F460650

General Info

Members Datasets Scaffolds Average Seq Length
535 355 476 294

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10006039|Ga0114129_1000603911
Length 331
Sequence VERVHRGLSDGVAGGGAGTSVLLRPPSVPATTAAGAWLRRLTSRAAAPYWQVAPLALVFAFFFLLPLAVTVAVSAWRYNEYSMTPALVGDNYAAVFSGCLTELPSLCLTFKTYLSTLKFCVLAWLLTLVLGFTVAYFLAFHVRSLTGQVVLFLVCTIPFWTSNVIRMISWVPLLGRNGLVNSVLLAAGVRREPFTWLLFSDFSVVLAFVHLYTMFMIVPIFNSMGRIDRALLEAARDAGASGWQTLWNVVVPLSKPGIVIGSIFVVTMVMGDYVTIGVMGGQQIASVGKVIQVQLSYLQFPLAAANAVVLLAAVLVVIATMTRLVDVRKEL

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2643221570 Acidovorax sp. Root568 Isolate Unclassified
12 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
13 2643221596 Acidovorax sp. Root70 Isolate Unclassified
14 2643221609 Acidovorax sp. Root217 Isolate Unclassified
15 2643221611 Acidovorax sp. Root219 Isolate Unclassified
16 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
17 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
18 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
19 2643221652 Acidovorax sp. Root402 Isolate Unclassified
20 2643221658 Variovorax sp. Root411 Isolate Unclassified
21 2643221672 Variovorax sp. Root434 Isolate Unclassified
22 2643221717 Acidovorax sp. Root267 Isolate Unclassified
23 2738541277 Variovorax sp. GV051 Isolate Unclassified
24 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
25 2738541307 Variovorax sp. GV008 Isolate Unclassified
26 2738543012 Acidovorax sp. CF301 Isolate Unclassified
27 2738543019 Variovorax sp. GV040 Isolate Unclassified
28 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
29 2816332133 Acidovorax radicis 2721A Isolate Unclassified
30 2818991446 Variovorax sp. 1180 Isolate Unclassified
31 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
32 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
33 2842677519 Variovorax sp. R-72495 Isolate Unclassified
34 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
35 2842733646 Variovorax sp. R-72446 Isolate Unclassified
36 2842747753 Variovorax sp. R-72060 Isolate Unclassified
37 2899924645 Variovorax sp. 369 Isolate Unclassified
38 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
39 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
40 2904456579 Variovorax sp. 2002 Isolate Unclassified
41 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
42 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
43 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
44 2928037797 Variovorax sp. 1126 Isolate Unclassified
45 2928044640 Variovorax sp. 1128 Isolate Unclassified
46 2928051484 Variovorax sp. 1133 Isolate Unclassified
47 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
48 2928070936 Variovorax gossypii 1167 Isolate Unclassified
49 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
50 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
51 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
52 2929520902 Variovorax beijingensis 502 Isolate Unclassified
53 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
54 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
55 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
56 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
57 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
58 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
59 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
60 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
61 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
62 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
63 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
64 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
65 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
66 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
67 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
68 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
69 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
70 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
71 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
72 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
73 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
74 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
75 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
76 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
77 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
78 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
79 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
80 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
81 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
82 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
83 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
84 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
85 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
86 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
87 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
88 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
89 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
90 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
91 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
94 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
95 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
98 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
99 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
100 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
101 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
102 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
103 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
104 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
105 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
109 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
110 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
111 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
117 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
127 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
128 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
129 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
130 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
131 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
132 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
133 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
134 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
157 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
158 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
159 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
163 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
171 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
172 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
173 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
176 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
177 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
186 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
189 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
220 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
221 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
227 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
228 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
229 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
230 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
231 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
232 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
238 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
239 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
253 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
254 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
255 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
256 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
257 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
258 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
259 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
260 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
261 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
262 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
