F460675

General Info

Members Datasets Scaffolds Average Seq Length
535 246 1070 245

Family's Representative Sequence

Representative Sequence 3300027876|Ga0209974_10036593|Ga0209974_100365933
Length 280
Sequence MRAATNGYVAYVTINVTQRHEDHRNHTGEICMSGHSKWSKVKHIKAVQDAKRGKAFTKVIKEITVAARIGGGDPDGNPRLRSAVMAAKQANMPGDNIKRAIQKGTGELPGVMYDEINYEGYGPGGVAILVEAMTDNKNRTVSEMRYVFSRNNGNMAEAGSVSWMFTKRGSIVIDKNAVSEDKLMEVALEAGADDIQEDEGNFEVLTAPEAFHKVTSALQAAAIPTLSAELAMIPQTWIKLTGKEAQQVLKLVEALEDHEDVQKVWANFDISEEELVQLAG

Samples

Sample ID Description Type Environment
1 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
153 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
164 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
165 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
166 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
187 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
188 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 2.43
Rhizosphere 96.82
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209974_10036593 3300027876 Bacteria 1630
2 Ga0065707_10113813 3300005295 Bacteria 2315
3 Ga0070676_10008326 3300005328 Bacteria 5588
4 Ga0070676_10161492 3300005328 Bacteria 1442
5 Ga0070690_100191390 3300005330 Bacteria 1418
6 Ga0070690_100221779 3300005330 Bacteria 1325
7 Ga0070670_100013837 3300005331 Bacteria 6919
8 Ga0070677_10019443 3300005333 Bacteria 2460
9 Ga0070677_10048577 3300005333 Bacteria 1706
10 Ga0068869_100115772 3300005334 Bacteria 2045
11 Ga0070666_10000282 3300005335 Bacteria 33636
12 Ga0070666_10033899 3300005335 Bacteria 3382
13 Ga0070666_10072843 3300005335 Bacteria 2339
14 Ga0068868_100006304 3300005338 Bacteria 8384
15 Ga0068868_100062549 3300005338 Bacteria 2950
16 Ga0070689_100010761 3300005340 Bacteria 6534
17 Ga0070689_100027067 3300005340 Bacteria 4321
18 Ga0070689_100269159 3300005340 Bacteria 1410
19 Ga0070689_100639053 3300005340 Bacteria 925
20 Ga0070692_10027529 3300005345 Bacteria 2819
21 Ga0070692_10111526 3300005345 Bacteria 1513
22 Ga0070668_100092342 3300005347 Bacteria 2387
23 Ga0070668_100121075 3300005347 Bacteria 2092
24 Ga0070669_100002519 3300005353 Bacteria 13253
25 Ga0070669_100107114 3300005353 Bacteria 2117
26 Ga0070669_100121211 3300005353 Bacteria 1995
27 Ga0070669_100333503 3300005353 Bacteria 1227
28 Ga0070675_100034168 3300005354 Bacteria 4125
29 Ga0070675_100236930 3300005354 Bacteria 1593
30 Ga0070671_100026232 3300005355 Bacteria 4787
31 Ga0070674_100046557 3300005356 Bacteria 2968
32 Ga0070674_100524572 3300005356 Bacteria 990
33 Ga0070673_100011133 3300005364 Bacteria 6133
34 Ga0070673_100021249 3300005364 Bacteria 4700
35 Ga0070688_100014396 3300005365 Bacteria 4480
36 Ga0070659_100099451 3300005366 Bacteria 2340
37 Ga0070659_100298587 3300005366 Bacteria 1343
38 Ga0070667_100149508 3300005367 Bacteria 2051
39 Ga0070667_100237970 3300005367 Bacteria 1625
40 Ga0070709_10000889 3300005434 Bacteria 16738
41 Ga0070700_100114438 3300005441 Bacteria 1798
42 Ga0070700_100203863 3300005441 Bacteria 1391
43 Ga0070694_100006886 3300005444 Bacteria 6907
44 Ga0070708_100001944 3300005445 Bacteria 15950
45 Ga0070708_100004799 3300005445 Bacteria 10664
46 Ga0070708_100010636 3300005445 Bacteria 7460
47 Ga0070708_100074490 3300005445 Bacteria 3062
48 Ga0070708_100170225 3300005445 Bacteria 2033
49 Ga0070663_100006038 3300005455 Bacteria 7250
50 Ga0070663_100070576 3300005455 Bacteria 2541
51 Ga0070663_100312119 3300005455 Bacteria 1262
52 Ga0070678_100003521 3300005456 Bacteria 8734
53 Ga0070662_100018253 3300005457 Bacteria 4743
54 Ga0070662_100057822 3300005457 Bacteria 2819
55 Ga0070662_100266148 3300005457 Bacteria 1382
56 Ga0068867_100156775 3300005459 Bacteria 1793
57 Ga0070706_100001720 3300005467 Bacteria 22739
58 Ga0070706_100003987 3300005467 Bacteria 14371
59 Ga0070706_100010283 3300005467 Bacteria 8694
60 Ga0070706_100070610 3300005467 Bacteria 3229
61 Ga0070707_100000742 3300005468 Bacteria 32317
62 Ga0070707_100011579 3300005468 Bacteria 8228
63 Ga0070707_100083304 3300005468 Bacteria 3090
64 Ga0070707_100234491 3300005468 Bacteria 1786
65 Ga0070707_100252294 3300005468 Bacteria 1717
66 Ga0070698_100015484 3300005471 Bacteria 8055
67 Ga0070698_100086527 3300005471 Bacteria 3120
68 Ga0070698_100137000 3300005471 Bacteria 2401
69 Ga0070699_100000007 3300005518 Bacteria 310847
70 Ga0070699_100072778 3300005518 Bacteria 2990
71 Ga0070684_100294148 3300005535 Unclassified 1489
72 Ga0070697_100004976 3300005536 Bacteria 10204
73 Ga0070672_100022029 3300005543 Bacteria 4673
74 Ga0070672_100095006 3300005543 Bacteria 2411
75 Ga0070672_100285520 3300005543 Bacteria 1396
76 Ga0070686_100147382 3300005544 Bacteria 1645
77 Ga0070695_100020933 3300005545 Bacteria 3997
78 Ga0070695_100079698 3300005545 Bacteria 2162
79 Ga0070695_100292154 3300005545 Bacteria 1202
80 Ga0070693_100131194 3300005547 Bacteria 1567
81 Ga0070693_100246333 3300005547 Bacteria 1183
82 Ga0070665_100023239 3300005548 Bacteria 6244
83 Ga0070665_100246902 3300005548 Bacteria 1785
84 Ga0070704_100055414 3300005549 Bacteria 2811
85 Ga0070704_100155527 3300005549 Bacteria 1803
86 Ga0070704_100165983 3300005549 Bacteria 1751
