga0495635_0028614
896 Ga0495659_0032515
897 Ga0495657_0012347
898 Ga0495657_0015820
899 Ga0495657_0056386
900 Ga0495599_0007501
901 Ga0495599_0014752
902 Ga0495599_0033073
903 Ga0495623_0004310
904 Ga0495646_0003704
905 Ga0495646_0013785
906 Ga0495613_0028835
907 Ga0495613_0049840
908 Ga0495624_0033446
909 Ga0495624_0073590
910 Ga0495624_0088878
911 Ga0495670_0057035
912 Ga0495600_0005188
913 Ga0495600_0008751
914 Ga0495600_0132618
915 Ga0495604_0005715
916 Ga0495604_0012765
917 Ga0495604_0023769
918 Ga0495604_0123668
919 Ga0495636_0048598
920 Ga0495674_0003607
921 Ga0495674_0006616
922 Ga0495674_0010302
923 Ga0495674_0110850
924 Ga0495680_0009797
925 Ga0495680_0023799
926 Ga0495680_0027726
927 Ga0495675_0002705
928 Ga0495675_0013326
929 Ga0495675_0064628
930 Ga0495684_0001336
931 Ga0495684_0048349
932 Ga0495684_0073579
933 Ga0495593_0006372
934 Ga0495602_0004741
935 Ga0495602_0013793
936 Ga0495602_0040159
937 Ga0496102_0090843
938 Ga0496104_0004901
939 Ga0496104_0105383
940 Ga0496104_0152073
941 Ga0496105_0210103
942 Ga0496106_0012757
943 Ga0496106_0063562
944 Ga0496106_0066846
945 Ga0496107_0000617
946 Ga0496107_0123646
947 Ga0496109_0241801
948 Ga0496111_0041227
949 Ga0496114_0067291
950 Ga0496115_0015353
951 Ga0496115_0016980
952 Ga0496115_0284741
953 Ga0496119_0013608
954 Ga0501033_0074860
955 Ga0501034_0007426
956 Ga0501034_0068464
957 Ga0501034_0083380
958 Ga0501036_0000242
959 Ga0501036_0025763
960 Ga0501037_0041194
961 Ga0501038_0118709
962 Ga0501039_0004465
963 Ga0501040_0024053
964 Ga0501042_0136467
965 Ga0501043_0016378
966 Ga0501043_0038643
967 Ga0501046_0028292
968 Ga0501047_0000073
969 Ga0501048_0000014
970 Ga0501068_0036452
971 Ga0501068_0154563
972 Ga0501069_0019659
973 Ga0501069_0060436
974 Ga0501070_0021605
975 Ga0501070_0028141
976 Ga0501072_0338984
977 Ga0501073_0124972
978 Ga0501074_0015045
979 Ga0501076_0087119
980 Ga0501077_0056423
981 Ga0501079_0064328
982 Ga0501079_0097660
983 Ga0501080_0000187
984 Ga0501080_0012496
985 Ga0501083_0000139
986 Ga0501083_0024817
987 Ga0501035_0000923
988 Ga0501044_0002061
989 Ga0501044_0067771
990 Ga0501044_0161586
991 Ga0501045_0122749
992 nmdc:mga0yw44_7651_c1
993 nmdc:mga05p37_10134_c1
994 nmdc:mga05p37_15407_c1
995 nmdc:mga05p37_16845_c1
996 nmdc:mga05p37_19055_c1
997 nmdc:mga05p37_5293_c1
998 nmdc:mga05p37_54891_c1
999 nmdc:mga05p37_7808_c1
1000 nmdc:mga09592_147069_c1
1001 nmdc:mga09592_19123_c1
1002 nmdc:mga09592_191767_c1
1003 nmdc:mga09592_43335_c1
1004 nmdc:mga09592_47462_c1
1005 nmdc:mga09592_622_c1
1006 nmdc:mga09592_68004_c1
1007 nmdc:mga09592_7271_c1
1008 nmdc:mga0qj67_15792_c1
1009 nmdc:mga0qj67_341448_c1
1010 nmdc:mga0qj67_37635_c1
1011 nmdc:mga0qj67_67977_c1
1012 nmdc:mga0qj67_88604_c1
1013 nmdc:mga06r32_103737_c1
1014 nmdc:mga06r32_122107_c1
1015 nmdc:mga06r32_13316_c1
1016 nmdc:mga06r32_165520_c1
1017 nmdc:mga06r32_249032_c1
1018 nmdc:mga06r32_266283_c1
1019 nmdc:mga06r32_36412_c1
1020 nmdc:mga06r32_4212_c1
1021 nmdc:mga08y16_15679_c1
1022 nmdc:mga08y16_168529_c1
1023 nmdc:mga08y16_2391_c1
1024 nmdc:mga08y16_291813_c1
1025 nmdc:mga08y16_3943_c1
1026 nmdc:mga08y16_41053_c1
1027 nmdc:mga08y16_57887_c1
1028 nmdc:mga08y16_8897_c1
1029 nmdc:mga0n895_14085_c1
1030 nmdc:mga0n895_171483_c1
1031 nmdc:mga0n895_261665_c1
1032 nmdc:mga0n895_64051_c1
1033 nmdc:mga0n895_803_c1
1034 nmdc:mga0rr50_143680_c1
1035 nmdc:mga0rr50_20874_c1
1036 nmdc:mga0rr50_30296_c2
1037 nmdc:mga0rr50_32176_c1
1038 nmdc:mga0a205_110_c1
1039 nmdc:mga0a205_140553_c1
1040 nmdc:mga0a205_221560_c1
1041 nmdc:mga0a205_58264_c1
1042 nmdc:mga0a205_60953_c1
1043 nmdc:mga0a205_756_c1
1044 nmdc:mga0a205_8603_c1
1045 nmdc:mga0sz30_59186_c1
1046 Ga0495601_0006790
1047 Ga0495601_0011105
1048 Ga0495601_0012070
1049 Ga0495601_0013082
1050 Ga0495601_0019145
1051 Ga0495601_0044588
1052 Ga0495612_0001955
1053 Ga0495612_0002662
1054 Ga0495612_0007325
1055 Ga0495612_0009159
1056 Ga0495595_0002153
1057 Ga0495595_0029386
1058 Ga0495619_0000275
1059 Ga0495619_0002608
1060 Ga0495619_0003005
1061 Ga0495619_0003930
1062 Ga0495619_0029569
1063 Ga0495619_0054797
1064 Ga0501082_0042661
1065 Ga0501082_0156642
1066 Ga0501082_0349059
1067 Ga0530510_0000216
1068 Ga0530510_0008762
1069 Ga0530510_0041783
1070 Ga0530510_0259624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

