F460646

General Info

Members Datasets Scaffolds Average Seq Length
535 259 527 455

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10033803|Ga0105240_100338036
Length 491
Sequence VESETCISPALLLAALVITLLSRKEGFVLIEGIRSGKIAAVLISLILCWPFAQAQNFNDIKPSPQQVEWQDLEFGVLIHFGTNTYLDREWGDGTASPQVFNPTQLDPEQWLRAAKAAGAKYVVLVAKHHDGFCLWPTKQTDYSVKSRPWENGKGDVVKRVSDAAHKLGIKFGIYLSPWDRHEPRYKNSADYDDYYAAELDELTSNYGDLVEFWLDGAGSEGHVYNFPRIIETLRKAQPNTLVFADAALFEYGDIRWAGNEDGKIPYENWNVLDRHGYLRWRPVEADTPLHKEHWFWHPNDEDTLKSVEDLLSTYEQTIGRGGQLMLGLAPDKRGLLPEADVRRLEEFGEAIRQRYSGNLITKEHIANSATDAAFDGDPDTFWSAPAGSHHAILEADFRQPVKIDRTLVMEWLNDGQRVEQFRIEVWDGGRWKSVVAGHAIGHKRIDIFPPVSTSRIRLNILSSSAEAHVREFQVFDASGARITRTVSGQNR

Samples

Sample ID Description Type Environment
1 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
2 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
3 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
4 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
5 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
6 2928963466 Dyella japonica 1073 Isolate Unclassified
7 2941471342 Luteibacter sp. 621 Isolate Unclassified
8 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
9 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
81 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
96 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
97 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
170 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
174 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
256 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
257 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0.56
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.15
Nodule 0
Rhizoplane 2.99
Rhizosphere 74.39
Stem 0
Stem Tuber 0
Unclassified 10.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000307 3300000546 Bacteria 8561
2 JGI24739J22299_10001182 3300001989 Bacteria 9766
3 JGI24737J22298_10035923 3300001990 Bacteria 1532
4 JGI24735J21928_10017091 3300002067 Unclassified 2244
5 JGI24735J21928_10020875 3300002067 Bacteria 2004
6 JGI24738J21930_10004670 3300002075 Bacteria 3335
7 JGI25162J39368_1000066 3300002737 Bacteria 130612
8 JGI25162J39368_1000623 3300002737 Bacteria 25375
9 JGI25162J39368_1000876 3300002737 Bacteria 19713
10 JGI25157J39369_1000050 3300002741 Bacteria 114470
11 JGI25157J39369_1000957 3300002741 Bacteria 13522
12 JGI25157J39369_1001576 3300002741 Bacteria 8062
13 JGI25163J39215_1002659 3300002771 Bacteria 1723
14 JGI25164J39214_1000056 3300002772 Bacteria 114468
15 JGI25164J39214_1000061 3300002772 Bacteria 110617
16 JGI25165J46597_1000009 3300003214 Bacteria 467965
17 JGI25165J46597_1000151 3300003214 Bacteria 114835
18 rootH2_10050965 3300003320 Bacteria 5732
19 rootH2_10078932 3300003320 Bacteria 8417
20 Ga0055538_1002563 3300003751 Bacteria 2607
21 Ga0055539_1000614 3300003752 Bacteria 9678
22 Ga0055533_1000913 3300003756 Bacteria 8841
23 Ga0055525_1000856 3300003759 Bacteria 8910
24 Ga0055527_1000271 3300003760 Bacteria 31313
25 Ga0055527_1000273 3300003760 Bacteria 30913
26 Ga0055535_1000045 3300003761 Bacteria 140688
27 Ga0055535_1000466 3300003761 Bacteria 37034
28 Ga0055535_1000567 3300003761 Bacteria 31313
29 Ga0055535_1000574 3300003761 Bacteria 30913
30 Ga0055542_1000010 3300003762 Bacteria 414813
31 Ga0055542_1000079 3300003762 Bacteria 130623
32 Ga0055542_1000591 3300003762 Bacteria 31313
33 Ga0055542_1000597 3300003762 Bacteria 30913
34 Ga0055542_1001011 3300003762 Bacteria 17923
35 Ga0055529_1000122 3300003763 Bacteria 114462
36 Ga0055529_1000140 3300003763 Bacteria 102393
37 Ga0055529_1000556 3300003763 Bacteria 31313
38 Ga0055529_1000815 3300003763 Bacteria 18794
39 Ga0065165_1000186 3300005262 Bacteria 108712
40 Ga0070658_10000007 3300005327 Bacteria 349444
41 Ga0070658_10016591 3300005327 Bacteria 5894
42 Ga0070658_10021565 3300005327 Bacteria 5162
43 Ga0070658_10027051 3300005327 Bacteria 4605
44 Ga0070658_10184919 3300005327 Bacteria 1754
45 Ga0070683_100037549 3300005329 Bacteria 4434