263 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
264 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
265 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
266 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
267 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
268 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
269 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
270 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
273 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
274 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
275 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
319 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
320 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
321 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
322 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
323 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
332 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
335 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
336 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
342 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
343 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
344 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
345 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
346 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
347 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
348 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
351 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.79
Metatranscriptomes 0.19
Isolates 11.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.53
Nodule 1.5
Rhizoplane 3.55
Rhizosphere 49.91
Stem 0
Stem Tuber 0
Unclassified 15.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000039 3300001915 Bacteria 30947
2 JGI24740J21852_10006007 3300001979 Bacteria 5078
3 JGI24739J22299_10052753 3300001989 Bacteria 1307
4 JGI25154J39366_1000276 3300002738 Bacteria 31477
5 JGI25158J39367_1003505 3300002739 Bacteria 2419
6 JGI25152J39213_1005183 3300002773 Bacteria 3889
7 JGI25152J39213_1013359 3300002773 Bacteria 1715
8 JGI25150J39212_1005830 3300002774 Bacteria 2595
9 JGI25159J45721_1000215 3300002987 Bacteria 27258
10 JGI25159J45721_1011718 3300002987 Bacteria 2132
11 JGI25151J46595_10006665 3300003187 Bacteria 5759
12 JGI25151J46595_10009103 3300003187 Bacteria 4730
13 JGI25151J46595_10032839 3300003187 Bacteria 2006
14 JGI25153J46596_10004528 3300003215 Bacteria 7476
15 JGI25153J46596_10009787 3300003215 Bacteria 4406
16 JGI25160J50197_1000281 3300003354 Bacteria 37019
17 JGI25161J50226_1000124 3300003374 Bacteria 56436
18 Ga0055539_1000185 3300003752 Bacteria 52003
19 Ga0055533_1000627 3300003756 Bacteria 11924
20 Ga0055532_1000006 3300003758 Bacteria 451244
21 Ga0055525_1000586 3300003759 Bacteria 15795
22 Ga0055535_1000004 3300003761 Bacteria 451244
23 Ga0055535_1000442 3300003761 Bacteria 38340
24 Ga0055542_1000052 3300003762 Bacteria 173583
25 Ga0055542_1001212 3300003762 Bacteria 14509
26 Ga0055529_1000273 3300003763 Bacteria 61443
27 Ga0055526_1002654 3300003771 Bacteria 11944
28 Ga0055524_1000294 3300003775 Bacteria 48038
29 Ga0055524_1009094 3300003775 Bacteria 4073
30 Ga0055534_1006771 3300003784 Bacteria 2834
31 Ga0055528_1032441 3300003790 Bacteria 1333
32 Ga0055530_10004436 3300003791 Bacteria 7215
33 Ga0055530_10006319 3300003791 Bacteria 5323
34 Ga0055530_10007636 3300003791 Bacteria 4509
35 Ga0055540_1000028 3300003792 Bacteria 184864
36 Ga0055540_1003653 3300003792 Bacteria 7328
37 Ga0055540_1008366 3300003792 Bacteria 3733
38 Ga0055531_10000353 3300003794 Bacteria 44922
39 Ga0055531_10003684 3300003794 Bacteria 9648
40 Ga0055531_10005490 3300003794 Bacteria 7416
41 Ga0055531_10007116 3300003794 Bacteria 6176
42 Ga0055543_1004249 3300004625 Bacteria 3952
43 Ga0055543_1030231 3300004625 Bacteria 948
44 Ga0065165_1004200 3300005262 Bacteria 9174
45 Ga0065165_1031614 3300005262 Bacteria 1670
46 Ga0065714_10007979 3300005288 Bacteria 3344
47 Ga0065704_10089200 3300005289 Bacteria 2878
48 Ga0070661_100000336 3300005344 Bacteria 37535
49 Ga0070668_100336938 3300005347 Bacteria 1274
50 Ga0070659_100001051 3300005366 Bacteria 20160
51 Ga0070667_100013586 3300005367 Bacteria 6729
52 Ga0070714_100286265 3300005435 Bacteria 1532
53 Ga0070700_100046168 3300005441 Bacteria 2691
54 Ga0070708_100019655 3300005445 Bacteria 5680
55 Ga0070663_100000344 3300005455 Bacteria 24261
56 Ga0070678_100018931 3300005456 Bacteria 4474
57 Ga0070706_100221576 3300005467 Bacteria 1766
58 Ga0070707_100037083 3300005468 Bacteria 4652
59 Ga0070707_100059281 3300005468 Bacteria 3672
60 Ga0070698_100144580 3300005471 Bacteria 2328
61 Ga0070699_100018199 3300005518 Bacteria 6036
62 Ga0070699_100073802 3300005518 Bacteria 2968
63 Ga0070697_100002587 3300005536 Bacteria 13917
64 Ga0070697_100032673 3300005536 Bacteria 4189
65 Ga0070697_100037601 3300005536 Bacteria 3910
66 Ga0068853_100065424 3300005539 Bacteria 3155
67 Ga0068853_100143512 3300005539 Bacteria 2144
68 Ga0068853_100386453 3300005539 Bacteria 1308
69 Ga0070695_100002753 3300005545 Bacteria 10198
70 Ga0070696_100246985 3300005546 Bacteria 1348
71 Ga0070665_100140158 3300005548 Bacteria 2421
72 Ga0068855_100079187 3300005563 Bacteria 3811
73 Ga0070664_100000122 3300005564 Bacteria 51758
74 Ga0068857_100004573 3300005577 Bacteria 11714
75 Ga0068854_100000121 3300005578 Bacteria 53603
76 Ga0068856_100001426 3300005614 Bacteria 25069
77 Ga0068864_100012311 3300005618 Bacteria 7070
78 Ga0068851_10010340 3300005834 Bacteria 4353
79 Ga0068851_10041918 3300005834 Bacteria 2303
80 Ga0068863_100351847 3300005841 Bacteria 1435
81 Ga0068860_100475068 3300005843 Bacteria 1245
82 Ga0070717_10198690 3300006028 Bacteria 1755
83 Ga0075365_10002292 3300006038 Bacteria 9305
84 Ga0075365_10060213 3300006038 Bacteria 2532
85 Ga0075363_100044603 3300006048 Bacteria 2350
86 Ga0075363_100066392 3300006048 Bacteria 1952
87 Ga0075364_10019297 3300006051 Bacteria 4278
88 Ga0075362_10001196 3300006177 Bacteria 8162
89 Ga0075362_10002954 3300006177 Bacteria 5837
90 Ga0075367_10118248 3300006178 Bacteria 1631
91 Ga0075366_10022219 3300006195 Bacteria 3690
92 Ga0075366_10075370 3300006195 Bacteria 2012
93 Ga0075366_10091864 3300006195 Bacteria 1818
94 Ga0097621_100307088 3300006237 Bacteria 1402
95 Ga0075370_10028299 3300006353 Bacteria 3114
96 Ga0075370_10029632 3300006353 Bacteria 3049
97 Ga0075370_10121230 3300006353 Bacteria 1522
98 Ga0075428_100000569 3300006844 Bacteria 37598
99 Ga0075428_100195271 3300006844 Bacteria 2189
100 Ga0075430_100000021 3300006846 Bacteria 83951
101 Ga0075433_10001898 3300006852 Bacteria 15723
102 Ga0075433_10132364 3300006852 Bacteria 2216
103 Ga0075433_10145148 3300006852 Bacteria 2110
104 Ga0075434_100009483 3300006871 Bacteria 9078
105 Ga0075434_100012102 3300006871 Bacteria 8169
106 Ga0075434_100043132 3300006871 Bacteria 4473
107 Ga0075434_100072346 3300006871 Bacteria 3440
108 Ga0075434_100188811 3300006871 Bacteria 2081
109 Ga0075429_100000375 3300006880 Bacteria 32935
110 Ga0075429_100019209 3300006880 Bacteria 5920
111 Ga0075436_100010774 3300006914 Bacteria 6272
112 Ga0075436_100012353 3300006914 Bacteria 5852
113 Ga0075436_100013296 3300006914 Bacteria 5637
114 Ga0075436_100083046 3300006914 Bacteria 2223
115 Ga0099824_1024096 3300006942 Bacteria 3639
116 Ga0099823_1000002 3300006944 Bacteria 212272
117 Ga0079104_1000194 3300006946 Bacteria 85426
118 Ga0099826_10088238 3300006948 Bacteria 1906
119 Ga0075435_100002109 3300007076 Bacteria 13085
120 Ga0075435_100040132 3300007076 Bacteria 3737
121 Ga0075435_100077737 3300007076 Bacteria 2721
122 Ga0075435_100384092 3300007076 Bacteria 1206
123 Ga0099794_10117711 3300007265 Bacteria 1335
124 Ga0105240_10004318 3300009093 Bacteria 21701
125 Ga0105240_10026585 3300009093 Bacteria 7594
126 Ga0111539_10151395 3300009094 Bacteria 2715
127 Ga0111539_10434409 3300009094 Bacteria 1529
128 Ga0105245_10368294 3300009098 Bacteria 1428
129 Ga0114129_10006039 3300009147 Bacteria 17170
130 Ga0114129_10015140 3300009147 Bacteria 10977
131 Ga0114129_10027881 3300009147 Bacteria 7998
132 Ga0114129_10108933 3300009147 Bacteria 3823
133 Ga0105243_10006651 3300009148 Bacteria 8923