87 Ga0068855_100195425 3300005563 Bacteria 2279
88 Ga0070664_100008746 3300005564 Bacteria 8199
89 Ga0068857_100237838 3300005577 Bacteria 1667
90 Ga0068856_100213449 3300005614 Bacteria 1945
91 Ga0068852_100033265 3300005616 Bacteria 4278
92 Ga0068859_100000660 3300005617 Bacteria 34582
93 Ga0068859_100026805 3300005617 Bacteria 5781
94 Ga0068859_100058029 3300005617 Bacteria 3899
95 Ga0068859_100234664 3300005617 Bacteria 1923
96 Ga0068864_100008999 3300005618 Bacteria 8233
97 Ga0068864_100019448 3300005618 Bacteria 5677
98 Ga0068866_10045992 3300005718 Bacteria 2192
99 Ga0068866_10097315 3300005718 Bacteria 1616
100 Ga0068861_100140608 3300005719 Bacteria 1970
101 Ga0068861_100163617 3300005719 Bacteria 1838
102 Ga0068870_10011829 3300005840 Bacteria 4059
103 Ga0068863_100098055 3300005841 Bacteria 2783
104 Ga0068863_101155273 3300005841 Bacteria 779
105 Ga0068858_100093956 3300005842 Bacteria 2792
106 Ga0068858_100270567 3300005842 Bacteria 1617
107 Ga0068860_100013509 3300005843 Bacteria 8006
108 Ga0068860_100025187 3300005843 Bacteria 5741
109 Ga0068860_100054407 3300005843 Bacteria 3805
110 Ga0068860_100265257 3300005843 Bacteria 1675
111 Ga0068860_100377959 3300005843 Bacteria 1398
112 Ga0068860_100801232 3300005843 Bacteria 955
113 Ga0068862_100025800 3300005844 Bacteria 4935
114 Ga0068862_100052534 3300005844 Bacteria 3487
115 Ga0068862_100100090 3300005844 Bacteria 2535
116 Ga0081455_10015178 3300005937 Bacteria 7495
117 Ga0081455_10032068 3300005937 Bacteria 4741
118 Ga0081455_10397712 3300005937 Bacteria 957
119 Ga0081539_10000025 3300005985 Bacteria 340255
120 Ga0070716_100010227 3300006173 Bacteria 4701
121 Ga0097621_100054937 3300006237 Bacteria 3250
122 Ga0097621_100332444 3300006237 Bacteria 1348
123 Ga0068871_100016049 3300006358 Bacteria 5628
124 Ga0068871_100153546 3300006358 Bacteria 1965
125 Ga0068871_100192701 3300006358 Bacteria 1756
126 Ga0075428_100083055 3300006844 Bacteria 3495
127 Ga0075428_100110827 3300006844 Bacteria 2990
128 Ga0075428_100223371 3300006844 Unclassified 2033
129 Ga0075428_100346591 3300006844 Unclassified 1594
130 Ga0075428_100425494 3300006844 Bacteria 1423
131 Ga0075430_100020541 3300006846 Bacteria 5617
132 Ga0075431_100025624 3300006847 Bacteria 6046
133 Ga0075431_100041945 3300006847 Bacteria 4719
134 Ga0075431_100069320 3300006847 Unclassified 3638
135 Ga0075431_100627233 3300006847 Bacteria 1057
136 Ga0075433_10045083 3300006852 Bacteria 3832
137 Ga0075433_10299817 3300006852 Bacteria 1423
138 Ga0075434_100001071 3300006871 Bacteria 22374
139 Ga0075434_100036902 3300006871 Bacteria 4836
140 Ga0075434_100090350 3300006871 Bacteria 3064
141 Ga0075429_100085806 3300006880 Bacteria 2744
142 Ga0075429_100134287 3300006880 Bacteria 2165
143 Ga0075429_100288882 3300006880 Bacteria 1436
144 Ga0068865_100177121 3300006881 Bacteria 1639
145 Ga0068865_100353926 3300006881 Bacteria 1190
146 Ga0097620_100000660 3300006931 Bacteria 34582
147 Ga0097620_100026806 3300006931 Bacteria 5781
148 Ga0097620_100058036 3300006931 Bacteria 3899
149 Ga0097620_100234676 3300006931 Bacteria 1923
150 Ga0075435_100024407 3300007076 Bacteria 4692
151 Ga0075435_100027643 3300007076 Bacteria 4440
152 Ga0075435_100030198 3300007076 Bacteria 4259
153 Ga0075435_100093410 3300007076 Bacteria 2486
154 Ga0105240_10025978 3300009093 Bacteria 7691
155 Ga0105240_10296251 3300009093 Bacteria 1852
156 Ga0105240_10511312 3300009093 Bacteria 1334
157 Ga0111539_10013393 3300009094 Bacteria 10253
158 Ga0111539_10226727 3300009094 Bacteria 2176
159 Ga0111539_10299853 3300009094 Bacteria 1870
160 Ga0111539_10349029 3300009094 Unclassified 1722
161 Ga0111539_10508520 3300009094 Bacteria 1403
162 Ga0105245_10021526 3300009098 Bacteria 5657
163 Ga0105245_10178931 3300009098 Bacteria 2025
164 Ga0105245_10492385 3300009098 Bacteria 1241
165 Ga0105245_10623040 3300009098 Bacteria 1107
166 Ga0114129_10000574 3300009147 Bacteria 45251
167 Ga0114129_10004306 3300009147 Bacteria 20116
168 Ga0114129_10063442 3300009147 Bacteria 5159
169 Ga0114129_10145276 3300009147 Bacteria 3250
170 Ga0114129_10169895 3300009147 Bacteria 2973
171 Ga0114129_10515345 3300009147 Bacteria 1560
172 Ga0105243_10222829 3300009148 Bacteria 1668
173 Ga0105242_10042444 3300009176 Bacteria 3673
174 Ga0105242_10207270 3300009176 Bacteria 1745
175 Ga0105248_10007321 3300009177 Bacteria 12112
176 Ga0105249_10002574 3300009553 Bacteria 15692
177 Ga0105249_10081680 3300009553 Bacteria 3005
178 Ga0105249_10152275 3300009553 Bacteria 2227
179 Ga0105249_10535075 3300009553 Bacteria 1221
180 Ga0099796_10027897 3300010159 Bacteria 1808
181 Ga0105239_10003630 3300010375 Bacteria 18865
182 Ga0157374_10018468 3300013296 Bacteria 6155
183 Ga0157378_10195391 3300013297 Bacteria 1911
184 Ga0163162_10076654 3300013306 Bacteria 3406
185 Ga0163162_10113497 3300013306 Bacteria 2808
186 Ga0157375_10020625 3300013308 Bacteria 6025
187 Ga0157375_10206843 3300013308 Bacteria 2119
188 Ga0157375_10386442 3300013308 Bacteria 1566
189 Ga0163163_10067562 3300014325 Bacteria 3555
190 Ga0157380_10067758 3300014326 Bacteria 2875
191 Ga0157380_10112370 3300014326 Bacteria 2292