46 Ga0070683_100113830 3300005329 Bacteria 2553
47 Ga0070670_100063050 3300005331 Bacteria 3181
48 Ga0068869_100003330 3300005334 Bacteria 9817
49 Ga0070666_10000008 3300005335 Bacteria 293415
50 Ga0068868_100000995 3300005338 Bacteria 19323
51 Ga0070689_100017194 3300005340 Bacteria 5307
52 Ga0070661_100007534 3300005344 Bacteria 7509
53 Ga0070661_100021595 3300005344 Bacteria 4599
54 Ga0070668_100100073 3300005347 Unclassified 2296
55 Ga0070671_100010112 3300005355 Bacteria 7578
56 Ga0070688_100054144 3300005365 Bacteria 2512
57 Ga0070659_100046459 3300005366 Unclassified 3403
58 Ga0070667_100107765 3300005367 Unclassified 2413
59 Ga0070709_10000389 3300005434 Bacteria 27031
60 Ga0070709_10024544 3300005434 Bacteria 3550
61 Ga0070714_100018479 3300005435 Bacteria 5663
62 Ga0070714_100019180 3300005435 Bacteria 5567
63 Ga0070714_100145569 3300005435 Bacteria 2131
64 Ga0070713_100000240 3300005436 Bacteria 35997
65 Ga0070713_100000860 3300005436 Bacteria 19441
66 Ga0070713_100001393 3300005436 Bacteria 15490
67 Ga0070713_100005337 3300005436 Bacteria 8772
68 Ga0070713_100007637 3300005436 Bacteria 7611
69 Ga0070711_100008179 3300005439 Bacteria 6396
70 Ga0070711_100045408 3300005439 Bacteria 2988
71 Ga0070711_100050361 3300005439 Bacteria 2856
72 Ga0070663_100015653 3300005455 Bacteria 4904
73 Ga0070663_100062808 3300005455 Bacteria 2679
74 Ga0070663_100134224 3300005455 Bacteria 1883
75 Ga0070662_100025419 3300005457 Bacteria 4089
76 Ga0070681_10007232 3300005458 Bacteria 10832
77 Ga0070681_10009811 3300005458 Bacteria 9429
78 Ga0068867_100083052 3300005459 Bacteria 2418
79 Ga0070707_100043551 3300005468 Bacteria 4295
80 Ga0070679_100004474 3300005530 Bacteria 12906
81 Ga0070679_100097174 3300005530 Bacteria 2933
82 Ga0070684_100022318 3300005535 Bacteria 5277
83 Ga0070684_100025054 3300005535 Bacteria 5010
84 Ga0070684_100026400 3300005535 Bacteria 4892
85 Ga0068853_100000020 3300005539 Bacteria 157450
86 Ga0068853_100017887 3300005539 Bacteria 5856
87 Ga0068853_100030721 3300005539 Bacteria 4539
88 Ga0068853_100037155 3300005539 Bacteria 4143
89 Ga0070665_100033023 3300005548 Bacteria 5207
90 Ga0070665_100063345 3300005548 Bacteria 3707
91 Ga0070665_100077635 3300005548 Bacteria 3327
92 Ga0068855_100002105 3300005563 Bacteria 24635
93 Ga0068855_100005395 3300005563 Bacteria 15596
94 Ga0068855_100005499 3300005563 Bacteria 15460
95 Ga0068855_100016759 3300005563 Bacteria 8812
96 Ga0068855_100022030 3300005563 Bacteria 7639
97 Ga0068855_100027044 3300005563 Bacteria 6863
98 Ga0068855_100032809 3300005563 Bacteria 6199
99 Ga0068855_100047771 3300005563 Bacteria 5055
100 Ga0070664_100101771 3300005564 Bacteria 2499
101 Ga0070664_100146668 3300005564 Bacteria 2081
102 Ga0068857_100000189 3300005577 Bacteria 39655
103 Ga0068857_100001376 3300005577 Bacteria 19181
104 Ga0068857_100006723 3300005577 Bacteria 9886
105 Ga0068857_100186220 3300005577 Bacteria 1890
106 Ga0068854_100000112 3300005578 Bacteria 55846
107 Ga0068854_100004478 3300005578 Bacteria 8812
108 Ga0068854_100008457 3300005578 Bacteria 6618
109 Ga0068854_100009911 3300005578 Bacteria 6164
110 Ga0068854_100049730 3300005578 Bacteria 2996
111 Ga0068854_100050015 3300005578 Unclassified 2989
112 Ga0068856_100000179 3300005614 Bacteria 66149
113 Ga0068856_100000323 3300005614 Bacteria 52568
114 Ga0068856_100010763 3300005614 Bacteria 8883
115 Ga0068856_100014695 3300005614 Bacteria 7556
116 Ga0068856_100244498 3300005614 Bacteria 1809
117 Ga0068859_100001235 3300005617 Bacteria 26117
118 Ga0068864_100000129 3300005618 Bacteria 73206
119 Ga0068864_100112909 3300005618 Bacteria 2422
120 Ga0068863_100004744 3300005841 Bacteria 13400
121 Ga0068858_100000272 3300005842 Bacteria 55575
122 Ga0068858_100002550 3300005842 Bacteria 18376
123 Ga0068858_100010102 3300005842 Bacteria 8961
124 Ga0068858_100104791 3300005842 Bacteria 2639
125 Ga0068860_100098222 3300005843 Bacteria 2793
126 Ga0068860_100143097 3300005843 Bacteria 2299
127 Ga0081455_10176541 3300005937 Bacteria 1621