134 Ga0105243_10019822 3300009148 Bacteria 5101
135 Ga0105241_10139257 3300009174 Bacteria 1974
136 Ga0105242_10004317 3300009176 Bacteria 11072
137 Ga0105248_10503525 3300009177 Bacteria 1365
138 Ga0105237_10000080 3300009545 Bacteria 127788
139 Ga0105238_10005068 3300009551 Bacteria 13021
140 Ga0105239_10000116 3300010375 Bacteria 112811
141 Ga0157373_10026092 3300013100 Bacteria 4223
142 Ga0157371_10000072 3300013102 Bacteria 163917
143 Ga0157371_10176776 3300013102 Bacteria 1526
144 Ga0157370_10000031 3300013104 Bacteria 139879
145 Ga0157370_10096261 3300013104 Bacteria 2777
146 Ga0157372_10031683 3300013307 Bacteria 5789
147 Ga0157375_10862116 3300013308 Bacteria 1052
148 Ga0163163_10387795 3300014325 Bacteria 1455
149 Ga0182008_10005470 3300014497 Bacteria 7233
150 Ga0157379_10222801 3300014968 Bacteria 1709
151 Ga0157379_10541060 3300014968 Bacteria 1083
152 Ga0182006_1004474 3300015261 Bacteria 6881
153 Ga0182006_1008178 3300015261 Bacteria 4746
154 Ga0182007_10004417 3300015262 Bacteria 6374
155 Ga0182007_10017871 3300015262 Bacteria 2581
156 Ga0182005_1043028 3300015265 Bacteria 1228
157 Ga0183362_10004 3300015683 Bacteria 569303
158 Ga0163161_10000210 3300017792 Bacteria 53340
159 Ga0163161_10214000 3300017792 Bacteria 1490
160 Ga0154015_1302157 3300020610 Bacteria 6345
161 Ga0213875_10000030 3300021388 Bacteria 178500
162 Ga0209784_100006 3300025224 Bacteria 930704
163 Ga0209784_100616 3300025224 Bacteria 11294
164 Ga0209566_100002 3300025225 Bacteria 2614868
165 Ga0209566_100428 3300025225 Bacteria 31946
166 Ga0209674_100010 3300025226 Bacteria 1038638
167 Ga0209674_100098 3300025226 Bacteria 167037
168 Ga0209672_100364 3300025228 Bacteria 28325
169 Ga0209672_100423 3300025228 Bacteria 24757
170 Ga0209147_100015 3300025229 Bacteria 565073
171 Ga0209147_100433 3300025229 Bacteria 26866
172 Ga0209563_100004 3300025230 Bacteria 1814108
173 Ga0209258_100009 3300025242 Bacteria 996276
174 Ga0209258_100021 3300025242 Bacteria 565073
175 Ga0207425_1000189 3300025245 Bacteria 50055
176 Ga0207425_1000238 3300025245 Bacteria 42734
177 Ga0207425_1004456 3300025245 Bacteria 4196
178 Ga0209646_1000082 3300025246 Bacteria 200645
179 Ga0209026_1001639 3300025250 Bacteria 9523
180 Ga0209677_100007 3300025253 Bacteria 1021332
181 Ga0209677_101888 3300025253 Bacteria 8468
182 Ga0209148_1000007 3300025254 Bacteria 1592273
183 Ga0209148_1000395 3300025254 Bacteria 51537
184 Ga0209759_1001325 3300025256 Bacteria 14542
185 Ga0209759_1001619 3300025256 Bacteria 11998
186 Ga0209129_1000062 3300025258 Bacteria 240655
187 Ga0209129_1000083 3300025258 Bacteria 183270
188 Ga0209129_1002273 3300025258 Bacteria 9590
189 Ga0209565_1001755 3300025263 Bacteria 8841
190 Ga0209455_1000028 3300025272 Bacteria 565073
191 Ga0209673_1000089 3300025273 Bacteria 202240
192 Ga0209673_1003676 3300025273 Bacteria 8843
193 Ga0209673_1006986 3300025273 Bacteria 5318
194 Ga0209673_1019526 3300025273 Bacteria 2430
195 Ga0209673_1020279 3300025273 Bacteria 2359
196 Ga0209130_1000463 3300025284 Bacteria 42235
197 Ga0209130_1000627 3300025284 Bacteria 33309
198 Ga0209130_1003871 3300025284 Bacteria 6029
199 Ga0209675_1000534 3300025291 Bacteria 27862
200 Ga0209675_1004229 3300025291 Bacteria 6475
201 Ga0209675_1029853 3300025291 Bacteria 1308
202 Ga0209676_1000004 3300025292 Bacteria 1138360
203 Ga0209676_1000206 3300025292 Bacteria 132202
204 Ga0209025_1000133 3300025294 Bacteria 195885
205 Ga0209025_1000155 3300025294 Bacteria 169116
206 Ga0209025_1000692 3300025294 Bacteria 57604
207 Ga0209025_1005734 3300025294 Bacteria 9976
208 Ga0209564_1000014 3300025295 Bacteria 621501
209 Ga0209564_1000323 3300025295 Bacteria 93122
210 Ga0209564_1000332 3300025295 Bacteria 91674
211 Ga0209758_1000126 3300025297 Bacteria 189761
212 Ga0209758_1000129 3300025297 Bacteria 185022
213 Ga0209758_1000132 3300025297 Bacteria 183273
214 Ga0209758_1020576 3300025297 Bacteria 3114
215 Ga0209758_1024798 3300025297 Bacteria 2658
216 Ga0209050_1000002 3300025298 Bacteria 1792849
217 Ga0209050_1000118 3300025298 Bacteria 202586
218 Ga0209050_1000282 3300025298 Bacteria 108629
219 Ga0209050_1002923 3300025298 Bacteria 13387
220 Ga0209050_1003576 3300025298 Bacteria 11309
221 Ga0209050_1006981 3300025298 Bacteria 6496
222 Ga0209050_1007456 3300025298 Bacteria 6127
223 Ga0209256_1000015 3300025299 Bacteria 622953
224 Ga0209256_1000375 3300025299 Bacteria 71601
225 Ga0209256_1000385 3300025299 Bacteria 70163
226 Ga0209256_1000659 3300025299 Bacteria 46883
227 Ga0209256_1016632 3300025299 Bacteria 2493
228 Ga0207426_1000323 3300025302 Bacteria 91662
229 Ga0207426_1000424 3300025302 Bacteria 69170
230 Ga0207426_1000517 3300025302 Bacteria 56285
231 Ga0209051_1000002 3300025303 Bacteria 1631846
232 Ga0209051_1000022 3300025303 Bacteria 474879
233 Ga0209051_1000552 3300025303 Bacteria 45581
234 Ga0209051_1000749 3300025303 Bacteria 34903
235 Ga0209051_1002111 3300025303 Bacteria 14867
236 Ga0209051_1003283 3300025303 Bacteria 10725
237 Ga0209051_1019023 3300025303 Bacteria 3014
238 Ga0209257_1000002 3300025304 Bacteria 1767052
239 Ga0209257_1000022 3300025304 Bacteria 765258
240 Ga0209257_1000030 3300025304 Bacteria 689812
241 Ga0209257_1000312 3300025304 Bacteria 102739
242 Ga0209257_1012820 3300025304 Bacteria 3812
243 Ga0207656_10010685 3300025321 Bacteria 3446
244 Ga0207655_1004685 3300025728 Bacteria 9586
245 Ga0207647_10087424 3300025904 Bacteria 1862
246 Ga0207645_10201759 3300025907 Bacteria 1309
247 Ga0207684_10001486 3300025910 Bacteria 25217
248 Ga0207684_10004735 3300025910 Bacteria 12758
249 Ga0207695_10002251 3300025913 Bacteria 28914
250 Ga0207695_10004216 3300025913 Bacteria 19757
251 Ga0207671_10003680 3300025914 Bacteria 15115
252 Ga0207657_10108038 3300025919 Bacteria 2300
253 Ga0207649_10000449 3300025920 Bacteria 29607
254 Ga0207646_10011702 3300025922 Bacteria 8483
255 Ga0207646_10036294 3300025922 Bacteria 4449
256 Ga0207646_10136131 3300025922 Bacteria 2212
257 Ga0207681_10005500 3300025923 Bacteria 7777
258 Ga0207694_10006723 3300025924 Bacteria 8736
259 Ga0207694_10334026 3300025924 Bacteria 1252
260 Ga0207664_10043153 3300025929 Bacteria 3525
261 Ga0207644_10382399 3300025931 Bacteria 1148
262 Ga0207690_10005650 3300025932 Bacteria 7390
263 Ga0207686_10013399 3300025934 Bacteria 4536
264 Ga0207709_10007351 3300025935 Bacteria 6138
265 Ga0207711_10049904 3300025941 Bacteria 3582
266 Ga0207689_10137081 3300025942 Bacteria 2015
267 Ga0207679_10000007 3300025945 Bacteria 460140
268 Ga0207640_10000107 3300025981 Bacteria 63143
269 Ga0207658_10007588 3300025986 Bacteria 7391
270 Ga0207639_10306751 3300026041 Bacteria 1405
271 Ga0207678_10000207 3300026067 Bacteria 51939
272 Ga0207708_10071768 3300026075 Bacteria 2653
273 Ga0207702_10000260 3300026078 Bacteria 61036
274 Ga0207674_10088393 3300026116 Bacteria 3092
275 Ga0207674_10108997 3300026116 Bacteria 2745
276 Ga0207683_10037660 3300026121 Bacteria 4213
277 Ga0209281_1000083 3300027111 Bacteria 255034
278 Ga0209389_1000340 3300027296 Bacteria 28501
279 Ga0209371_1000003 3300027312 Bacteria 1122971
280 Ga0209588_1021831 3300027671 Bacteria 2013
281 Ga0268266_10083474 3300028379 Bacteria 2789
282 Ga0307517_10004249 3300028786 Bacteria 22093
283 Ga0307515_10000468 3300028794 Bacteria 96483
284 Ga0307515_10000996 3300028794 Bacteria 64755
285 Ga0307515_10016105 3300028794 Bacteria 13712
286 Ga0307515_10023690 3300028794 Bacteria 10740
287 Ga0307515_10033855 3300028794 Bacteria 8395
288 Ga0307515_10083379 3300028794 Bacteria 4120
289 Ga0307515_10157508 3300028794 Bacteria 2335
290 Ga0307515_10168734 3300028794 Bacteria 2193
291 Ga0268256_1000004 3300030500 Bacteria 1122967
292 Ga0307512_10091169 3300030522 Bacteria 2121
293 Ga0314311_1004344 3300030733 Bacteria 3205
294 Ga0316178_1040733 3300030735 Bacteria 3008
295 Ga0316183_1025593 3300030742 Bacteria 2035
296 Ga0316182_1127356 3300030745 Bacteria 2412
297 Ga0265328_10003064 3300031239 Bacteria 7458
298 Ga0265327_10000143 3300031251 Bacteria 156870
299 Ga0265327_10002325 3300031251 Bacteria 20322
300 Ga0307513_10009782 3300031456 Bacteria 12111
301 Ga0307513_10010816 3300031456 Bacteria 11398
302 Ga0307513_10038458 3300031456 Bacteria 5312
303 Ga0307513_10154013 3300031456 Bacteria 2201
304 Ga0307513_10325626 3300031456 Bacteria 1293