192 Ga0157380_10155950 3300014326 Bacteria 1979
193 Ga0157379_10024444 3300014968 Bacteria 5363
194 Ga0157376_10082390 3300014969 Bacteria 2764
195 Ga0163161_10011991 3300017792 Bacteria 6012
196 Ga0163161_10024629 3300017792 Bacteria 4253
197 Ga0163161_10399558 3300017792 Bacteria 1102
198 Ga0224712_10004733 3300022467 Bacteria 3707
199 Ga0224712_10174351 3300022467 Bacteria 966
200 Ga0207697_10035412 3300025315 Bacteria 2044
201 Ga0207697_10036636 3300025315 Bacteria 2009
202 Ga0207682_10002808 3300025893 Bacteria 7700
203 Ga0207682_10010982 3300025893 Bacteria 3547
204 Ga0207682_10050130 3300025893 Bacteria 1725
205 Ga0207682_10233921 3300025893 Unclassified 852
206 Ga0207642_10234541 3300025899 Bacteria 1033
207 Ga0207710_10166170 3300025900 Bacteria 1077
208 Ga0207688_10087855 3300025901 Bacteria 1782
209 Ga0207680_10001923 3300025903 Bacteria 9740
210 Ga0207680_10073325 3300025903 Bacteria 2128
211 Ga0207699_10000026 3300025906 Bacteria 152387
212 Ga0207645_10001092 3300025907 Bacteria 22384
213 Ga0207645_10004007 3300025907 Bacteria 10981
214 Ga0207645_10015302 3300025907 Bacteria 5101
215 Ga0207645_10102158 3300025907 Bacteria 1850
216 Ga0207645_10258415 3300025907 Bacteria 1153
217 Ga0207645_10315454 3300025907 Bacteria 1042
218 Ga0207643_10022606 3300025908 Bacteria 3463
219 Ga0207684_10000543 3300025910 Bacteria 46477
220 Ga0207684_10019561 3300025910 Bacteria 5791
221 Ga0207684_10107612 3300025910 Bacteria 2385
222 Ga0207684_10210058 3300025910 Unclassified 1679
223 Ga0207695_10019676 3300025913 Bacteria 7763
224 Ga0207660_10477176 3300025917 Bacteria 1010
225 Ga0207662_10026535 3300025918 Bacteria 3341
226 Ga0207646_10000623 3300025922 Bacteria 46113
227 Ga0207646_10004706 3300025922 Bacteria 14709
228 Ga0207646_10016925 3300025922 Bacteria 6831
229 Ga0207646_10201948 3300025922 Bacteria 1796
230 Ga0207646_10258011 3300025922 Bacteria 1575
231 Ga0207681_10011152 3300025923 Bacteria 5519
232 Ga0207681_10048663 3300025923 Bacteria 2862
233 Ga0207681_10130693 3300025923 Bacteria 1856
234 Ga0207681_10210130 3300025923 Bacteria 1499
235 Ga0207681_10245912 3300025923 Bacteria 1394
236 Ga0207650_10024208 3300025925 Bacteria 4313
237 Ga0207650_10227636 3300025925 Unclassified 1503
238 Ga0207650_10342747 3300025925 Bacteria 1228
239 Ga0207659_10034829 3300025926 Bacteria 3476
240 Ga0207659_10055242 3300025926 Bacteria 2839
241 Ga0207659_10135035 3300025926 Bacteria 1909
242 Ga0207659_10833236 3300025926 Bacteria 793
243 Ga0207687_10088382 3300025927 Bacteria 2254
244 Ga0207687_10291710 3300025927 Bacteria 1311
245 Ga0207687_10372851 3300025927 Bacteria 1167
246 Ga0207664_10834797 3300025929 Bacteria 828
247 Ga0207644_10427846 3300025931 Bacteria 1085
248 Ga0207644_10746801 3300025931 Bacteria 817
249 Ga0207706_10062984 3300025933 Bacteria 3266
250 Ga0207706_10142153 3300025933 Bacteria 2111
251 Ga0207706_10241735 3300025933 Bacteria 1578
252 Ga0207706_10339908 3300025933 Bacteria 1306
253 Ga0207706_10468025 3300025933 Bacteria 1089
254 Ga0207686_10330681 3300025934 Bacteria 1141
255 Ga0207670_10096862 3300025936 Bacteria 2099
256 Ga0207670_10170096 3300025936 Bacteria 1633
257 Ga0207670_10567489 3300025936 Bacteria 929
258 Ga0207669_10033450 3300025937 Bacteria 2902
259 Ga0207669_10047902 3300025937 Bacteria 2535
260 Ga0207669_10060073 3300025937 Bacteria 2328
261 Ga0207669_10108318 3300025937 Bacteria 1855
262 Ga0207669_10439939 3300025937 Bacteria 1031
263 Ga0207704_10142824 3300025938 Bacteria 1677
264 Ga0207665_10006635 3300025939 Bacteria 7679
265 Ga0207691_10024698 3300025940 Bacteria 5651
266 Ga0207691_10030695 3300025940 Bacteria 5020
267 Ga0207691_10115507 3300025940 Bacteria 2383
268 Ga0207691_10176410 3300025940 Bacteria 1869
269 Ga0207691_10335759 3300025940 Unclassified 1294
270 Ga0207691_10628994 3300025940 Bacteria 908
271 Ga0207711_10005446 3300025941 Bacteria 10759
272 Ga0207711_10103662 3300025941 Bacteria 2519
273 Ga0207711_10190210 3300025941 Bacteria 1870
274 Ga0207711_10338357 3300025941 Bacteria 1392
275 Ga0207689_10009401 3300025942 Bacteria 8443
276 Ga0207689_10105238 3300025942 Bacteria 2318
277 Ga0207679_10133326 3300025945 Bacteria 1996
278 Ga0207679_10856454 3300025945 Bacteria 830
279 Ga0207651_10000527 3300025960 Bacteria 16072
280 Ga0207651_10169937 3300025960 Bacteria 1718
281 Ga0207712_10011488 3300025961 Bacteria 5643
282 Ga0207712_10189931 3300025961 Bacteria 1621
283 Ga0207712_10300170 3300025961 Bacteria 1318
284 Ga0207712_10388129 3300025961 Bacteria 1170
285 Ga0207668_10153733 3300025972 Bacteria 1784
286 Ga0207668_10201353 3300025972 Bacteria 1586
287 Ga0207640_10149836 3300025981 Bacteria 1712
288 Ga0207640_10190551 3300025981 Bacteria 1545
289 Ga0207640_10511243 3300025981 Bacteria 1002
290 Ga0207658_10551370 3300025986 Bacteria 1031
291 Ga0207658_10587891 3300025986 Bacteria 999
292 Ga0207677_10220778 3300026023 Bacteria 1520
293 Ga0207677_10318644 3300026023 Bacteria 1291
294 Ga0207703_10325342 3300026035 Bacteria 1409
295 Ga0207703_10414152 3300026035 Bacteria 1253
296 Ga0207703_10442153 3300026035 Bacteria 1213
297 Ga0207639_10315154 3300026041 Bacteria 1387