128 Ga0081540_1004420 3300005983 Bacteria 10725
129 Ga0070717_10001325 3300006028 Bacteria 16967
130 Ga0070717_10003643 3300006028 Bacteria 11048
131 Ga0070717_10082016 3300006028 Unclassified 2709
132 Ga0070716_100002097 3300006173 Bacteria 9150
133 Ga0070716_100165402 3300006173 Bacteria 1438
134 Ga0070712_100021376 3300006175 Bacteria 4250
135 Ga0070712_100031295 3300006175 Bacteria 3583
136 Ga0070712_100087564 3300006175 Bacteria 2272
137 Ga0070712_100105388 3300006175 Bacteria 2094
138 Ga0097621_100002345 3300006237 Bacteria 12976
139 Ga0097621_100146124 3300006237 Bacteria 2024
140 Ga0068871_100000476 3300006358 Bacteria 27506
141 Ga0097620_100001235 3300006931 Bacteria 26117
142 Ga0105240_10000884 3300009093 Bacteria 53814
143 Ga0105240_10001842 3300009093 Bacteria 35528
144 Ga0105240_10008820 3300009093 Bacteria 14362
145 Ga0105240_10033803 3300009093 Bacteria 6603
146 Ga0105240_10034423 3300009093 Bacteria 6533
147 Ga0105240_10040519 3300009093 Bacteria 5956
148 Ga0105240_10086873 3300009093 Unclassified 3830
149 Ga0105240_10262823 3300009093 Bacteria 1990
150 Ga0105247_10012902 3300009101 Bacteria 5012
151 Ga0105243_10161142 3300009148 Unclassified 1934
152 Ga0105248_10000003 3300009177 Bacteria 1019601
153 Ga0105248_10001430 3300009177 Bacteria 26616
154 Ga0105248_10036718 3300009177 Bacteria 5480
155 Ga0105248_10187683 3300009177 Bacteria 2329
156 Ga0105237_10000136 3300009545 Bacteria 103269
157 Ga0105237_10037387 3300009545 Bacteria 4907
158 Ga0105237_10044490 3300009545 Bacteria 4470
159 Ga0105237_10209575 3300009545 Bacteria 1949
160 Ga0105238_10003140 3300009551 Bacteria 16486
161 Ga0105238_10032910 3300009551 Bacteria 5277
162 Ga0105238_10039610 3300009551 Bacteria 4778
163 Ga0105238_10058975 3300009551 Bacteria 3846
164 Ga0105238_10210933 3300009551 Unclassified 1918
165 Ga0105239_10000050 3300010375 Bacteria 173908
166 Ga0105239_10003222 3300010375 Bacteria 20174
167 Ga0105239_10011958 3300010375 Bacteria 9679
168 Ga0105239_10182592 3300010375 Bacteria 2347
169 Ga0157319_1000005 3300012497 Bacteria 372810
170 Ga0157314_1000157 3300012500 Bacteria 7422
171 Ga0157373_10056710 3300013100 Bacteria 2781
172 Ga0157370_10007106 3300013104 Bacteria 12221
173 Ga0157370_10024061 3300013104 Bacteria 6038
174 Ga0157370_10099724 3300013104 Bacteria 2722
175 Ga0157369_10008365 3300013105 Bacteria 11866
176 Ga0157369_10009439 3300013105 Bacteria 11153
177 Ga0157369_10046144 3300013105 Bacteria 4736
178 Ga0157369_10068901 3300013105 Bacteria 3801
179 Ga0157369_10084831 3300013105 Bacteria 3385
180 Ga0157369_10106526 3300013105 Bacteria 2983
181 Ga0157369_10108577 3300013105 Bacteria 2951
182 Ga0157369_10177274 3300013105 Unclassified 2243
183 Ga0157369_10367965 3300013105 Bacteria 1492
184 Ga0157374_10000766 3300013296 Bacteria 28060
185 Ga0157374_10004453 3300013296 Bacteria 11766
186 Ga0157378_10000009 3300013297 Bacteria 161557
187 Ga0163162_10000851 3300013306 Bacteria 28389
188 Ga0157372_10000140 3300013307 Bacteria 79310
189 Ga0157372_10001616 3300013307 Bacteria 24485
190 Ga0157372_10001867 3300013307 Bacteria 22864
191 Ga0157372_10002812 3300013307 Bacteria 18801
192 Ga0157372_10005638 3300013307 Bacteria 13307
193 Ga0157372_10082234 3300013307 Bacteria 3645
194 Ga0157372_10131281 3300013307 Bacteria 2882
195 Ga0157372_10182515 3300013307 Unclassified 2429
196 Ga0163163_10002757 3300014325 Bacteria 14828
197 Ga0163163_10291773 3300014325 Bacteria 1683
198 Ga0182008_10002794 3300014497 Bacteria 10806
199 Ga0157376_10003224 3300014969 Bacteria 11219
200 Ga0157376_10068349 3300014969 Bacteria 3009
201 Ga0157376_10153187 3300014969 Bacteria 2081
202 Ga0182006_1001703 3300015261 Bacteria 12839
203 Ga0182007_10012089 3300015262 Bacteria 3333
204 Ga0182005_1003469 3300015265 Bacteria 5333
205 Ga0183368_1004 3300015687 Bacteria 1211761
206 Ga0209435_102268 3300025206 Bacteria 2273
207 Ga0209784_100013 3300025224 Bacteria 518664
208 Ga0209674_100053 3300025226 Bacteria 323159
209 Ga0209674_100063 3300025226 Bacteria 275507