305 Ga0307509_10006186 3300031507 Bacteria 16221
306 Ga0307509_10013803 3300031507 Bacteria 9532
307 Ga0307509_10047956 3300031507 Bacteria 4591
308 Ga0307509_10204277 3300031507 Bacteria 1808
309 Ga0307509_10263176 3300031507 Bacteria 1498
310 Ga0307408_100025084 3300031548 Bacteria 4079
311 Ga0307408_100407240 3300031548 Bacteria 1169
312 Ga0307508_10137279 3300031616 Bacteria 2048
313 Ga0307514_10012067 3300031649 Bacteria 7193
314 Ga0307514_10066287 3300031649 Bacteria 2731
315 Ga0307516_10013210 3300031730 Bacteria 8818
316 Ga0307516_10264207 3300031730 Bacteria 1410
317 Ga0307405_10057896 3300031731 Bacteria 2436
318 Ga0307406_10006155 3300031901 Bacteria 6600
319 Ga0307416_100051416 3300032002 Bacteria 3291
320 Ga0307416_100554160 3300032002 Bacteria 1223
321 Ga0307510_10001484 3300033180 Bacteria 25882
322 Ga0307510_10029737 3300033180 Bacteria 6210
323 Ga0307510_10133499 3300033180 Bacteria 2147
324 Ga0307510_10156716 3300033180 Bacteria 1883
325 Ga0373937_0069374 3300036401 Bacteria 3250
326 Ga0395899_0090468 3300037312 Bacteria 2219
327 Ga0395900_0009997 3300037418 Bacteria 9708
328 Ga0395900_0078567 3300037418 Bacteria 3390
329 Ga0395898_0016690 3300037466 Bacteria 7505
330 Ga0395905_0000181 3300037471 Bacteria 100569
331 Ga0436364_0048713 3300037853 Bacteria 1314
332 Ga0436364_0164703 3300037853 Bacteria 3471
333 Ga0395901_0018012 3300038443 Bacteria 7209
334 Ga0436365_0361666 3300039437 Bacteria 1881
335 Ga0439436_0017633 3300041404 Bacteria 2136
336 Ga0439439_0004879 3300041406 Bacteria 3040
337 Ga0451800_0435002 3300041459 Bacteria 1529
338 Ga0451802_1617884 3300041460 Bacteria 1621
339 Ga0451804_0553819 3300041463 Bacteria 1124
340 Ga0451807_0833619 3300041486 Bacteria 1547
341 Ga0451855_1366561 3300041511 Bacteria 1196
342 Ga0439449_0017485 3300042007 Bacteria 2693
343 Ga0439457_027196 3300042014 Bacteria 1266
344 Ga0450919_003166 3300042121 Bacteria 2090
345 Ga0450898_028713 3300042134 Bacteria 1012
346 Ga0450906_023953 3300042145 Bacteria 1086
347 Ga0439446_0018184 3300042156 Bacteria 1967
348 Ga0439434_0013319 3300042435 Bacteria 2441
349 Ga0450918_000218 3300042531 Bacteria 13121
350 Ga0466969_0033048 3300044656 Bacteria 2629
351 Ga0466978_0127421 3300044671 Bacteria 1568
352 Ga0453683_0005531 3300044673 Bacteria 8807
353 Ga0466965_0033846 3300044683 Bacteria 2498
354 Ga0466961_0000242 3300044693 Bacteria 36694
355 Ga0466964_0006208 3300044706 Bacteria 4453
356 Ga0453684_0021150 3300044712 Bacteria 9746
357 Ga0466968_0085874 3300044735 Bacteria 1388
358 Ga0466970_0002465 3300044765 Bacteria 8949
359 Ga0466960_0034748 3300044901 Bacteria 2352
360 Ga0466959_0016492 3300045049 Bacteria 5398
361 Ga0451576_0039332 3300045051 Bacteria 5005
362 Ga0451576_0041514 3300045051 Bacteria 4863
363 Ga0466967_0006234 3300045976 Bacteria 8408
364 Ga0495592_0000495 3300046454 Bacteria 28713
365 Ga0495638_0133199 3300046460 Bacteria 1458
366 Ga0495639_0003270 3300046475 Bacteria 7037
367 Ga0495610_0062947 3300046512 Bacteria 1758
368 Ga0495616_0000899 3300046513 Bacteria 21469
369 Ga0495632_0017745 3300046519 Bacteria 3922
370 Ga0495637_0007675 3300046520 Bacteria 5335
371 Ga0495643_0113569 3300046522 Bacteria 1375
372 Ga0495666_0066709 3300046526 Bacteria 1715
373 Ga0495654_0002885 3300046530 Bacteria 10786
374 Ga0495625_0000057 3300046660 Bacteria 181623
375 Ga0495599_0130581 3300046678 Bacteria 1560
376 Ga0495624_0082086 3300046690 Bacteria 1995
377 Ga0495672_0108136 3300047320 Bacteria 1496
378 Ga0495676_0061247 3300047321 Bacteria 2944
379 Ga0495676_0233218 3300047321 Bacteria 1263
380 Ga0495685_035318 3300047447 Bacteria 1718
381 Ga0495593_0006885 3300047673 Bacteria 6658
382 Ga0495614_0014202 3300048089 Bacteria 3490
383 Ga0496101_0044140 3300048904 Bacteria 3189
384 Ga0496102_0012945 3300048905 Bacteria 7224
385 Ga0496102_0045310 3300048905 Bacteria 3993
386 Ga0496102_0474739 3300048905 Bacteria 1172
387 Ga0496103_0037782 3300048906 Bacteria 2960
388 Ga0496104_0002642 3300048907 Bacteria 15420
389 Ga0496106_0481355 3300048909 Bacteria 997
390 Ga0496108_0073364 3300048911 Bacteria 2889
391 Ga0496109_0036306 3300048912 Bacteria 4448
392 Ga0496110_0020858 3300048913 Bacteria 5536
393 Ga0496111_0056807 3300048914 Bacteria 2832
394 Ga0496122_0000039 3300048925 Bacteria 295352
395 Ga0496122_0144007 3300048925 Bacteria 1485
396 Ga0496123_0000026 3300048926 Bacteria 318040
397 Ga0496124_0000126 3300048927 Bacteria 159539
398 Ga0496124_0011786 3300048927 Bacteria 8713
399 Ga0496125_0029741 3300048928 Bacteria 4902
400 Ga0496125_0079785 3300048928 Bacteria 2508
401 Ga0496125_0164908 3300048928 Bacteria 1499
402 Ga0501034_0049824 3300049571 Bacteria 4225
403 Ga0501034_0093665 3300049571 Bacteria 3001
404 Ga0501034_0153637 3300049571 Bacteria 2277
405 Ga0501037_0064679 3300049573 Bacteria 2665
406 Ga0501039_0393811 3300049575 Bacteria 1088
407 Ga0501043_0026628 3300049579 Bacteria 4537
408 Ga0501043_0159304 3300049579 Bacteria 1764
409 Ga0501047_0078127 3300049581 Bacteria 3183
410 Ga0501067_0003970 3300049583 Bacteria 8162
411 Ga0501070_0129165 3300049586 Bacteria 2088
412 Ga0501072_0551821 3300049588 Bacteria 910
413 Ga0501073_0026363 3300049589 Bacteria 4165
414 Ga0501076_0155878 3300049592 Bacteria 1859
415 Ga0501077_0085280 3300049593 Bacteria 2002
416 Ga0501249_013664 3300049679 Bacteria 1727
417 Ga0501225_0005204 3300049705 Bacteria 3829
418 Ga0501080_0177944 3300049742 Bacteria 1959
419 Ga0501083_0013652 3300049744 Bacteria 5679
420 Ga0501035_0015893 3300049822 Bacteria 6945
421 Ga0501035_0082715 3300049822 Bacteria 2833
422 Ga0501044_0056675 3300049823 Bacteria 4023
423 Ga0501044_0149309 3300049823 Bacteria 2320
424 nmdc:mga03683_394_c1 3300050489 Bacteria 9398
425 nmdc:mga0yw44_23307_c1 3300050492 Bacteria 3486
426 nmdc:mga0k408_12966_c1 3300050493 Bacteria 4204
427 nmdc:mga0k408_50518_c2 3300050493 Bacteria 1581
428 nmdc:mga0k408_9068_c1 3300050493 Bacteria 4574
429 nmdc:mga06z11_4490_c1 3300050494 Bacteria 5493
430 nmdc:mga07m45_119790_c1 3300050496 Bacteria 1520
431 nmdc:mga07m45_31081_c1 3300050496 Bacteria 2959
432 nmdc:mga05p37_2330_c1 3300050507 Bacteria 22105
433 nmdc:mga05p37_3465_c1 3300050507 Bacteria 18430
434 nmdc:mga05p37_3512_c1 3300050507 Bacteria 18320
435 nmdc:mga05p37_4649_c1 3300050507 Bacteria 16049
436 nmdc:mga09592_13107_c1 3300050508 Bacteria 6765
437 nmdc:mga09592_18143_c1 3300050508 Bacteria 5771
438 nmdc:mga0qj67_689_c1 3300050509 Bacteria 23022
439 nmdc:mga06r32_1730_c1 3300050510 Bacteria 19651
440 nmdc:mga06r32_79371_c1 3300050510 Bacteria 3193
441 nmdc:mga0n895_2591_c1 3300050512 Bacteria 14200
442 nmdc:mga0n895_26241_c1 3300050512 Bacteria 5514
443 nmdc:mga0n895_30084_c1 3300050512 Bacteria 5186
444 nmdc:mga0n895_4605_c1 3300050512 Bacteria 11365
445 nmdc:mga0rr50_112808_c1 3300050513 Bacteria 2154
446 nmdc:mga0rr50_234367_c1 3300050513 Bacteria 1520
447 nmdc:mga0rr50_4214_c1 3300050513 Bacteria 8407
448 nmdc:mga0rr50_43238_c1 3300050513 Bacteria 3295
449 nmdc:mga08x19_119008_c1 3300050514 Bacteria 1769
450 nmdc:mga08x19_183388_c1 3300050514 Bacteria 1429
451 nmdc:mga08x19_2840_c1 3300050514 Bacteria 10447
452 nmdc:mga08x19_89314_c1 3300050514 Bacteria 2032
453 nmdc:mga0a205_110829_c1 3300050515 Bacteria 2643
454 nmdc:mga0a205_15780_c1 3300050515 Bacteria 7062
455 nmdc:mga0a205_23567_c1 3300050515 Bacteria 5839
456 nmdc:mga0a205_70466_c1 3300050515 Bacteria 3376
457 Ga0500610_0015661 3300053079 Bacteria 3596
458 Ga0500610_0078864 3300053079 Bacteria 1715
459 Ga0500578_0000040 3300053086 Bacteria 133601
460 Ga0500651_0000261 3300053093 Bacteria 31479
461 Ga0500651_0128722 3300053093 Bacteria 1532
462 Ga0500594_0000600 3300053118 Bacteria 7720
463 Ga0500594_0004565 3300053118 Bacteria 3052
464 Ga0500628_002997 3300053129 Bacteria 2776
465 Ga0500655_011283 3300053133 Bacteria 1617
466 Ga0500658_0008702 3300053134 Bacteria 3746
467 Ga0500658_0009380 3300053134 Bacteria 3609
468 Ga0500559_0001133 3300053136 Bacteria 16045
469 Ga0500559_0035868 3300053136 Bacteria 2143
470 Ga0500622_0000138 3300053156 Bacteria 77892
471 Ga0500622_0005474 3300053156 Bacteria 7622
472 Ga0500627_0075640 3300053158 Bacteria 1496
473 Ga0500634_0074122 3300053161 Bacteria 1773
474 Ga0501084_0110608 3300054114 Bacteria 2308
475 Ga0501082_0018308 3300060353 Bacteria 6030