298 Ga0207678_10009296 3300026067 Bacteria 8652
299 Ga0207708_10080214 3300026075 Bacteria 2508
300 Ga0207708_10117103 3300026075 Bacteria 2073
301 Ga0207708_10300064 3300026075 Bacteria 1306
302 Ga0207702_10366294 3300026078 Bacteria 1382
303 Ga0207641_10032861 3300026088 Bacteria 4310
304 Ga0207641_10156582 3300026088 Bacteria 2067
305 Ga0207648_10020748 3300026089 Bacteria 5915
306 Ga0207648_10040076 3300026089 Bacteria 4116
307 Ga0207648_10642658 3300026089 Bacteria 980
308 Ga0207676_10235447 3300026095 Bacteria 1639
309 Ga0207676_10369361 3300026095 Bacteria 1332
310 Ga0207674_10160992 3300026116 Bacteria 2199
311 Ga0207675_100010849 3300026118 Bacteria 8535
312 Ga0207675_100042810 3300026118 Bacteria 4228
313 Ga0207675_100205235 3300026118 Bacteria 1894
314 Ga0207675_100235830 3300026118 Bacteria 1766
315 Ga0207683_10002553 3300026121 Bacteria 15885
316 Ga0207683_10048058 3300026121 Bacteria 3737
317 Ga0207683_10121571 3300026121 Bacteria 2345
318 Ga0207698_10030912 3300026142 Bacteria 3858
319 Ga0209973_1014276 3300027252 Bacteria 989
320 Ga0209967_1016123 3300027364 Bacteria 1072
321 Ga0209995_1003355 3300027471 Bacteria 2553
322 Ga0209968_1007333 3300027526 Bacteria 1668
323 Ga0209982_1007672 3300027552 Bacteria 1577
324 Ga0209970_1000613 3300027614 Bacteria 6183
325 Ga0210002_1002412 3300027617 Bacteria 2695
326 Ga0210002_1016588 3300027617 Bacteria 1166
327 Ga0209983_1002394 3300027665 Bacteria 4111
328 Ga0209971_1000399 3300027682 Bacteria 11748
329 Ga0209998_10026824 3300027717 Bacteria 1260
330 Ga0209974_10004425 3300027876 Bacteria 4999
331 Ga0207428_10045839 3300027907 Bacteria 3518
332 Ga0207428_10095151 3300027907 Bacteria 2308
333 Ga0207428_10325610 3300027907 Bacteria 1134
334 Ga0268266_10057743 3300028379 Unclassified 3340
335 Ga0268266_10162554 3300028379 Bacteria 2021
336 Ga0268265_10019423 3300028380 Bacteria 4724
337 Ga0268265_10046070 3300028380 Bacteria 3257
338 Ga0268265_10118746 3300028380 Bacteria 2174
339 Ga0268265_10178203 3300028380 Bacteria 1824
340 Ga0268265_10263988 3300028380 Bacteria 1532
341 Ga0268264_10019145 3300028381 Bacteria 5596
342 Ga0268264_10035551 3300028381 Bacteria 4102
343 Ga0268264_10215117 3300028381 Bacteria 1766
344 Ga0268264_10228735 3300028381 Bacteria 1716
345 Ga0268264_10301469 3300028381 Bacteria 1509
346 Ga0268264_10535173 3300028381 Bacteria 1147
347 Ga0265323_10006779 3300028653 Bacteria 4798
348 Ga0265323_10028718 3300028653 Bacteria 2085
349 Ga0265322_10000036 3300028654 Bacteria 79374
350 Ga0265329_10026427 3300031242 Bacteria 1912
351 Ga0265339_10099361 3300031249 Bacteria 1517
352 Ga0265316_10000536 3300031344 Bacteria 42732
353 Ga0265316_10108154 3300031344 Unclassified 2108
354 Ga0316579_10002112 3300031691 Bacteria 7453
355 Ga0316579_10213964 3300031691 Bacteria 932
356 Ga0316576_10004531 3300031727 Bacteria 8351
357 Ga0316576_10005409 3300031727 Bacteria 7797
358 Ga0316576_10188744 3300031727 Bacteria 1554
359 Ga0316578_10005120 3300031728 Bacteria 6312
360 Ga0316578_10232213 3300031728 Bacteria 1108
361 Ga0316577_10048869 3300031733 Bacteria 2362
362 Ga0307410_10336722 3300031852 Bacteria 1201
363 Ga0307412_10409645 3300031911 Bacteria 1106
364 Ga0307409_100119400 3300031995 Bacteria 2229
365 Ga0316583_10005290 3300032133 Bacteria 4629
366 Ga0316583_10008085 3300032133 Bacteria 3791
367 Ga0316585_10009047 3300032137 Bacteria 2895
368 Ga0316580_10008605 3300032139 Bacteria 3060
369 Ga0373959_0054600 3300034820 Bacteria 871
370 Ga0373940_0096188 3300035088 Bacteria 894
371 Ga0373932_0085483 3300035112 Bacteria 1004
372 Ga0373956_0006074 3300035119 Bacteria 4833
373 Ga0316574_0001673 3300035398 Bacteria 10690
374 Ga0373931_0043529 3300035691 Bacteria 2365
375 Ga0373935_0213785 3300035692 Unclassified 1337
376 Ga0373927_0102148 3300035695 Bacteria 1865
377 Ga0373933_0029256 3300035724 Bacteria 3184
378 Ga0373937_0014290 3300036401 Bacteria 7007
379 Ga0373937_0070153 3300036401 Bacteria 3232
380 Ga0373937_0081938 3300036401 Unclassified 2985
381 Ga0373937_0270036 3300036401 Bacteria 1605
382 Ga0316582_0002926 3300036647 Bacteria 8210
383 Ga0316582_0045087 3300036647 Bacteria 2775
384 Ga0316584_0060283 3300036712 Bacteria 2842
385 Ga0373925_0019890 3300037068 Bacteria 4884
386 Ga0373925_0140008 3300037068 Bacteria 1893
387 Ga0395900_0125014 3300037418 Bacteria 2638
388 Ga0316581_0029282 3300037588 Bacteria 1653
389 Ga0395901_0640244 3300038443 Bacteria 1068
390 Ga0242420_046901 3300038996 Unclassified 837
391 Ga0436360_0438352 3300039438 Bacteria 2559
392 Ga0439461_0067584 3300041410 Bacteria 823
393 Ga0451853_3211811 3300041512 Bacteria 1298
394 Ga0439457_036339 3300042014 Bacteria 1096
395 Ga0439462_0005970 3300042015 Bacteria 3017
396 Ga0450923_020265 3300042125 Bacteria 1288
397 Ga0439446_0004851 3300042156 Bacteria 3430
398 Ga0439434_0012216 3300042435 Bacteria 2541
399 Ga0439435_0017504 3300042436 Bacteria 1813
400 Ga0439435_0076989 3300042436 Bacteria 996
401 Ga0450918_033292 3300042531 Bacteria 913
402 Ga0451577_0000053 3300042876 Bacteria 279563
403 Ga0451577_0000207 3300042876 Bacteria 123185
404 Ga0451577_0002962 3300042876 Bacteria 19438