210 Ga0209674_102281 3300025226 Bacteria 4217
211 Ga0209672_100009 3300025228 Bacteria 883623
212 Ga0209672_100024 3300025228 Bacteria 367869
213 Ga0209672_100107 3300025228 Bacteria 99267
214 Ga0209563_100127 3300025230 Bacteria 109913
215 Ga0207427_100021 3300025231 Bacteria 494115
216 Ga0207427_100030 3300025231 Bacteria 358045
217 Ga0209437_100012 3300025233 Bacteria 792625
218 Ga0209437_100150 3300025233 Bacteria 157430
219 Ga0209437_100416 3300025233 Bacteria 38751
220 Ga0209258_100011 3300025242 Bacteria 867542
221 Ga0209258_100019 3300025242 Bacteria 566728
222 Ga0209258_100047 3300025242 Bacteria 367869
223 Ga0209258_100299 3300025242 Bacteria 80970
224 Ga0209258_101028 3300025242 Bacteria 12566
225 Ga0209646_1000458 3300025246 Bacteria 21135
226 Ga0209646_1000553 3300025246 Bacteria 15780
227 Ga0209026_1000010 3300025250 Bacteria 511986
228 Ga0209026_1000015 3300025250 Bacteria 395555
229 Ga0209026_1000163 3300025250 Bacteria 102814
230 Ga0209026_1005397 3300025250 Bacteria 3453
231 Ga0209148_1000001 3300025254 Bacteria 2545271
232 Ga0209148_1000005 3300025254 Bacteria 1806504
233 Ga0209148_1000013 3300025254 Bacteria 956684
234 Ga0209148_1000054 3300025254 Bacteria 367869
235 Ga0209148_1000205 3300025254 Bacteria 104659
236 Ga0209759_1000023 3300025256 Bacteria 321695
237 Ga0209759_1000622 3300025256 Bacteria 33847
238 Ga0209759_1004122 3300025256 Bacteria 5547
239 Ga0209129_1002144 3300025258 Bacteria 10012
240 Ga0209233_1000002 3300025261 Bacteria 2501366
241 Ga0209233_1000023 3300025261 Bacteria 738870
242 Ga0209455_1000012 3300025272 Bacteria 867234
243 Ga0209455_1000027 3300025272 Bacteria 566710
244 Ga0209455_1000052 3300025272 Bacteria 367804
245 Ga0209455_1000081 3300025272 Bacteria 263674
246 Ga0209257_1014211 3300025304 Bacteria 3443
247 Ga0209257_1015973 3300025304 Bacteria 3072
248 Ga0207697_10072531 3300025315 Bacteria 1444
249 Ga0207692_10111578 3300025898 Unclassified 1517
250 Ga0207680_10000005 3300025903 Bacteria 660983
251 Ga0207647_10001010 3300025904 Bacteria 21869
252 Ga0207647_10004877 3300025904 Bacteria 9910
253 Ga0207647_10111319 3300025904 Bacteria 1619
254 Ga0207699_10008055 3300025906 Bacteria 5179
255 Ga0207699_10013471 3300025906 Bacteria 4188
256 Ga0207699_10024760 3300025906 Bacteria 3286
257 Ga0207705_10000013 3300025909 Bacteria 451680
258 Ga0207705_10001463 3300025909 Bacteria 18825
259 Ga0207705_10003955 3300025909 Bacteria 11268
260 Ga0207705_10017963 3300025909 Bacteria 5058
261 Ga0207705_10058789 3300025909 Bacteria 2773
262 Ga0207707_10023053 3300025912 Bacteria 5446
263 Ga0207695_10000198 3300025913 Bacteria 167880
264 Ga0207695_10000694 3300025913 Bacteria 65968
265 Ga0207695_10002325 3300025913 Bacteria 28342
266 Ga0207695_10007696 3300025913 Bacteria 13642
267 Ga0207695_10015849 3300025913 Bacteria 8853
268 Ga0207695_10026127 3300025913 Bacteria 6521
269 Ga0207695_10046395 3300025913 Bacteria 4606
270 Ga0207695_10051777 3300025913 Bacteria 4308
271 Ga0207695_10139220 3300025913 Bacteria 2377
272 Ga0207671_10000059 3300025914 Bacteria 179761
273 Ga0207671_10031622 3300025914 Bacteria 3943
274 Ga0207671_10067946 3300025914 Bacteria 2655
275 Ga0207671_10075754 3300025914 Bacteria 2517
276 Ga0207693_10000084 3300025915 Bacteria 84105
277 Ga0207693_10000160 3300025915 Bacteria 62687
278 Ga0207693_10031338 3300025915 Bacteria 4201
279 Ga0207693_10031475 3300025915 Bacteria 4192
280 Ga0207693_10061240 3300025915 Bacteria 2948
281 Ga0207663_10009342 3300025916 Bacteria 5176
282 Ga0207663_10026305 3300025916 Bacteria 3375
283 Ga0207657_10005725 3300025919 Bacteria 12962
284 Ga0207657_10046151 3300025919 Bacteria 3817
285 Ga0207652_10028631 3300025921 Bacteria 4651
286 Ga0207646_10078840 3300025922 Bacteria 2944
287 Ga0207694_10000241 3300025924 Bacteria 52660
288 Ga0207694_10027366 3300025924 Bacteria 4342
289 Ga0207700_10001174 3300025928 Bacteria 15056
290 Ga0207700_10001774 3300025928 Bacteria 12236
291 Ga0207700_10021384 3300025928 Bacteria 4416
292 Ga0207700_10074273 3300025928 Bacteria 2630