81

457

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vgq-assembly1.cif.gz_B formyl-coa transferase mutant asp169 to ala 0.9389 11 407
1pt8-assembly1.cif.gz_B crystal structure of the yfdw gene product of e. coli, in complex with oxalate and acetyl-coa 0.9364 10 408
2vjk-assembly1.cif.gz_B formyl-coa transferase with aspartyl-coa thioester intermediate derived from oxalyl-coa 0.9359 11 407
2vjq-assembly1.cif.gz_B formyl-coa transferase mutant variant w48q 0.9334 11 407
1t3z-assembly1.cif.gz_B formyl-coa tranferase mutant asp169 to ser 0.9323 11 407
ID Description Score Start End Superfamily
1pt8B02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9307 242 330 3.30.1540.10
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9195 31 232 3.40.50.10540
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9122 11 295 3.40.50.10540
4hl6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9053 13 391 3.40.50.10540
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9031 238 330 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A2V6PRP9-F1-model_v4 Formyl-CoA transferase (EC 2.8.3.16) 0.9583 3 408 GO:0033608
AF-A0A2V6ZGT8-F1-model_v4 Formyl-CoA transferase (EC 2.8.3.16) 0.9567 1 323 GO:0033608
AF-A0A3D5DEB0-F1-model_v4 Formyl-CoA transferase 0.9537 11 329 GO:0008410
AF-A0A2V6PRP9-F1-model_v4 Formyl-CoA transferase (EC 2.8.3.16) 0.9537 3 408 GO:0033608
AF-A0A2V6TU85-F1-model_v4 Formyl-CoA transferase (EC 2.8.3.16) 0.9528 11 299 GO:0033608

Map