405 Ga0451577_0046305 3300042876 Bacteria 3892
406 Ga0451577_0050432 3300042876 Bacteria 3715
407 Ga0451577_0072231 3300042876 Bacteria 3078
408 Ga0451577_0092745 3300042876 Bacteria 2696
409 Ga0451577_0268379 3300042876 Bacteria 1545
410 Ga0451577_0524241 3300042876 Bacteria 1076
411 Ga0439440_0037150 3300042993 Bacteria 1175
412 Ga0453683_0003422 3300044673 Bacteria 11703
413 Ga0453683_0420121 3300044673 Bacteria 863
414 Ga0453684_0000245 3300044712 Bacteria 233453
415 Ga0453684_0000791 3300044712 Bacteria 108441
416 Ga0453684_0002442 3300044712 Bacteria 45166
417 Ga0453684_0014352 3300044712 Bacteria 12688
418 Ga0453684_0033276 3300044712 Bacteria 7190
419 Ga0453684_0168947 3300044712 Bacteria 2579
420 Ga0451576_0001885 3300045051 Bacteria 33717
421 Ga0451576_0063394 3300045051 Bacteria 3852
422 Ga0451576_0088593 3300045051 Bacteria 3219
423 Ga0451576_0148712 3300045051 Bacteria 2443
424 Ga0451576_0195750 3300045051 Bacteria 2111
425 Ga0451576_0256842 3300045051 Bacteria 1826
426 Ga0451576_0326747 3300045051 Bacteria 1605
427 Ga0451576_0496676 3300045051 Bacteria 1282
428 Ga0451576_0855888 3300045051 Bacteria 954
429 Ga0495629_0077996 3300046459 Bacteria 2313
430 Ga0495629_0102050 3300046459 Bacteria 2001
431 Ga0495629_0267045 3300046459 Bacteria 1176
432 Ga0495651_0314434 3300046462 Bacteria 1046
433 Ga0495580_0133547 3300046472 Bacteria 1721
434 Ga0495580_0136744 3300046472 Bacteria 1699
435 Ga0495580_0170205 3300046472 Bacteria 1506
436 Ga0495582_0047863 3300046473 Bacteria 2355
437 Ga0495582_0087921 3300046473 Bacteria 1730
438 Ga0495585_0195304 3300046492 Bacteria 1033
439 Ga0495644_0149445 3300046523 Bacteria 894
440 Ga0495656_0178723 3300046615 Bacteria 1042
441 Ga0495647_0016324 3300046681 Bacteria 2613
442 Ga0495647_0020755 3300046681 Bacteria 2361
443 Ga0495647_0085225 3300046681 Bacteria 1287
444 Ga0495613_0183722 3300046689 Bacteria 1480
445 Ga0495624_0340642 3300046690 Bacteria 902
446 Ga0495604_0278800 3300047317 Bacteria 1130
447 Ga0495674_0052981 3300047319 Bacteria 3569
448 Ga0495674_0301362 3300047319 Bacteria 1309
449 Ga0495684_0088626 3300047471 Bacteria 2345
450 Ga0495684_0325073 3300047471 Bacteria 1099
451 Ga0495684_0436829 3300047471 Bacteria 912
452 Ga0496102_0162134 3300048905 Bacteria 2103
453 Ga0496103_0053606 3300048906 Bacteria 2500
454 Ga0496103_0447287 3300048906 Bacteria 829
455 Ga0496106_0067724 3300048909 Bacteria 2722
456 Ga0496106_0114500 3300048909 Bacteria 2103
457 Ga0496107_0068164 3300048910 Bacteria 2582
458 Ga0496107_0493686 3300048910 Bacteria 908
459 Ga0496108_0064575 3300048911 Bacteria 3084
460 Ga0496109_0000005 3300048912 Bacteria 358226
461 Ga0496109_0060121 3300048912 Bacteria 3472
462 Ga0496109_0363723 3300048912 Bacteria 1367
463 Ga0496112_0224933 3300048915 Bacteria 1832
464 Ga0496113_0009126 3300048916 Bacteria 6498
465 Ga0501299_005190 3300049522 Bacteria 1989
466 Ga0501034_0487412 3300049571 Bacteria 1147
467 Ga0501043_0442549 3300049579 Bacteria 978
468 Ga0501048_0250254 3300049582 Bacteria 1258
469 Ga0501067_0053271 3300049583 Bacteria 2242
470 Ga0501072_0179858 3300049588 Bacteria 1687
471 Ga0501075_0077957 3300049591 Bacteria 2508
472 Ga0501235_035324 3300049669 Unclassified 1135
473 Ga0501079_0587610 3300049741 Bacteria 876
474 Ga0501080_0546731 3300049742 Bacteria 1032
475 Ga0501081_0039905 3300049743 Bacteria 3214
476 Ga0501081_0068539 3300049743 Bacteria 2470
477 nmdc:mga05p37_18388_c1 3300050507 Bacteria 8442
478 nmdc:mga05p37_186482_c1 3300050507 Bacteria 2522
479 nmdc:mga05p37_20796_c1 3300050507 Bacteria 7942
480 nmdc:mga05p37_313440_c1 3300050507 Unclassified 1859
481 nmdc:mga05p37_329752_c1 3300050507 Unclassified 1803
482 nmdc:mga05p37_359145_c1 3300050507 Bacteria 1713
483 nmdc:mga05p37_569_c2 3300050507 Bacteria 24307
484 nmdc:mga05p37_73294_c1 3300050507 Bacteria 4214
485 nmdc:mga05p37_74995_c1 3300050507 Unclassified 4164
486 nmdc:mga05p37_7796_c1 3300050507 Bacteria 12638
487 nmdc:mga05p37_929880_c1 3300050507 Unclassified 933
488 nmdc:mga09592_10035_c1 3300050508 Bacteria 7699
489 nmdc:mga09592_101143_c1 3300050508 Bacteria 2469
490 nmdc:mga09592_148074_c1 3300050508 Unclassified 2025
491 nmdc:mga09592_189812_c1 3300050508 Bacteria 1778
492 nmdc:mga09592_25857_c1 3300050508 Bacteria 4861
493 nmdc:mga0qj67_2957_c1 3300050509 Bacteria 12183
494 nmdc:mga0qj67_451883_c1 3300050509 Bacteria 1035
495 nmdc:mga0qj67_7069_c1 3300050509 Bacteria 8281
496 nmdc:mga06r32_202254_c1 3300050510 Unclassified 1974
497 nmdc:mga06r32_326760_c1 3300050510 Bacteria 1519
498 nmdc:mga06r32_47157_c1 3300050510 Bacteria 4114
499 nmdc:mga06r32_51679_c1 3300050510 Bacteria 3934
500 nmdc:mga06r32_91991_c1 3300050510 Bacteria 2965
501 nmdc:mga06r32_99241_c1 3300050510 Bacteria 2855
502 nmdc:mga08y16_102933_c1 3300050511 Bacteria 2973
503 nmdc:mga08y16_182891_c1 3300050511 Bacteria 2176
504 nmdc:mga08y16_256922_c1 3300050511 Bacteria 1805
505 nmdc:mga08y16_38702_c1 3300050511 Bacteria 5006
506 nmdc:mga08y16_666540_c1 3300050511 Bacteria 1043
507 nmdc:mga08y16_692706_c1 3300050511 Bacteria 1020
508 nmdc:mga08y16_95621_c1 3300050511 Bacteria 3094
509 nmdc:mga0n895_120557_c1 3300050512 Unclassified 2644