293 Ga0207700_10095633 3300025928 Bacteria 2356
294 Ga0207700_10096828 3300025928 Bacteria 2344
295 Ga0207664_10137933 3300025929 Bacteria 2060
296 Ga0207690_10011373 3300025932 Bacteria 5322
297 Ga0207690_10075751 3300025932 Bacteria 2334
298 Ga0207706_10039908 3300025933 Bacteria 4161
299 Ga0207670_10006704 3300025936 Bacteria 6407
300 Ga0207665_10006958 3300025939 Bacteria 7488
301 Ga0207665_10010350 3300025939 Bacteria 6126
302 Ga0207665_10053230 3300025939 Bacteria 2728
303 Ga0207711_10000012 3300025941 Bacteria 515147
304 Ga0207711_10149384 3300025941 Bacteria 2107
305 Ga0207689_10020634 3300025942 Bacteria 5541
306 Ga0207679_10024016 3300025945 Bacteria 4176
307 Ga0207667_10000031 3300025949 Bacteria 323587
308 Ga0207667_10000292 3300025949 Bacteria 69279
309 Ga0207667_10003408 3300025949 Bacteria 19625
310 Ga0207667_10008428 3300025949 Bacteria 12247
311 Ga0207667_10019177 3300025949 Bacteria 7650
312 Ga0207667_10035946 3300025949 Bacteria 5312
313 Ga0207667_10079052 3300025949 Bacteria 3408
314 Ga0207640_10000001 3300025981 Bacteria 628778
315 Ga0207640_10000061 3300025981 Bacteria 89141
316 Ga0207640_10000995 3300025981 Bacteria 15688
317 Ga0207640_10023791 3300025981 Bacteria 3687
318 Ga0207640_10038520 3300025981 Unclassified 3018
319 Ga0207640_10103020 3300025981 Bacteria 2006
320 Ga0207677_10023622 3300026023 Bacteria 3802
321 Ga0207703_10000365 3300026035 Bacteria 48400
322 Ga0207703_10006688 3300026035 Bacteria 9197
323 Ga0207703_10008600 3300026035 Bacteria 8057
324 Ga0207703_10091740 3300026035 Bacteria 2555
325 Ga0207639_10000023 3300026041 Bacteria 215340
326 Ga0207639_10096811 3300026041 Bacteria 2375
327 Ga0207678_10005660 3300026067 Bacteria 11169
328 Ga0207678_10022118 3300026067 Bacteria 5572
329 Ga0207678_10202380 3300026067 Bacteria 1698
330 Ga0207702_10006103 3300026078 Bacteria 10441
331 Ga0207702_10013707 3300026078 Bacteria 6734
332 Ga0207702_10014687 3300026078 Bacteria 6498
333 Ga0207702_10035149 3300026078 Bacteria 4190
334 Ga0207641_10005114 3300026088 Bacteria 11234
335 Ga0207648_10073278 3300026089 Bacteria 2985
336 Ga0207676_10003562 3300026095 Bacteria 11001
337 Ga0207674_10000298 3300026116 Bacteria 62902
338 Ga0207674_10000763 3300026116 Bacteria 42020
339 Ga0207674_10005708 3300026116 Bacteria 14752
340 Ga0207674_10207554 3300026116 Bacteria 1908
341 Ga0207698_10164529 3300026142 Bacteria 1945
342 Ga0268266_10000004 3300028379 Bacteria 1495817
343 Ga0268266_10001623 3300028379 Bacteria 26151
344 Ga0268266_10002599 3300028379 Bacteria 19128
345 Ga0268266_10055850 3300028379 Bacteria 3395
346 Ga0268264_10058948 3300028381 Bacteria 3216
347 Ga0268264_10149612 3300028381 Bacteria 2092
348 Ga0265338_10002332 3300028800 Bacteria 28677
349 Ga0265762_1000396 3300030760 Bacteria 7484
350 Ga0265760_10013641 3300031090 Unclassified 2327
351 Ga0265760_10025781 3300031090 Bacteria 1718
352 Ga0265325_10016019 3300031241 Bacteria 4196
353 Ga0265325_10042880 3300031241 Bacteria 2363
354 Ga0265331_10027239 3300031250 Bacteria 2867
355 Ga0265316_10004157 3300031344 Bacteria 14464
356 Ga0265316_10015042 3300031344 Bacteria 6782
357 Ga0265314_10001468 3300031711 Bacteria 26265
358 Ga0265314_10056419 3300031711 Bacteria 2704
359 Ga0307405_10155385 3300031731 Bacteria 1614
360 Ga0307510_10003576 3300033180 Bacteria 18154
361 Ga0307510_10016607 3300033180 Bacteria 8688
362 Ga0307510_10044183 3300033180 Bacteria 4830
363 Ga0373954_0000981 3300035118 Bacteria 11232
364 Ga0373955_0102416 3300035172 Bacteria 1645
365 Ga0373937_0003120 3300036401 Bacteria 13861
366 Ga0395899_0000195 3300037312 Bacteria 89015
367 Ga0395899_0004130 3300037312 Bacteria 11425
368 Ga0395900_0000018 3300037418 Bacteria 363472
369 Ga0395898_0000530 3300037466 Bacteria 72663
370 Ga0395898_0000533 3300037466 Bacteria 72575
371 Ga0395901_0140952 3300038443 Bacteria 2534
372 Ga0436365_0595167 3300039437 Bacteria 7133
373 Ga0436361_0534850 3300039447 Bacteria 74664
374 Ga0436361_0944579 3300039447 Bacteria 9762
375 Ga0439436_0000006 3300041404 Bacteria 123245