476 Ga0466962_0118867 3300061719 Bacteria 1274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046678 Ga0495599_0130581 Ga0495599_0130581_441_1304 235
2 3300049571 Ga0501034_0093665 Ga0501034_0093665_1520_2368 245
3 3300027312 Ga0209371_1000003 Ga0209371_1000003111 255
4 3300030500 Ga0268256_1000004 Ga0268256_1000004940 255
5 3300030745 Ga0316182_1127356 Ga0316182_11273563 255
6 3300049588 Ga0501072_0551821 Ga0501072_0551821_41_889 256
7 3300049583 Ga0501067_0003970 Ga0501067_0003970_38_886 257
8 3300049593 Ga0501077_0085280 Ga0501077_0085280_472_1320 257
9 3300005536 Ga0070697_100032673 Ga0070697_1000326731 258
10 3300005467 Ga0070706_100221576 Ga0070706_1002215762 259
11 3300006852 Ga0075433_10001898 Ga0075433_1000189814 259
12 3300006871 Ga0075434_100043132 Ga0075434_1000431322 259
13 3300006914 Ga0075436_100010774 Ga0075436_1000107741 259
14 3300007076 Ga0075435_100040132 Ga0075435_1000401325 259
15 3300009147 Ga0114129_10027881 Ga0114129_100278817 259
16 3300050507 nmdc:mga05p37_3465_c1 nmdc:mga05p37_3465_c1_10993_11898 259
17 3300050512 nmdc:mga0n895_4605_c1 nmdc:mga0n895_4605_c1_7681_8586 259
18 3300050513 nmdc:mga0rr50_112808_c1 nmdc:mga0rr50_112808_c1_107_1012 259
19 3300050514 nmdc:mga08x19_2840_c1 nmdc:mga08x19_2840_c1_4732_5637 259
20 3300050515 nmdc:mga0a205_70466_c1 nmdc:mga0a205_70466_c1_2365_3270 259
21 3300006844 Ga0075428_100195271 Ga0075428_1001952712 260
22 3300006880 Ga0075429_100019209 Ga0075429_1000192097 260
23 3300007265 Ga0099794_10117711 Ga0099794_101177112 260
24 3300009147 Ga0114129_10015140 Ga0114129_1001514012 260
25 3300027671 Ga0209588_1021831 Ga0209588_10218312 260
26 3300049589 Ga0501073_0026363 Ga0501073_0026363_1175_2080 260
27 3300049592 Ga0501076_0155878 Ga0501076_0155878_312_1217 260
28 3300049744 Ga0501083_0013652 Ga0501083_0013652_1145_2050 260
29 3300050507 nmdc:mga05p37_2330_c1 nmdc:mga05p37_2330_c1_13884_14789 260
30 3300050508 nmdc:mga09592_13107_c1 nmdc:mga09592_13107_c1_203_1108 260
31 3300050510 nmdc:mga06r32_1730_c1 nmdc:mga06r32_1730_c1_7429_8334 260
32 3300054114 Ga0501084_0110608 Ga0501084_0110608_1026_1931 260
33 3300060353 Ga0501082_0018308 Ga0501082_0018308_1790_2695 260
34 3300005445 Ga0070708_100019655 Ga0070708_1000196557 261
35 3300005468 Ga0070707_100037083 Ga0070707_1000370837 261
36 3300005518 Ga0070699_100018199 Ga0070699_1000181997 261
37 3300005536 Ga0070697_100037601 Ga0070697_1000376012 261
38 3300005546 Ga0070696_100246985 Ga0070696_1002469852 261
39 3300025910 Ga0207684_10004735 Ga0207684_100047353 261
40 3300025922 Ga0207646_10011702 Ga0207646_100117027 261
41 3300003215 JGI25153J46596_10009787 JGI25153J46596_100097872 265
42 3300025297 Ga0209758_1000126 Ga0209758_1000126121 265
43 3300042121 Ga0450919_003166 Ga0450919_003166_668_1483 265
44 3300053093 Ga0500651_0128722 Ga0500651_0128722_251_1117 265
45 3300031456 Ga0307513_10038458 Ga0307513_100384586 268
46 3300045051 Ga0451576_0041514 Ga0451576_0041514_1153_2064 268
47 3300006914 Ga0075436_100013296 Ga0075436_1000132964 271
48 3300036401 Ga0373937_0069374 Ga0373937_0069374_1577_2422 271
49 3300003775 Ga0055524_1000294 Ga0055524_100029441 273
50 3300004625 Ga0055543_1030231 Ga0055543_10302311 273
51 3300005262 Ga0065165_1004200 Ga0065165_10042002 273
52 3300005539 Ga0068853_100386453 Ga0068853_1003864532 273
53 3300025291 Ga0209675_1029853 Ga0209675_10298531 273
54 3300025298 Ga0209050_1000118 Ga0209050_1000118175 273
55 3300025299 Ga0209256_1000015 Ga0209256_100001586 273
56 3300025303 Ga0209051_1019023 Ga0209051_10190232 273
57 3300026041 Ga0207639_10306751 Ga0207639_103067512 273
58 3300006237 Ga0097621_100307088 Ga0097621_1003070882 274
59 3300006353 Ga0075370_10029632 Ga0075370_100296322 274
60 3300006871 Ga0075434_100072346 Ga0075434_1000723462 274
61 3300007076 Ga0075435_100077737 Ga0075435_1000777374 274
62 3300025728 Ga0207655_1004685 Ga0207655_100468510 274
63 3300025924 Ga0207694_10334026 Ga0207694_103340261 274
64 3300025935 Ga0207709_10007351 Ga0207709_100073513 274
65 3300050512 nmdc:mga0n895_26241_c1 nmdc:mga0n895_26241_c1_403_1305 274
66 3300050513 nmdc:mga0rr50_43238_c1 nmdc:mga0rr50_43238_c1_886_1788 274
67 3300006871 Ga0075434_100188811 Ga0075434_1001888112 275
68 3300009148 Ga0105243_10019822 Ga0105243_100198223 275
69 3300014497 Ga0182008_10005470 Ga0182008_100054703 275
70 3300015262 Ga0182007_10004417 Ga0182007_100044175 275
71 3300033180 Ga0307510_10156716 Ga0307510_101567162 275
72 3300048928 Ga0496125_0029741 Ga0496125_0029741_3476_4348 275
73 3300050514 nmdc:mga08x19_183388_c1 nmdc:mga08x19_183388_c1_296_1222 275
74 3300006038 Ga0075365_10002292 Ga0075365_100022925 276
75 3300006051 Ga0075364_10019297 Ga0075364_100192972 276
76 3300006177 Ga0075362_10001196 Ga0075362_100011966 276
77 3300006195 Ga0075366_10075370 Ga0075366_100753702 276
78 3300009094 Ga0111539_10151395 Ga0111539_101513951 276
79 3300025904 Ga0207647_10087424 Ga0207647_100874242 276
80 3300025907 Ga0207645_10201759 Ga0207645_102017591 276
81 3300028794 Ga0307515_10000996 Ga0307515_1000099641 276
82 3300031456 Ga0307513_10009782 Ga0307513_100097829 276
83 3300031649 Ga0307514_10012067 Ga0307514_100120675 276
84 3300033180 Ga0307510_10133499 Ga0307510_101334991 276
85 3300046520 Ga0495637_0007675 Ga0495637_0007675_721_1602 276
86 3300050489 nmdc:mga03683_394_c1 nmdc:mga03683_394_c1_1809_2690 276
87 3300050492 nmdc:mga0yw44_23307_c1 nmdc:mga0yw44_23307_c1_979_1860 276
88 3300050493 nmdc:mga0k408_12966_c1 nmdc:mga0k408_12966_c1_2754_3635 276
89 3300053079 Ga0500610_0015661 Ga0500610_0015661_2046_2927 276
90 3300053079 Ga0500610_0078864 Ga0500610_0078864_24_905 276
91 3300053158 Ga0500627_0075640 Ga0500627_0075640_456_1337 276
92 3300009098 Ga0105245_10368294 Ga0105245_103682942 277
93 3300025298 Ga0209050_1007456 Ga0209050_10074562 277
94 3300028379 Ga0268266_10083474 Ga0268266_100834743 277
95 3300002773 JGI25152J39213_1005183 JGI25152J39213_10051833 278
96 3300003215 JGI25153J46596_10004528 JGI25153J46596_100045284 278
97 3300003771 Ga0055526_1002654 Ga0055526_10026542 278
98 3300003790 Ga0055528_1032441 Ga0055528_10324412 278
99 3300003791 Ga0055530_10007636 Ga0055530_100076364 278
100 3300003792 Ga0055540_1003653 Ga0055540_10036533 278
101 3300003792 Ga0055540_1008366 Ga0055540_10083662 278
102 3300006178 Ga0075367_10118248 Ga0075367_101182482 278
103 3300025245 Ga0207425_1000238 Ga0207425_100023814 278
104 3300025258 Ga0209129_1000062 Ga0209129_100006231 278
105 3300025273 Ga0209673_1019526 Ga0209673_10195262 278
106 3300025292 Ga0209676_1000206 Ga0209676_1000206123 278
107 3300025295 Ga0209564_1000014 Ga0209564_100001451 278
108 3300025297 Ga0209758_1000129 Ga0209758_1000129138 278
109 3300025298 Ga0209050_1003576 Ga0209050_10035763 278
110 3300025299 Ga0209256_1016632 Ga0209256_10166323 278
111 3300025303 Ga0209051_1000749 Ga0209051_100074928 278
112 3300025303 Ga0209051_1002111 Ga0209051_10021119 278
113 3300025304 Ga0209257_1000312 Ga0209257_100031213 278
114 3300050496 nmdc:mga07m45_31081_c1 nmdc:mga07m45_31081_c1_1825_2721 278
115 3300053086 Ga0500578_0000040 Ga0500578_0000040_77839_78693 278
116 iso_pu_bacteria 2588253510 2588290715 278
117 iso_pu_bacteria 2643221592 2643972207 278
118 iso_pu_bacteria 2643221625 2644141682 278
119 iso_pu_bacteria 2643221648 2644275547 278
120 3300001989 JGI24739J22299_10052753 JGI24739J22299_100527531 279
121 3300002739 JGI25158J39367_1003505 JGI25158J39367_10035052 279
122 3300002773 JGI25152J39213_1013359 JGI25152J39213_10133592 279
123 3300002774 JGI25150J39212_1005830 JGI25150J39212_10058303 279
124 3300002987 JGI25159J45721_1011718 JGI25159J45721_10117182 279
125 3300003187 JGI25151J46595_10009103 JGI25151J46595_100091033 279
126 3300003761 Ga0055535_1000442 Ga0055535_100044235 279
127 3300003762 Ga0055542_1000052 Ga0055542_1000052117 279
128 3300003784 Ga0055534_1006771 Ga0055534_10067712 279
129 3300003791 Ga0055530_10004436 Ga0055530_100044363 279
130 3300005289 Ga0065704_10089200 Ga0065704_100892003 279
131 3300005539 Ga0068853_100065424 Ga0068853_1000654243 279
132 3300005563 Ga0068855_100079187 Ga0068855_1000791872 279
133 3300005618 Ga0068864_100012311 Ga0068864_1000123117 279
134 3300005834 Ga0068851_10010340 Ga0068851_100103402 279
135 3300006914 Ga0075436_100083046 Ga0075436_1000830462 279
136 3300006948 Ga0099826_10088238 Ga0099826_100882381 279