510 nmdc:mga0n895_159395_c1 3300050512 Bacteria 2287
511 nmdc:mga0n895_198835_c1 3300050512 Bacteria 2036
512 nmdc:mga0n895_43515_c1 3300050512 Bacteria 4376
513 nmdc:mga0n895_48448_c1 3300050512 Bacteria 4159
514 nmdc:mga0n895_521361_c1 3300050512 Bacteria 1196
515 nmdc:mga0rr50_18262_c1 3300050513 Bacteria 4706
516 nmdc:mga0rr50_259446_c1 3300050513 Bacteria 1446
517 nmdc:mga08x19_122755_c1 3300050514 Unclassified 1742
518 nmdc:mga0a205_26238_c1 3300050515 Bacteria 5553
519 nmdc:mga0a205_2874_c1 3300050515 Bacteria 15233
520 nmdc:mga0a205_293486_c1 3300050515 Bacteria 1500
521 nmdc:mga0a205_315759_c1 3300050515 Bacteria 1434
522 nmdc:mga0a205_326844_c1 3300050515 Bacteria 1404
523 nmdc:mga0a205_95215_c1 3300050515 Unclassified 2876
524 Ga0495601_0011945 3300053077 Bacteria 5205
525 Ga0495601_0099750 3300053077 Bacteria 1875
526 Ga0495595_0049996 3300053084 Bacteria 1935
527 Ga0495619_0042140 3300053085 Bacteria 2988
528 Ga0495619_0059086 3300053085 Bacteria 2547
529 Ga0500641_0147715 3300053096 Bacteria 1015
530 Ga0500555_002581 3300053103 Bacteria 5219
531 Ga0500628_047949 3300053129 Bacteria 1003
532 Ga0501084_0142749 3300054114 Bacteria 2017
533 Ga0501084_0383815 3300054114 Bacteria 1187
534 Ga0501084_0631924 3300054114 Bacteria 904
535 Ga0501082_0697700 3300060353 Bacteria 888
536 Ga0209974_10036593
537 Ga0065707_10113813
538 Ga0070676_10008326
539 Ga0070676_10161492
540 Ga0070690_100191390
541 Ga0070690_100221779
542 Ga0070670_100013837
543 Ga0070677_10019443
544 Ga0070677_10048577
545 Ga0068869_100115772
546 Ga0070666_10000282
547 Ga0070666_10033899
548 Ga0070666_10072843
549 Ga0068868_100006304
550 Ga0068868_100062549
551 Ga0070689_100010761
552 Ga0070689_100027067
553 Ga0070689_100269159
554 Ga0070689_100639053
555 Ga0070692_10027529
556 Ga0070692_10111526
557 Ga0070668_100092342
558 Ga0070668_100121075
559 Ga0070669_100002519
560 Ga0070669_100107114
561 Ga0070669_100121211
562 Ga0070669_100333503
563 Ga0070675_100034168
564 Ga0070675_100236930
565 Ga0070671_100026232
566 Ga0070674_100046557
567 Ga0070674_100524572
568 Ga0070673_100011133
569 Ga0070673_100021249
570 Ga0070688_100014396
571 Ga0070659_100099451
572 Ga0070659_100298587
573 Ga0070667_100149508
574 Ga0070667_100237970
575 Ga0070709_10000889
576 Ga0070700_100114438
577 Ga0070700_100203863
578 Ga0070694_100006886
579 Ga0070708_100001944
580 Ga0070708_100004799
581 Ga0070708_100010636
582 Ga0070708_100074490
583 Ga0070708_100170225
584 Ga0070663_100006038
585 Ga0070663_100070576
586 Ga0070663_100312119
587 Ga0070678_100003521
588 Ga0070662_100018253
589 Ga0070662_100057822
590 Ga0070662_100266148
591 Ga0068867_100156775
592 Ga0070706_100001720
593 Ga0070706_100003987
594 Ga0070706_100010283
595 Ga0070706_100070610
596 Ga0070707_100000742
597 Ga0070707_100011579
598 Ga0070707_100083304
599 Ga0070707_100234491
600 Ga0070707_100252294
601 Ga0070698_100015484
602 Ga0070698_100086527
603 Ga0070698_100137000
604 Ga0070699_100000007
605 Ga0070699_100072778
606 Ga0070684_100294148
607 Ga0070697_100004976
608 Ga0070672_100022029
609 Ga0070672_100095006
610 Ga0070672_100285520
611 Ga0070686_100147382
612 Ga0070695_100020933
613 Ga0070695_100079698
614 Ga0070695_100292154
615 Ga0070693_100131194
616 Ga0070693_100246333
617 Ga0070665_100023239
618 Ga0070665_100246902
619 Ga0070704_100055414
620 Ga0070704_100155527
621 Ga0070704_100165983
622 Ga0068855_100195425
623 Ga0070664_100008746
624 Ga0068857_100237838
625 Ga0068856_100213449
626 Ga0068852_100033265
627 Ga0068859_100000660
628 Ga0068859_100026805
629 Ga0068859_100058029
630 Ga0068859_100234664
631 Ga0068864_100008999
632 Ga0068864_100019448
633 Ga0068866_10045992
634 Ga0068866_10097315
635 Ga0068861_100140608
636 Ga0068861_100163617
637 Ga0068870_10011829
638 Ga0068863_100098055
639 Ga0068863_101155273
640 Ga0068858_100093956
641 Ga0068858_100270567
642 Ga0068860_100013509
643 Ga0068860_100025187
644 Ga0068860_100054407
645 Ga0068860_100265257
646 Ga0068860_100377959
647 Ga0068860_100801232
648 Ga0068862_100025800
649 Ga0068862_100052534
650 Ga0068862_100100090
651 Ga0081455_10015178
652 Ga0081455_10032068
653 Ga0081455_10397712
654 Ga0081539_10000025
655 Ga0070716_100010227
656 Ga0097621_100054937
657 Ga0097621_100332444
658 Ga0068871_100016049
659 Ga0068871_100153546
660 Ga0068871_100192701
661 Ga0075428_100083055
662 Ga0075428_100110827
663 Ga0075428_100223371
664 Ga0075428_100346591
665 Ga0075428_100425494
666 Ga0075430_100020541
667 Ga0075431_100025624
668 Ga0075431_100041945
669 Ga0075431_100069320
670 Ga0075431_100627233
671 Ga0075433_10045083
672 Ga0075433_10299817
673 Ga0075434_100001071
674 Ga0075434_100036902
675 Ga0075434_100090350
676 Ga0075429_100085806
677 Ga0075429_100134287
678 Ga0075429_100288882
679 Ga0068865_100177121
680 Ga0068865_100353926
681 Ga0097620_100000660
682 Ga0097620_100026806
683 Ga0097620_100058036
684 Ga0097620_100234676
685 Ga0075435_100024407
686 Ga0075435_100027643
687 Ga0075435_100030198
688 Ga0075435_100093410
689 Ga0105240_10025978
690 Ga0105240_10296251
691 Ga0105240_10511312
692 Ga0111539_10013393
693 Ga0111539_10226727
694 Ga0111539_10299853