376 Ga0439465_0000030 3300041413 Bacteria 28642
377 Ga0450908_000095 3300042184 Bacteria 17458
378 Ga0466969_0003759 3300044656 Bacteria 8068
379 Ga0466969_0019326 3300044656 Bacteria 3543
380 Ga0466972_0025125 3300044658 Bacteria 2954
381 Ga0466972_0040378 3300044658 Bacteria 2274
382 Ga0466975_0093908 3300044661 Bacteria 2136
383 Ga0466982_0000010 3300044672 Bacteria 188341
384 Ga0466982_0000033 3300044672 Bacteria 46451
385 Ga0466965_0034225 3300044683 Bacteria 2485
386 Ga0466966_0047532 3300044684 Bacteria 2735
387 Ga0466966_0103263 3300044684 Unclassified 1762
388 Ga0466961_0000604 3300044693 Bacteria 22628
389 Ga0466961_0002035 3300044693 Bacteria 12585
390 Ga0466961_0005214 3300044693 Bacteria 8179
391 Ga0466961_0010585 3300044693 Bacteria 5885
392 Ga0466961_0028013 3300044693 Bacteria 3623
393 Ga0466961_0035309 3300044693 Bacteria 3211
394 Ga0466971_0003869 3300044719 Bacteria 6419
395 Ga0466971_0082505 3300044719 Bacteria 1467
396 Ga0466970_0003423 3300044765 Bacteria 7721
397 Ga0466970_0004581 3300044765 Bacteria 6823
398 Ga0466957_0004881 3300044842 Bacteria 7506
399 Ga0466959_0000043 3300045049 Bacteria 92533
400 Ga0466959_0009477 3300045049 Bacteria 6928
401 Ga0466959_0017254 3300045049 Bacteria 5289
402 Ga0466958_0009428 3300045836 Bacteria 5439
403 Ga0466958_0017336 3300045836 Bacteria 4161
404 Ga0466958_0059425 3300045836 Bacteria 2326
405 Ga0495603_0053549 3300046455 Bacteria 2394
406 Ga0495629_0025153 3300046459 Bacteria 4235
407 Ga0495629_0035896 3300046459 Bacteria 3501
408 Ga0495638_0000009 3300046460 Bacteria 525345
409 Ga0495638_0000052 3300046460 Bacteria 203695
410 Ga0495650_0000009 3300046471 Bacteria 653845
411 Ga0495650_0000027 3300046471 Bacteria 475071
412 Ga0495650_0000122 3300046471 Bacteria 182888
413 Ga0495650_0005128 3300046471 Bacteria 8650
414 Ga0495580_0000249 3300046472 Bacteria 42609
415 Ga0495580_0004692 3300046472 Bacteria 11463
416 Ga0495639_0008744 3300046475 Bacteria 4343
417 Ga0495662_0007636 3300046476 Bacteria 5336
418 Ga0495664_0005541 3300046477 Bacteria 6936
419 Ga0495585_0000021 3300046492 Bacteria 155715
420 Ga0495594_0001013 3300046499 Bacteria 14654
421 Ga0495594_0001638 3300046499 Bacteria 11655
422 Ga0495606_0000056 3300046507 Bacteria 198575
423 Ga0495606_0037325 3300046507 Bacteria 3301
424 Ga0495608_0102407 3300046511 Bacteria 1846
425 Ga0495610_0001176 3300046512 Bacteria 23703
426 Ga0495631_0000060 3300046518 Bacteria 68239
427 Ga0495632_0000003 3300046519 Bacteria 396071
428 Ga0495643_0046181 3300046522 Bacteria 2362
429 Ga0495644_0001022 3300046523 Bacteria 11661
430 Ga0495648_0000688 3300046524 Bacteria 36092
431 Ga0495652_0044883 3300046529 Bacteria 3804
432 Ga0495586_0012344 3300046535 Bacteria 4532
433 Ga0495587_0104899 3300046536 Bacteria 1626
434 Ga0495645_0012556 3300046543 Bacteria 5971
435 Ga0495622_0006997 3300046557 Bacteria 5236
436 Ga0495668_0051146 3300046616 Bacteria 2288
437 Ga0495634_0008699 3300046642 Bacteria 7530
438 Ga0495625_0000174 3300046660 Bacteria 100401
439 Ga0495625_0013321 3300046660 Bacteria 6612
440 Ga0495625_0018234 3300046660 Bacteria 5484
441 Ga0495625_0051306 3300046660 Bacteria 2958
442 Ga0495625_0130807 3300046660 Bacteria 1700
443 Ga0495661_0000353 3300046665 Bacteria 50121
444 Ga0495623_0033022 3300046679 Bacteria 3323
445 Ga0495646_0006928 3300046680 Bacteria 7195
446 Ga0495669_0001680 3300046684 Bacteria 9061
447 Ga0495613_0055258 3300046689 Bacteria 2917
448 Ga0495670_0005163 3300046691 Bacteria 6424
449 Ga0495649_0035326 3300046694 Bacteria 2749
450 Ga0495649_0102315 3300046694 Bacteria 1522
451 Ga0495674_0005764 3300047319 Bacteria 11876
452 Ga0495674_0007158 3300047319 Bacteria 10670
453 Ga0495674_0025992 3300047319 Bacteria 5358
454 Ga0495672_0009768 3300047320 Bacteria 6912
455 Ga0495684_0021024 3300047471 Bacteria 5027
456 Ga0495686_0004810 3300047472 Bacteria 10906
457 Ga0495686_0007061 3300047472 Bacteria 8471
458 Ga0495602_0006491 3300048088 Bacteria 12273
459 Ga0496100_0048526 3300048903 Bacteria 2741