137 3300009148 Ga0105243_10006651 Ga0105243_100066517 279
138 3300013102 Ga0157371_10176776 Ga0157371_101767762 279
139 3300013104 Ga0157370_10096261 Ga0157370_100962613 279
140 3300017792 Ga0163161_10000210 Ga0163161_100002102 279
141 3300017792 Ga0163161_10214000 Ga0163161_102140002 279
142 3300025228 Ga0209672_100364 Ga0209672_10036413 279
143 3300025229 Ga0209147_100433 Ga0209147_1004335 279
144 3300025242 Ga0209258_100009 Ga0209258_10000948 279
145 3300025245 Ga0207425_1000189 Ga0207425_100018939 279
146 3300025254 Ga0209148_1000007 Ga0209148_100000748 279
147 3300025258 Ga0209129_1000083 Ga0209129_1000083111 279
148 3300025258 Ga0209129_1002273 Ga0209129_10022732 279
149 3300025263 Ga0209565_1001755 Ga0209565_10017557 279
150 3300025273 Ga0209673_1000089 Ga0209673_1000089133 279
151 3300025273 Ga0209673_1003676 Ga0209673_10036767 279
152 3300025284 Ga0209130_1000463 Ga0209130_100046339 279
153 3300025284 Ga0209130_1003871 Ga0209130_10038717 279
154 3300025291 Ga0209675_1000534 Ga0209675_10005342 279
155 3300025291 Ga0209675_1004229 Ga0209675_10042293 279
156 3300025292 Ga0209676_1000004 Ga0209676_1000004459 279
157 3300025294 Ga0209025_1000155 Ga0209025_1000155129 279
158 3300025294 Ga0209025_1000692 Ga0209025_100069215 279
159 3300025294 Ga0209025_1005734 Ga0209025_10057343 279
160 3300025295 Ga0209564_1000323 Ga0209564_100032349 279
161 3300025295 Ga0209564_1000332 Ga0209564_100033249 279
162 3300025297 Ga0209758_1000132 Ga0209758_1000132111 279
163 3300025298 Ga0209050_1000002 Ga0209050_1000002969 279
164 3300025299 Ga0209256_1000375 Ga0209256_100037526 279
165 3300025299 Ga0209256_1000385 Ga0209256_100038526 279
166 3300025302 Ga0207426_1000323 Ga0207426_100032339 279
167 3300025302 Ga0207426_1000517 Ga0207426_100051739 279
168 3300025303 Ga0209051_1000002 Ga0209051_1000002738 279
169 3300025304 Ga0209257_1000002 Ga0209257_1000002879 279
170 3300025321 Ga0207656_10010685 Ga0207656_100106854 279
171 3300025941 Ga0207711_10049904 Ga0207711_100499043 279
172 3300031548 Ga0307408_100025084 Ga0307408_1000250843 279
173 3300031548 Ga0307408_100407240 Ga0307408_1004072402 279
174 3300031901 Ga0307406_10006155 Ga0307406_100061554 279
175 3300032002 Ga0307416_100554160 Ga0307416_1005541602 279
176 3300037471 Ga0395905_0000181 Ga0395905_0000181_38445_39293 279
177 3300041460 Ga0451802_1617884 Ga0451802_1617884_657_1514 279
178 3300041463 Ga0451804_0553819 Ga0451804_0553819_61_918 279
179 3300046460 Ga0495638_0133199 Ga0495638_0133199_174_1091 279
180 3300046512 Ga0495610_0062947 Ga0495610_0062947_148_1065 279
181 3300046513 Ga0495616_0000899 Ga0495616_0000899_20224_21141 279
182 3300047321 Ga0495676_0061247 Ga0495676_0061247_1465_2382 279
183 3300047673 Ga0495593_0006885 Ga0495593_0006885_5012_5929 279
184 3300048089 Ga0495614_0014202 Ga0495614_0014202_581_1498 279
185 3300048904 Ga0496101_0044140 Ga0496101_0044140_1747_2664 279
186 3300048925 Ga0496122_0144007 Ga0496122_0144007_221_1138 279
187 3300048928 Ga0496125_0164908 Ga0496125_0164908_164_1081 279
188 3300049571 Ga0501034_0153637 Ga0501034_0153637_573_1463 279
189 3300049579 Ga0501043_0026628 Ga0501043_0026628_2611_3501 279
190 3300049581 Ga0501047_0078127 Ga0501047_0078127_980_1870 279
191 3300049742 Ga0501080_0177944 Ga0501080_0177944_236_1126 279
192 3300049822 Ga0501035_0015893 Ga0501035_0015893_1522_2412 279
193 3300049823 Ga0501044_0056675 Ga0501044_0056675_325_1215 279
194 3300050514 nmdc:mga08x19_89314_c1 nmdc:mga08x19_89314_c1_298_1230 279
195 3300053093 Ga0500651_0000261 Ga0500651_0000261_4411_5328 279
196 3300053118 Ga0500594_0004565 Ga0500594_0004565_1417_2334 279
197 3300053129 Ga0500628_002997 Ga0500628_002997_471_1328 279
198 3300053133 Ga0500655_011283 Ga0500655_011283_137_1054 279
199 3300053134 Ga0500658_0008702 Ga0500658_0008702_1504_2421 279
200 3300053134 Ga0500658_0009380 Ga0500658_0009380_1119_2036 279
201 3300053136 Ga0500559_0035868 Ga0500559_0035868_780_1697 279
202 3300053156 Ga0500622_0000138 Ga0500622_0000138_22462_23319 279
203 3300053161 Ga0500634_0074122 Ga0500634_0074122_696_1613 279
204 3300003187 JGI25151J46595_10006665 JGI25151J46595_100066652 280
205 3300005456 Ga0070678_100018931 Ga0070678_1000189316 280
206 3300005468 Ga0070707_100059281 Ga0070707_1000592812 280
207 3300005471 Ga0070698_100144580 Ga0070698_1001445802 280
208 3300005518 Ga0070699_100073802 Ga0070699_1000738021 280
209 3300025294 Ga0209025_1000133 Ga0209025_1000133157 280
210 3300025922 Ga0207646_10136131 Ga0207646_101361312 280
211 3300026121 Ga0207683_10037660 Ga0207683_100376602 280
212 3300005834 Ga0068851_10041918 Ga0068851_100419181 281
213 3300009093 Ga0105240_10004318 Ga0105240_1000431815 281
214 3300009174 Ga0105241_10139257 Ga0105241_101392572 281
215 3300009545 Ga0105237_10000080 Ga0105237_1000008058 281
216 3300009551 Ga0105238_10005068 Ga0105238_100050689 281
217 3300010375 Ga0105239_10000116 Ga0105239_1000011650 281
218 3300025913 Ga0207695_10004216 Ga0207695_1000421614 281
219 3300025914 Ga0207671_10003680 Ga0207671_1000368010 281
220 3300025924 Ga0207694_10006723 Ga0207694_100067236 281
221 3300031507 Ga0307509_10263176 Ga0307509_102631762 281
222 3300006871 Ga0075434_100012102 Ga0075434_1000121024 282
223 3300037853 Ga0436364_0048713 Ga0436364_0048713_357_1250 283
224 3300039437 Ga0436365_0361666 Ga0436365_0361666_284_1177 283
225 3300005536 Ga0070697_100002587 Ga0070697_1000025875 284
226 3300009093 Ga0105240_10026585 Ga0105240_100265853 284
227 3300013102 Ga0157371_10000072 Ga0157371_1000007239 284
228 3300013307 Ga0157372_10031683 Ga0157372_100316833 284
229 3300015261 Ga0182006_1008178 Ga0182006_10081783 284
230 3300015265 Ga0182005_1043028 Ga0182005_10430282 284
231 3300025246 Ga0209646_1000082 Ga0209646_100008237 284
232 3300025910 Ga0207684_10001486 Ga0207684_100014863 284
233 3300028794 Ga0307515_10168734 Ga0307515_101687341 284
234 3300046690 Ga0495624_0082086 Ga0495624_0082086_801_1655 284
235 3300047321 Ga0495676_0233218 Ga0495676_0233218_267_1121 284
236 3300044735 Ga0466968_0085874 Ga0466968_0085874_215_1087 285
237 iso_pu_bacteria 2842718218 2842720225 285
238 iso_pu_bacteria 2974320154 2974322796 285
239 3300003791 Ga0055530_10006319 Ga0055530_100063192 286
240 3300003792 Ga0055540_1000028 Ga0055540_100002898 286
241 3300003794 Ga0055531_10005490 Ga0055531_1000549010 286
242 3300003794 Ga0055531_10007116 Ga0055531_1000711610 286
243 3300005539 Ga0068853_100143512 Ga0068853_1001435122 286
244 3300005548 Ga0070665_100140158 Ga0070665_1001401582 286
245 3300005843 Ga0068860_100475068 Ga0068860_1004750682 286
246 3300006946 Ga0079104_1000194 Ga0079104_100019426 286
247 3300007076 Ga0075435_100384092 Ga0075435_1003840922 286
248 3300014968 Ga0157379_10541060 Ga0157379_105410601 286
249 3300025298 Ga0209050_1000282 Ga0209050_10002822 286
250 3300025303 Ga0209051_1000022 Ga0209051_1000022363 286
251 3300025304 Ga0209257_1000030 Ga0209257_1000030561 286
252 3300025922 Ga0207646_10036294 Ga0207646_100362942 286
253 3300025931 Ga0207644_10382399 Ga0207644_103823991 286
254 3300025942 Ga0207689_10137081 Ga0207689_101370812 286
255 3300027111 Ga0209281_1000083 Ga0209281_100008391 286
256 3300028786 Ga0307517_10004249 Ga0307517_1000424920 286
257 3300030522 Ga0307512_10091169 Ga0307512_100911692 286
258 3300031456 Ga0307513_10010816 Ga0307513_100108168 286
259 3300031507 Ga0307509_10006186 Ga0307509_100061862 286
260 3300031507 Ga0307509_10047956 Ga0307509_100479562 286
261 3300031507 Ga0307509_10204277 Ga0307509_102042772 286
262 3300031616 Ga0307508_10137279 Ga0307508_101372792 286
263 3300031730 Ga0307516_10264207 Ga0307516_102642072 286
264 3300033180 Ga0307510_10001484 Ga0307510_1000148423 286
265 3300033180 Ga0307510_10029737 Ga0307510_100297377 286
266 3300046454 Ga0495592_0000495 Ga0495592_0000495_12800_13678 286
267 3300046526 Ga0495666_0066709 Ga0495666_0066709_369_1247 286
268 3300050512 nmdc:mga0n895_30084_c1 nmdc:mga0n895_30084_c1_144_1127 286
269 3300050515 nmdc:mga0a205_15780_c1 nmdc:mga0a205_15780_c1_692_1675 286
270 3300053118 Ga0500594_0000600 Ga0500594_0000600_3404_4282 286
271 3300053136 Ga0500559_0001133 Ga0500559_0001133_9998_10876 286
272 3300053156 Ga0500622_0005474 Ga0500622_0005474_2923_3801 286
273 iso_pu_bacteria 2511231002 2511243031 286