695 Ga0111539_10349029
696 Ga0111539_10508520
697 Ga0105245_10021526
698 Ga0105245_10178931
699 Ga0105245_10492385
700 Ga0105245_10623040
701 Ga0114129_10000574
702 Ga0114129_10004306
703 Ga0114129_10063442
704 Ga0114129_10145276
705 Ga0114129_10169895
706 Ga0114129_10515345
707 Ga0105243_10222829
708 Ga0105242_10042444
709 Ga0105242_10207270
710 Ga0105248_10007321
711 Ga0105249_10002574
712 Ga0105249_10081680
713 Ga0105249_10152275
714 Ga0105249_10535075
715 Ga0099796_10027897
716 Ga0105239_10003630
717 Ga0157374_10018468
718 Ga0157378_10195391
719 Ga0163162_10076654
720 Ga0163162_10113497
721 Ga0157375_10020625
722 Ga0157375_10206843
723 Ga0157375_10386442
724 Ga0163163_10067562
725 Ga0157380_10067758
726 Ga0157380_10112370
727 Ga0157380_10155950
728 Ga0157379_10024444
729 Ga0157376_10082390
730 Ga0163161_10011991
731 Ga0163161_10024629
732 Ga0163161_10399558
733 Ga0224712_10004733
734 Ga0224712_10174351
735 Ga0207697_10035412
736 Ga0207697_10036636
737 Ga0207682_10002808
738 Ga0207682_10010982
739 Ga0207682_10050130
740 Ga0207682_10233921
741 Ga0207642_10234541
742 Ga0207710_10166170
743 Ga0207688_10087855
744 Ga0207680_10001923
745 Ga0207680_10073325
746 Ga0207699_10000026
747 Ga0207645_10001092
748 Ga0207645_10004007
749 Ga0207645_10015302
750 Ga0207645_10102158
751 Ga0207645_10258415
752 Ga0207645_10315454
753 Ga0207643_10022606
754 Ga0207684_10000543
755 Ga0207684_10019561
756 Ga0207684_10107612
757 Ga0207684_10210058
758 Ga0207695_10019676
759 Ga0207660_10477176
760 Ga0207662_10026535
761 Ga0207646_10000623
762 Ga0207646_10004706
763 Ga0207646_10016925
764 Ga0207646_10201948
765 Ga0207646_10258011
766 Ga0207681_10011152
767 Ga0207681_10048663
768 Ga0207681_10130693
769 Ga0207681_10210130
770 Ga0207681_10245912
771 Ga0207650_10024208
772 Ga0207650_10227636
773 Ga0207650_10342747
774 Ga0207659_10034829
775 Ga0207659_10055242
776 Ga0207659_10135035
777 Ga0207659_10833236
778 Ga0207687_10088382
779 Ga0207687_10291710
780 Ga0207687_10372851
781 Ga0207664_10834797
782 Ga0207644_10427846
783 Ga0207644_10746801
784 Ga0207706_10062984
785 Ga0207706_10142153
786 Ga0207706_10241735
787 Ga0207706_10339908
788 Ga0207706_10468025
789 Ga0207686_10330681
790 Ga0207670_10096862
791 Ga0207670_10170096
792 Ga0207670_10567489
793 Ga0207669_10033450
794 Ga0207669_10047902
795 Ga0207669_10060073
796 Ga0207669_10108318
797 Ga0207669_10439939
798 Ga0207704_10142824
799 Ga0207665_10006635
800 Ga0207691_10024698
801 Ga0207691_10030695
802 Ga0207691_10115507
803 Ga0207691_10176410
804 Ga0207691_10335759
805 Ga0207691_10628994
806 Ga0207711_10005446
807 Ga0207711_10103662
808 Ga0207711_10190210
809 Ga0207711_10338357
810 Ga0207689_10009401
811 Ga0207689_10105238
812 Ga0207679_10133326
813 Ga0207679_10856454
814 Ga0207651_10000527
815 Ga0207651_10169937
816 Ga0207712_10011488
817 Ga0207712_10189931
818 Ga0207712_10300170
819 Ga0207712_10388129
820 Ga0207668_10153733
821 Ga0207668_10201353
822 Ga0207640_10149836
823 Ga0207640_10190551
824 Ga0207640_10511243
825 Ga0207658_10551370
826 Ga0207658_10587891
827 Ga0207677_10220778
828 Ga0207677_10318644
829 Ga0207703_10325342
830 Ga0207703_10414152
831 Ga0207703_10442153
832 Ga0207639_10315154
833 Ga0207678_10009296
834 Ga0207708_10080214
835 Ga0207708_10117103
836 Ga0207708_10300064
837 Ga0207702_10366294
838 Ga0207641_10032861
839 Ga0207641_10156582
840 Ga0207648_10020748
841 Ga0207648_10040076
842 Ga0207648_10642658
843 Ga0207676_10235447
844 Ga0207676_10369361
845 Ga0207674_10160992
846 Ga0207675_100010849
847 Ga0207675_100042810
848 Ga0207675_100205235
849 Ga0207675_100235830
850 Ga0207683_10002553
851 Ga0207683_10048058
852 Ga0207683_10121571
853 Ga0207698_10030912
854 Ga0209973_1014276
855 Ga0209967_1016123
856 Ga0209995_1003355
857 Ga0209968_1007333
858 Ga0209982_1007672
859 Ga0209970_1000613
860 Ga0210002_1002412
861 Ga0210002_1016588
862 Ga0209983_1002394
863 Ga0209971_1000399
864 Ga0209998_10026824
865 Ga0209974_10004425
866 Ga0207428_10045839
867 Ga0207428_10095151
868 Ga0207428_10325610
869 Ga0268266_10057743
870 Ga0268266_10162554
871 Ga0268265_10019423
872 Ga0268265_10046070
873 Ga0268265_10118746
874 Ga0268265_10178203
875 Ga0268265_10263988
876 Ga0268264_10019145
877 Ga0268264_10035551
878 Ga0268264_10215117
879 Ga0268264_10228735
880 Ga0268264_10301469
881 Ga0268264_10535173
882 Ga0265323_10006779
883 Ga0265323_10028718
884 Ga0265322_10000036
885 Ga0265329_10026427
886 Ga0265339_10099361
887 Ga0265316_10000536
888 Ga0265316_10108154
889 Ga0316579_10002112
890 Ga0316579_10213964
891 Ga0316576_10004531
892 Ga0316576_10005409
893 Ga0316576_10188744
894 Ga0316578_10005120
895 Ga0316578_10232213
896 Ga0316577_10048869
897 Ga0307410_10336722
898 Ga0307412_10409645
899 Ga0307409_100119400
900 Ga0316583_10005290
901 Ga0316583_10008085
902 Ga0316585_10009047
903 Ga0316580_10008605
904 Ga0373959_0054600
905 Ga0373940_0096188
906 Ga0373932_0085483
907 Ga0373956_0006074
908 Ga0316574_0001673
909 Ga0373931_0043529
910 Ga0373935_0213785
911 Ga0373927_0102148
912 Ga0373933_0029256
913 Ga0373937_0014290
914 Ga0373937_0070153
915 Ga0373937_0081938
916 Ga0373937_0270036
917 Ga0316582_0002926
918 Ga0316582_0045087