460 Ga0496101_0042667 3300048904 Bacteria 3238
461 Ga0496101_0141191 3300048904 Bacteria 1836
462 Ga0496104_0091689 3300048907 Bacteria 2905
463 Ga0496104_0151671 3300048907 Unclassified 2224
464 Ga0496104_0164181 3300048907 Bacteria 2129
465 Ga0496105_0003575 3300048908 Bacteria 11535
466 Ga0496106_0271098 3300048909 Unclassified 1359
467 Ga0496112_0037133 3300048915 Bacteria 4756
468 Ga0496112_0211488 3300048915 Bacteria 1896
469 Ga0496113_0002616 3300048916 Bacteria 10533
470 Ga0496115_0000013 3300048918 Bacteria 213060
471 Ga0496115_0000044 3300048918 Bacteria 115745
472 Ga0496115_0012431 3300048918 Bacteria 6407
473 Ga0496115_0051691 3300048918 Bacteria 3294
474 Ga0496115_0104355 3300048918 Bacteria 2326
475 Ga0496117_0006370 3300048920 Bacteria 11993
476 Ga0496117_0017189 3300048920 Bacteria 6053
477 Ga0496117_0020746 3300048920 Bacteria 5347
478 Ga0496118_0000636 3300048921 Bacteria 57474
479 Ga0496118_0000780 3300048921 Bacteria 51033
480 Ga0496118_0004166 3300048921 Bacteria 17446
481 Ga0496119_0000109 3300048922 Bacteria 116054
482 Ga0496119_0037017 3300048922 Bacteria 3176
483 Ga0496120_0000150 3300048923 Bacteria 116072
484 Ga0496121_0000013 3300048924 Bacteria 614976
485 Ga0496121_0001215 3300048924 Bacteria 44880
486 Ga0496121_0005667 3300048924 Bacteria 15885
487 Ga0496121_0018867 3300048924 Bacteria 6923
488 Ga0496121_0039847 3300048924 Bacteria 4132
489 Ga0496121_0047961 3300048924 Bacteria 3639
490 Ga0496122_0038959 3300048925 Bacteria 3797
491 Ga0496122_0105799 3300048925 Bacteria 1864
492 Ga0496123_0056615 3300048926 Bacteria 2560
493 Ga0496123_0076145 3300048926 Bacteria 2067
494 Ga0496124_0003509 3300048927 Bacteria 19100
495 Ga0496124_0004598 3300048927 Bacteria 15998
496 Ga0496125_0000453 3300048928 Bacteria 74032
497 Ga0496125_0000599 3300048928 Bacteria 61376
498 Ga0496126_0001475 3300048929 Bacteria 36589
499 Ga0496126_0002275 3300048929 Bacteria 26475
500 Ga0496126_0006890 3300048929 Bacteria 12589
501 Ga0496126_0009222 3300048929 Bacteria 10524
502 Ga0496126_0010917 3300048929 Bacteria 9463
503 Ga0495682_0000253 3300049460 Bacteria 42266
504 Ga0495682_0031178 3300049460 Bacteria 1971
505 Ga0501032_0033565 3300049569 Bacteria 3515
506 Ga0501032_0049466 3300049569 Bacteria 2836
507 Ga0501033_0003097 3300049570 Bacteria 13810
508 Ga0501036_0005483 3300049572 Bacteria 10288
509 Ga0501037_0002833 3300049573 Bacteria 12571
510 Ga0501038_0002468 3300049574 Bacteria 17200
511 Ga0501039_0110293 3300049575 Bacteria 2151
512 Ga0501043_0003939 3300049579 Bacteria 12177
513 Ga0501046_0001610 3300049580 Bacteria 21590
514 Ga0501047_0009097 3300049581 Bacteria 9380
515 Ga0501073_0015192 3300049589 Bacteria 5586
516 Ga0501074_0064294 3300049590 Bacteria 2642
517 Ga0501035_0003319 3300049822 Bacteria 15418
518 Ga0501044_0002842 3300049823 Bacteria 19709
519 nmdc:mga08x19_78068_c1 3300050514 Bacteria 2169
520 Ga0495601_0045246 3300053077 Unclassified 2767
521 Ga0495601_0049721 3300053077 Bacteria 2644
522 Ga0500644_0023228 3300053088 Bacteria 1881
523 Ga0500651_0000022 3300053093 Bacteria 136412
524 Ga0500595_000007 3300053119 Bacteria 289461
525 Ga0500595_004569 3300053119 Bacteria 6178
526 Ga0500645_000125 3300053730 Bacteria 60408
527 Ga0466962_0003669 3300061719 Bacteria 7318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0595167 Ga0436365_0595167_5912_7105 394
2 3300005434 Ga0070709_10000389 Ga0070709_1000038915 407
3 3300005436 Ga0070713_100000860 Ga0070713_1000008602 407
4 3300048907 Ga0496104_0151671 Ga0496104_0151671_22_1266 409
5 3300048909 Ga0496106_0271098 Ga0496106_0271098_52_1296 409
6 3300048925 Ga0496122_0105799 Ga0496122_0105799_598_1851 412
7 3300044658 Ga0466972_0025125 Ga0466972_0025125_1680_2933 413
8 3300046459 Ga0495629_0025153 Ga0495629_0025153_2757_4007 414
9 3300046472 Ga0495580_0000249 Ga0495580_0000249_4634_5884 414
10 3300047319 Ga0495674_0005764 Ga0495674_0005764_3408_4658 414
11 3300053077 Ga0495601_0045246 Ga0495601_0045246_1299_2549 414
12 3300009093 Ga0105240_10086873 Ga0105240_100868732 420