274 iso_pu_bacteria 2585428062 2587758791 286
275 iso_pu_bacteria 2643221644 2644247417 286
276 iso_pu_bacteria 2904479285 2904481368 286
277 iso_pu_bacteria 2945972063 2945976459 286
278 3300005435 Ga0070714_100286265 Ga0070714_1002862652 287
279 3300006028 Ga0070717_10198690 Ga0070717_101986902 287
280 3300006852 Ga0075433_10132364 Ga0075433_101323642 287
281 3300006852 Ga0075433_10145148 Ga0075433_101451482 287
282 3300006871 Ga0075434_100009483 Ga0075434_1000094834 287
283 3300007076 Ga0075435_100002109 Ga0075435_10000210912 287
284 3300009176 Ga0105242_10004317 Ga0105242_100043174 287
285 3300009177 Ga0105248_10503525 Ga0105248_105035251 287
286 3300021388 Ga0213875_10000030 Ga0213875_10000030182 287
287 3300025929 Ga0207664_10043153 Ga0207664_100431532 287
288 3300025934 Ga0207686_10013399 Ga0207686_100133992 287
289 3300028794 Ga0307515_10016105 Ga0307515_100161052 287
290 3300028794 Ga0307515_10023690 Ga0307515_100236902 287
291 3300028794 Ga0307515_10033855 Ga0307515_100338552 287
292 3300028794 Ga0307515_10083379 Ga0307515_100833792 287
293 3300031456 Ga0307513_10154013 Ga0307513_101540131 287
294 3300031507 Ga0307509_10013803 Ga0307509_100138033 287
295 3300031649 Ga0307514_10066287 Ga0307514_100662873 287
296 3300031730 Ga0307516_10013210 Ga0307516_100132108 287
297 3300037853 Ga0436364_0164703 Ga0436364_0164703_727_1692 287
298 3300041459 Ga0451800_0435002 Ga0451800_0435002_208_1089 287
299 3300041511 Ga0451855_1366561 Ga0451855_1366561_252_1133 287
300 3300046519 Ga0495632_0017745 Ga0495632_0017745_273_1154 287
301 3300046522 Ga0495643_0113569 Ga0495643_0113569_442_1323 287
302 3300050493 nmdc:mga0k408_50518_c2 nmdc:mga0k408_50518_c2_111_992 287
303 3300050512 nmdc:mga0n895_2591_c1 nmdc:mga0n895_2591_c1_7736_8629 287
304 3300050513 nmdc:mga0rr50_234367_c1 nmdc:mga0rr50_234367_c1_486_1400 287
305 3300050513 nmdc:mga0rr50_4214_c1 nmdc:mga0rr50_4214_c1_2339_3232 287
306 3300050515 nmdc:mga0a205_110829_c1 nmdc:mga0a205_110829_c1_819_1712 287
307 3300050515 nmdc:mga0a205_23567_c1 nmdc:mga0a205_23567_c1_3142_4056 287
308 iso_pu_bacteria 2547132374 2548498363 287
309 iso_pu_bacteria 2643221570 2643867636 287
310 iso_pu_bacteria 2643221596 2643990554 287
311 iso_pu_bacteria 2643221609 2644062838 287
312 iso_pu_bacteria 2643221611 2644070527 287
313 iso_pu_bacteria 2643221652 2644294928 287
314 iso_pu_bacteria 2643221717 2644648902 287
315 iso_pu_bacteria 2738543012 2739243837 287
316 iso_pu_bacteria 2816332133 2816472677 287
317 iso_pu_bacteria 2990710928 2990713051 287
318 3300026116 Ga0207674_10108997 Ga0207674_101089972 288
319 3300031239 Ga0265328_10003064 Ga0265328_100030643 288
320 3300031251 Ga0265327_10000143 Ga0265327_10000143129 288
321 3300031731 Ga0307405_10057896 Ga0307405_100578962 288
322 3300032002 Ga0307416_100051416 Ga0307416_1000514162 288
323 3300041404 Ga0439436_0017633 Ga0439436_0017633_679_1569 288
324 3300041406 Ga0439439_0004879 Ga0439439_0004879_1928_2818 288
325 3300042014 Ga0439457_027196 Ga0439457_027196_277_1167 288
326 3300042145 Ga0450906_023953 Ga0450906_023953_128_1018 288
327 3300042435 Ga0439434_0013319 Ga0439434_0013319_614_1504 288
328 3300042531 Ga0450918_000218 Ga0450918_000218_3741_4625 288
329 3300046530 Ga0495654_0002885 Ga0495654_0002885_1090_2007 288
330 3300048912 Ga0496109_0036306 Ga0496109_0036306_2162_3037 288
331 iso_pu_bacteria 2738541281 2738746128 288
332 iso_pu_bacteria 2738543032 2739355358 288
333 3300002987 JGI25159J45721_1000215 JGI25159J45721_100021534 289
334 3300003187 JGI25151J46595_10032839 JGI25151J46595_100328392 289
335 3300003354 JGI25160J50197_1000281 JGI25160J50197_100028138 289
336 3300003374 JGI25161J50226_1000124 JGI25161J50226_100012457 289
337 3300003794 Ga0055531_10000353 Ga0055531_1000035332 289
338 3300004625 Ga0055543_1004249 Ga0055543_10042492 289
339 3300005262 Ga0065165_1031614 Ga0065165_10316142 289
340 3300005441 Ga0070700_100046168 Ga0070700_1000461682 289
341 3300005545 Ga0070695_100002753 Ga0070695_1000027536 289
342 3300006048 Ga0075363_100066392 Ga0075363_1000663922 289
343 3300006177 Ga0075362_10002954 Ga0075362_100029542 289
344 3300006195 Ga0075366_10022219 Ga0075366_100222193 289
345 3300006195 Ga0075366_10091864 Ga0075366_100918642 289
346 3300006353 Ga0075370_10028299 Ga0075370_100282993 289
347 3300006353 Ga0075370_10121230 Ga0075370_101212301 289
348 3300025245 Ga0207425_1004456 Ga0207425_10044562 289
349 3300025273 Ga0209673_1006986 Ga0209673_10069863 289
350 3300025284 Ga0209130_1000627 Ga0209130_100062710 289
351 3300025297 Ga0209758_1020576 Ga0209758_10205763 289
352 3300025297 Ga0209758_1024798 Ga0209758_10247982 289
353 3300025298 Ga0209050_1006981 Ga0209050_10069812 289
354 3300025302 Ga0207426_1000424 Ga0207426_100042447 289
355 3300025303 Ga0209051_1000552 Ga0209051_100055216 289
356 3300025304 Ga0209257_1000022 Ga0209257_100002246 289
357 3300026075 Ga0207708_10071768 Ga0207708_100717682 289
358 3300041486 Ga0451807_0833619 Ga0451807_0833619_197_1111 289
359 3300042007 Ga0439449_0017485 Ga0439449_0017485_697_1590 289
360 3300042156 Ga0439446_0018184 Ga0439446_0018184_344_1231 289
361 3300044673 Ga0453683_0005531 Ga0453683_0005531_6728_7642 289
362 3300044712 Ga0453684_0021150 Ga0453684_0021150_5127_6041 289
363 3300045051 Ga0451576_0039332 Ga0451576_0039332_778_1692 289
364 3300048905 Ga0496102_0474739 Ga0496102_0474739_171_1058 289
365 3300050493 nmdc:mga0k408_9068_c1 nmdc:mga0k408_9068_c1_2064_2978 289
366 3300050496 nmdc:mga07m45_119790_c1 nmdc:mga07m45_119790_c1_161_1042 289
367 iso_pu_bacteria 2599185214 2599622893 289
368 iso_pu_bacteria 2599185226 2599671372 289
369 iso_pu_bacteria 2599185227 2599679591 289
370 iso_pu_bacteria 2599185229 2599691607 289
371 iso_pu_bacteria 2738541277 2738718747 289
372 iso_pu_bacteria 2738541307 2738884938 289
373 iso_pu_bacteria 2738543019 2739280765 289
374 iso_pu_bacteria 2818991446 2819602309 289
375 iso_pu_bacteria 2831265667 2831265725 289
376 iso_pu_bacteria 2838054893 2838056440 289
377 iso_pu_bacteria 2842677519 2842681860 289
378 iso_pu_bacteria 2842733646 2842737199 289
379 iso_pu_bacteria 2842747753 2842750438 289
380 iso_pu_bacteria 2899924645 2899930587 289
381 iso_pu_bacteria 2904449895 2904452417 289
382 iso_pu_bacteria 2904456579 2904458435 289
383 iso_pu_bacteria 2904541872 2904546944 289
384 iso_pu_bacteria 2919462493 2919466452 289
385 iso_pu_bacteria 2928037797 2928039701 289
386 iso_pu_bacteria 2928044640 2928044694 289
387 iso_pu_bacteria 2928051484 2928052493 289
388 iso_pu_bacteria 2928064002 2928064843 289
389 iso_pu_bacteria 2928070936 2928074683 289
390 iso_pu_bacteria 2928084124 2928087179 289
391 iso_pu_bacteria 2928115317 2928118435 289
392 iso_pu_bacteria 2929160207 2929164416 289
393 iso_pu_bacteria 2929520902 2929522333 289
394 iso_pu_bacteria 2945909444 2945910884 289
395 iso_pu_bacteria 2945945610 2945946745 289
396 iso_pu_bacteria 2945984333 2945986876 289
397 iso_pu_bacteria 643348564 643597879 289
398 3300005347 Ga0070668_100336938 Ga0070668_1003369381 290
399 3300006048 Ga0075363_100044603 Ga0075363_1000446032 290
400 3300014968 Ga0157379_10222801 Ga0157379_102228011 290
401 3300047320 Ga0495672_0108136 Ga0495672_0108136_60_962 290
402 3300048905 Ga0496102_0045310 Ga0496102_0045310_90_992 290
403 3300048907 Ga0496104_0002642 Ga0496104_0002642_5545_6447 290
404 3300048909 Ga0496106_0481355 Ga0496106_0481355_65_967 290
405 3300048914 Ga0496111_0056807 Ga0496111_0056807_55_957 290
406 3300048927 Ga0496124_0000126 Ga0496124_0000126_11907_12836 290
407 3300048928 Ga0496125_0079785 Ga0496125_0079785_1562_2491 290
408 3300049571 Ga0501034_0049824 Ga0501034_0049824_1130_2077 290
409 3300049573 Ga0501037_0064679 Ga0501037_0064679_1287_2234 290
410 3300049575 Ga0501039_0393811 Ga0501039_0393811_93_1040 290
411 3300049579 Ga0501043_0159304 Ga0501043_0159304_151_1098 290
412 3300049586 Ga0501070_0129165 Ga0501070_0129165_835_1782 290
413 3300049822 Ga0501035_0082715 Ga0501035_0082715_608_1555 290
414 3300049823 Ga0501044_0149309 Ga0501044_0149309_1258_2205 290
415 3300050494 nmdc:mga06z11_4490_c1 nmdc:mga06z11_4490_c1_4041_4937 290
416 3300005841 Ga0068863_100351847 Ga0068863_1003518472 291
417 3300006844 Ga0075428_100000569 Ga0075428_1000005692 291
418 3300006846 Ga0075430_100000021 Ga0075430_10000002126 291