919 Ga0316584_0060283
920 Ga0373925_0019890
921 Ga0373925_0140008
922 Ga0395900_0125014
923 Ga0316581_0029282
924 Ga0395901_0640244
925 Ga0242420_046901
926 Ga0436360_0438352
927 Ga0439461_0067584
928 Ga0451853_3211811
929 Ga0439457_036339
930 Ga0439462_0005970
931 Ga0450923_020265
932 Ga0439446_0004851
933 Ga0439434_0012216
934 Ga0439435_0017504
935 Ga0439435_0076989
936 Ga0450918_033292
937 Ga0451577_0000053
938 Ga0451577_0000207
939 Ga0451577_0002962
940 Ga0451577_0046305
941 Ga0451577_0050432
942 Ga0451577_0072231
943 Ga0451577_0092745
944 Ga0451577_0268379
945 Ga0451577_0524241
946 Ga0439440_0037150
947 Ga0453683_0003422
948 Ga0453683_0420121
949 Ga0453684_0000245
950 Ga0453684_0000791
951 Ga0453684_0002442
952 Ga0453684_0014352
953 Ga0453684_0033276
954 Ga0453684_0168947
955 Ga0451576_0001885
956 Ga0451576_0063394
957 Ga0451576_0088593
958 Ga0451576_0148712
959 Ga0451576_0195750
960 Ga0451576_0256842
961 Ga0451576_0326747
962 Ga0451576_0496676
963 Ga0451576_0855888
964 Ga0495629_0077996
965 Ga0495629_0102050
966 Ga0495629_0267045
967 Ga0495651_0314434
968 Ga0495580_0133547
969 Ga0495580_0136744
970 Ga0495580_0170205
971 Ga0495582_0047863
972 Ga0495582_0087921
973 Ga0495585_0195304
974 Ga0495644_0149445
975 Ga0495656_0178723
976 Ga0495647_0016324
977 Ga0495647_0020755
978 Ga0495647_0085225
979 Ga0495613_0183722
980 Ga0495624_0340642
981 Ga0495604_0278800
982 Ga0495674_0052981
983 Ga0495674_0301362
984 Ga0495684_0088626
985 Ga0495684_0325073
986 Ga0495684_0436829
987 Ga0496102_0162134
988 Ga0496103_0053606
989 Ga0496103_0447287
990 Ga0496106_0067724
991 Ga0496106_0114500
992 Ga0496107_0068164
993 Ga0496107_0493686
994 Ga0496108_0064575
995 Ga0496109_0000005
996 Ga0496109_0060121
997 Ga0496109_0363723
998 Ga0496112_0224933
999 Ga0496113_0009126
1000 Ga0501299_005190
1001 Ga0501034_0487412
1002 Ga0501043_0442549
1003 Ga0501048_0250254
1004 Ga0501067_0053271
1005 Ga0501072_0179858
1006 Ga0501075_0077957
1007 Ga0501235_035324
1008 Ga0501079_0587610
1009 Ga0501080_0546731
1010 Ga0501081_0039905
1011 Ga0501081_0068539
1012 nmdc:mga05p37_18388_c1
1013 nmdc:mga05p37_186482_c1
1014 nmdc:mga05p37_20796_c1
1015 nmdc:mga05p37_313440_c1
1016 nmdc:mga05p37_329752_c1
1017 nmdc:mga05p37_359145_c1
1018 nmdc:mga05p37_569_c2
1019 nmdc:mga05p37_73294_c1
1020 nmdc:mga05p37_74995_c1
1021 nmdc:mga05p37_7796_c1
1022 nmdc:mga05p37_929880_c1
1023 nmdc:mga09592_10035_c1
1024 nmdc:mga09592_101143_c1
1025 nmdc:mga09592_148074_c1
1026 nmdc:mga09592_189812_c1
1027 nmdc:mga09592_25857_c1
1028 nmdc:mga0qj67_2957_c1
1029 nmdc:mga0qj67_451883_c1
1030 nmdc:mga0qj67_7069_c1
1031 nmdc:mga06r32_202254_c1
1032 nmdc:mga06r32_326760_c1
1033 nmdc:mga06r32_47157_c1
1034 nmdc:mga06r32_51679_c1
1035 nmdc:mga06r32_91991_c1
1036 nmdc:mga06r32_99241_c1
1037 nmdc:mga08y16_102933_c1
1038 nmdc:mga08y16_182891_c1
1039 nmdc:mga08y16_256922_c1
1040 nmdc:mga08y16_38702_c1
1041 nmdc:mga08y16_666540_c1
1042 nmdc:mga08y16_692706_c1
1043 nmdc:mga08y16_95621_c1
1044 nmdc:mga0n895_120557_c1
1045 nmdc:mga0n895_159395_c1
1046 nmdc:mga0n895_198835_c1
1047 nmdc:mga0n895_43515_c1
1048 nmdc:mga0n895_48448_c1
1049 nmdc:mga0n895_521361_c1
1050 nmdc:mga0rr50_18262_c1
1051 nmdc:mga0rr50_259446_c1
1052 nmdc:mga08x19_122755_c1
1053 nmdc:mga0a205_26238_c1
1054 nmdc:mga0a205_2874_c1
1055 nmdc:mga0a205_293486_c1
1056 nmdc:mga0a205_315759_c1
1057 nmdc:mga0a205_326844_c1
1058 nmdc:mga0a205_95215_c1
1059 Ga0495601_0011945
1060 Ga0495601_0099750
1061 Ga0495595_0049996
1062 Ga0495619_0042140
1063 Ga0495619_0059086
1064 Ga0500641_0147715
1065 Ga0500555_002581
1066 Ga0500628_047949
1067 Ga0501084_0142749
1068 Ga0501084_0383815
1069 Ga0501084_0631924
1070 Ga0501082_0697700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01709

Transcrip_reg

TACO1/YebC second and third domain

113

268

0.98

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

36

107

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.9113 18 241
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.852 3 245
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8472 24 238
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8417 3 245
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8406 18 241
ID Description Score Start End Superfamily
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9782 24 74 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9657 83 241 3.30.70.980
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9212 19 79 1.10.10.200
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9035 83 238 3.30.70.980
4f3qA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.8993 130 205 3.30.70.980
ID Description Score Start End GO Terms
AF-A0A536RP66-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9863 1 135 GO:0003677
GO:0005829
AF-A0A2V9JXX5-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9772 1 184 GO:0003677
GO:0005829
AF-A0A7V3FN36-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9754 110 249 GO:0003677
GO:0005829
AF-A0A382W3A4-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9745 1 200 GO:0003677
GO:0005829
AF-K1UEW2-F1-model_v4 Protein containing DUF28 0.9743 83 239 GO:0005829

Map