419 3300006880 Ga0075429_100000375 Ga0075429_10000037529 291
420 3300006914 Ga0075436_100012353 Ga0075436_1000123532 291
421 3300009094 Ga0111539_10434409 Ga0111539_104344092 291
422 3300009147 Ga0114129_10006039 Ga0114129_1000603911 291
423 3300009147 Ga0114129_10108933 Ga0114129_101089332 291
424 3300028794 Ga0307515_10157508 Ga0307515_101575082 291
425 3300031456 Ga0307513_10325626 Ga0307513_103256262 291
426 3300037418 Ga0395900_0009997 Ga0395900_0009997_3826_4761 291
427 3300037466 Ga0395898_0016690 Ga0395898_0016690_3748_4683 291
428 3300038443 Ga0395901_0018012 Ga0395901_0018012_5840_6775 291
429 3300050507 nmdc:mga05p37_3512_c1 nmdc:mga05p37_3512_c1_2358_3317 291
430 3300050507 nmdc:mga05p37_4649_c1 nmdc:mga05p37_4649_c1_9730_10665 291
431 3300050508 nmdc:mga09592_18143_c1 nmdc:mga09592_18143_c1_2100_3059 291
432 3300050509 nmdc:mga0qj67_689_c1 nmdc:mga0qj67_689_c1_21455_22414 291
433 3300050510 nmdc:mga06r32_79371_c1 nmdc:mga06r32_79371_c1_1882_2841 291
434 3300050514 nmdc:mga08x19_119008_c1 nmdc:mga08x19_119008_c1_199_1134 291
435 3300005288 Ga0065714_10007979 Ga0065714_100079792 292
436 3300005367 Ga0070667_100013586 Ga0070667_1000135864 292
437 3300013308 Ga0157375_10862116 Ga0157375_108621161 292
438 3300014325 Ga0163163_10387795 Ga0163163_103877952 292
439 3300015683 Ga0183362_10004 Ga0183362_10004275 292
440 3300025923 Ga0207681_10005500 Ga0207681_100055003 292
441 3300025986 Ga0207658_10007588 Ga0207658_100075885 292
442 3300028794 Ga0307515_10000468 Ga0307515_1000046859 292
443 3300030733 Ga0314311_1004344 Ga0314311_10043442 292
444 3300030735 Ga0316178_1040733 Ga0316178_10407332 292
445 3300030742 Ga0316183_1025593 Ga0316183_10255932 292
446 3300031251 Ga0265327_10002325 Ga0265327_1000232512 292
447 3300042134 Ga0450898_028713 Ga0450898_028713_68_985 292
448 3300046475 Ga0495639_0003270 Ga0495639_0003270_447_1364 292
449 3300046660 Ga0495625_0000057 Ga0495625_0000057_143821_144738 292
450 3300047447 Ga0495685_035318 Ga0495685_035318_206_1123 292
451 3300048905 Ga0496102_0012945 Ga0496102_0012945_734_1651 292
452 3300048906 Ga0496103_0037782 Ga0496103_0037782_1656_2573 292
453 3300048911 Ga0496108_0073364 Ga0496108_0073364_1727_2644 292
454 3300048913 Ga0496110_0020858 Ga0496110_0020858_4016_4933 292
455 3300048925 Ga0496122_0000039 Ga0496122_0000039_179967_180884 292
456 3300048926 Ga0496123_0000026 Ga0496123_0000026_180063_180980 292
457 3300048927 Ga0496124_0011786 Ga0496124_0011786_6918_7835 292
458 3300049679 Ga0501249_013664 Ga0501249_013664_648_1565 292
459 3300049705 Ga0501225_0005204 Ga0501225_0005204_753_1670 292
460 iso_pu_bacteria 2513020051 2513229324 292
461 iso_pu_bacteria 2599185178 2599447312 292
462 iso_pu_bacteria 2643221658 2644325022 292
463 iso_pu_bacteria 2643221672 2644400250 292
464 3300001915 JGI24741J21665_1000039 JGI24741J21665_10000399 293
465 3300001979 JGI24740J21852_10006007 JGI24740J21852_100060073 293
466 3300002738 JGI25154J39366_1000276 JGI25154J39366_100027620 293
467 3300003752 Ga0055539_1000185 Ga0055539_10001859 293
468 3300003756 Ga0055533_1000627 Ga0055533_10006273 293
469 3300003758 Ga0055532_1000006 Ga0055532_1000006439 293
470 3300003759 Ga0055525_1000586 Ga0055525_100058614 293
471 3300003761 Ga0055535_1000004 Ga0055535_1000004438 293
472 3300003762 Ga0055542_1001212 Ga0055542_100121215 293
473 3300003763 Ga0055529_1000273 Ga0055529_100027310 293
474 3300003775 Ga0055524_1009094 Ga0055524_10090943 293
475 3300003794 Ga0055531_10003684 Ga0055531_100036844 293
476 3300005344 Ga0070661_100000336 Ga0070661_10000033628 293
477 3300005366 Ga0070659_100001051 Ga0070659_1000010514 293
478 3300005455 Ga0070663_100000344 Ga0070663_10000034415 293
479 3300005564 Ga0070664_100000122 Ga0070664_1000001229 293
480 3300005577 Ga0068857_100004573 Ga0068857_1000045732 293
481 3300005578 Ga0068854_100000121 Ga0068854_1000001216 293
482 3300005614 Ga0068856_100001426 Ga0068856_10000142619 293
483 3300006038 Ga0075365_10060213 Ga0075365_100602132 293
484 3300006942 Ga0099824_1024096 Ga0099824_10240963 293
485 3300006944 Ga0099823_1000002 Ga0099823_100000218 293
486 3300013100 Ga0157373_10026092 Ga0157373_100260922 293
487 3300013104 Ga0157370_10000031 Ga0157370_100000319 293
488 3300015261 Ga0182006_1004474 Ga0182006_10044745 293
489 3300015262 Ga0182007_10017871 Ga0182007_100178713 293
490 3300020610 Ga0154015_1302157 Ga0154015_13021573 293
491 3300025224 Ga0209784_100006 Ga0209784_100006616 293
492 3300025224 Ga0209784_100616 Ga0209784_1006166 293
493 3300025225 Ga0209566_100002 Ga0209566_100002616 293
494 3300025225 Ga0209566_100428 Ga0209566_10042812 293
495 3300025226 Ga0209674_100010 Ga0209674_100010520 293
496 3300025226 Ga0209674_100098 Ga0209674_100098119 293
497 3300025228 Ga0209672_100423 Ga0209672_1004234 293
498 3300025229 Ga0209147_100015 Ga0209147_100015112 293
499 3300025230 Ga0209563_100004 Ga0209563_10000427 293
500 3300025242 Ga0209258_100021 Ga0209258_100021112 293
501 3300025250 Ga0209026_1001639 Ga0209026_10016397 293
502 3300025253 Ga0209677_100007 Ga0209677_100007616 293
503 3300025253 Ga0209677_101888 Ga0209677_1018886 293
504 3300025254 Ga0209148_1000395 Ga0209148_100039537 293
505 3300025256 Ga0209759_1001325 Ga0209759_100132512 293
506 3300025256 Ga0209759_1001619 Ga0209759_10016193 293
507 3300025272 Ga0209455_1000028 Ga0209455_1000028112 293
508 3300025273 Ga0209673_1020279 Ga0209673_10202792 293
509 3300025298 Ga0209050_1002923 Ga0209050_10029239 293
510 3300025299 Ga0209256_1000659 Ga0209256_100065919 293
511 3300025303 Ga0209051_1003283 Ga0209051_10032833 293
512 3300025304 Ga0209257_1012820 Ga0209257_10128202 293
513 3300025913 Ga0207695_10002251 Ga0207695_1000225111 293
514 3300025919 Ga0207657_10108038 Ga0207657_101080382 293
515 3300025920 Ga0207649_10000449 Ga0207649_100004492 293
516 3300025932 Ga0207690_10005650 Ga0207690_100056503 293
517 3300025945 Ga0207679_10000007 Ga0207679_10000007332 293
518 3300025981 Ga0207640_10000107 Ga0207640_100001078 293
519 3300026067 Ga0207678_10000207 Ga0207678_1000020738 293
520 3300026078 Ga0207702_10000260 Ga0207702_1000026010 293
521 3300026116 Ga0207674_10088393 Ga0207674_100883933 293
522 3300027296 Ga0209389_1000340 Ga0209389_100034017 293
523 3300037312 Ga0395899_0090468 Ga0395899_0090468_1250_2206 293
524 3300037418 Ga0395900_0078567 Ga0395900_0078567_676_1593 293
525 3300044656 Ga0466969_0033048 Ga0466969_0033048_802_1755 293
526 3300044671 Ga0466978_0127421 Ga0466978_0127421_360_1313 293
527 3300044683 Ga0466965_0033846 Ga0466965_0033846_810_1763 293
528 3300044693 Ga0466961_0000242 Ga0466961_0000242_2451_3404 293
529 3300044706 Ga0466964_0006208 Ga0466964_0006208_145_1098 293
530 3300044765 Ga0466970_0002465 Ga0466970_0002465_5584_6537 293
531 3300044901 Ga0466960_0034748 Ga0466960_0034748_737_1690 293
532 3300045049 Ga0466959_0016492 Ga0466959_0016492_2500_3453 293
533 3300045976 Ga0466967_0006234 Ga0466967_0006234_5433_6386 293
534 3300061719 Ga0466962_0118867 Ga0466962_0118867_143_1096 293
535 iso_pu_bacteria 2900577576 2900582385 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

30

329

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7702 11 289
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7484 10 285
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7287 11 289
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7272 11 286
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7122 11 286
ID Description Score Start End Superfamily
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7855 14 286 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7723 13 292 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7722 46 291 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7704 14 286 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7689 9 286 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4Q5R4M2-F1-model_v4 ABC transporter permease 0.9312 11 234 GO:0005886
GO:0055085
AF-A0A6P0QT05-F1-model_v4 deleted 0.9156 7 220
AF-A0A3G6WVH1-F1-model_v4 deleted 0.895 30 223
AF-A0A4Q5R4M2-F1-model_v4 ABC transporter permease 0.8916 11 234 GO:0005886
GO:0055085
AF-A0A7V1MI83-F1-model_v4 ABC transporter permease 0.8915 1 223 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
75.54 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map