13 3300049589 Ga0501073_0015192 Ga0501073_0015192_3732_5117 420
14 3300046499 Ga0495594_0001638 Ga0495594_0001638_422_1780 423
15 3300014325 Ga0163163_10291773 Ga0163163_102917731 424
16 3300025913 Ga0207695_10046395 Ga0207695_100463953 424
17 3300005344 Ga0070661_100007534 Ga0070661_1000075342 425
18 3300005366 Ga0070659_100046459 Ga0070659_1000464592 425
19 3300005458 Ga0070681_10009811 Ga0070681_100098115 425
20 3300005530 Ga0070679_100004474 Ga0070679_1000044744 425
21 3300009093 Ga0105240_10040519 Ga0105240_100405193 425
22 3300009545 Ga0105237_10044490 Ga0105237_100444902 425
23 3300005327 Ga0070658_10016591 Ga0070658_100165913 428
24 3300005327 Ga0070658_10021565 Ga0070658_100215652 428
25 3300009551 Ga0105238_10003140 Ga0105238_1000314015 428
26 3300025909 Ga0207705_10001463 Ga0207705_1000146314 428
27 3300025909 Ga0207705_10017963 Ga0207705_100179632 428
28 3300025924 Ga0207694_10000241 Ga0207694_1000024138 428
29 3300005455 Ga0070663_100062808 Ga0070663_1000628082 429
30 3300005563 Ga0068855_100005395 Ga0068855_10000539511 429
31 3300025913 Ga0207695_10139220 Ga0207695_101392202 429
32 3300025949 Ga0207667_10003408 Ga0207667_1000340814 429
33 3300026067 Ga0207678_10202380 Ga0207678_102023801 429
34 3300031241 Ga0265325_10016019 Ga0265325_100160194 429
35 3300031250 Ga0265331_10027239 Ga0265331_100272392 429
36 3300033180 Ga0307510_10003576 Ga0307510_100035767 429
37 3300033180 Ga0307510_10016607 Ga0307510_100166073 429
38 3300044693 Ga0466961_0035309 Ga0466961_0035309_1801_3177 429
39 3300045836 Ga0466958_0017336 Ga0466958_0017336_107_1468 429
40 3300005327 Ga0070658_10027051 Ga0070658_100270513 430
41 3300005535 Ga0070684_100026400 Ga0070684_1000264003 430
42 3300005539 Ga0068853_100017887 Ga0068853_1000178872 430
43 3300005548 Ga0070665_100063345 Ga0070665_1000633453 430
44 3300005563 Ga0068855_100005499 Ga0068855_1000054996 430
45 3300005563 Ga0068855_100047771 Ga0068855_1000477714 430
46 3300005577 Ga0068857_100006723 Ga0068857_1000067232 430
47 3300005578 Ga0068854_100050015 Ga0068854_1000500152 430
48 3300009551 Ga0105238_10032910 Ga0105238_100329103 430
49 3300013104 Ga0157370_10007106 Ga0157370_100071065 430
50 3300013104 Ga0157370_10099724 Ga0157370_100997242 430
51 3300013105 Ga0157369_10046144 Ga0157369_100461442 430
52 3300013307 Ga0157372_10082234 Ga0157372_100822342 430
53 3300025909 Ga0207705_10003955 Ga0207705_100039558 430
54 3300025913 Ga0207695_10015849 Ga0207695_100158493 430
55 3300025914 Ga0207671_10075754 Ga0207671_100757542 430
56 3300025919 Ga0207657_10005725 Ga0207657_100057255 430
57 3300025921 Ga0207652_10028631 Ga0207652_100286312 430
58 3300025932 Ga0207690_10075751 Ga0207690_100757512 430
59 3300025949 Ga0207667_10008428 Ga0207667_100084283 430
60 3300025949 Ga0207667_10035946 Ga0207667_100359462 430
61 3300025981 Ga0207640_10038520 Ga0207640_100385202 430
62 3300026067 Ga0207678_10005660 Ga0207678_100056606 430
63 3300026116 Ga0207674_10005708 Ga0207674_100057084 430
64 3300028379 Ga0268266_10001623 Ga0268266_1000162311 430
65 3300046536 Ga0495587_0104899 Ga0495587_0104899_135_1454 430
66 3300046543 Ga0495645_0012556 Ga0495645_0012556_2916_4235 430
67 3300046660 Ga0495625_0000174 Ga0495625_0000174_82908_84323 430
68 3300005327 Ga0070658_10000007 Ga0070658_10000007194 431
69 3300025909 Ga0207705_10000013 Ga0207705_10000013130 431
70 3300005367 Ga0070667_100107765 Ga0070667_1001077652 432
71 3300046459 Ga0495629_0035896 Ga0495629_0035896_851_2254 432
72 3300046689 Ga0495613_0055258 Ga0495613_0055258_486_1889 432
73 3300025928 Ga0207700_10074273 Ga0207700_100742732 433
74 3300025939 Ga0207665_10053230 Ga0207665_100532303 433
75 3300031344 Ga0265316_10004157 Ga0265316_100041577 433
76 3300046499 Ga0495594_0001013 Ga0495594_0001013_7415_8776 433
77 3300046523 Ga0495644_0001022 Ga0495644_0001022_7820_9181 433
78 3300046616 Ga0495668_0051146 Ga0495668_0051146_752_2113 433
79 3300046684 Ga0495669_0001680 Ga0495669_0001680_6457_7818 433
80 3300009545 Ga0105237_10209575 Ga0105237_102095752 434
81 3300014497 Ga0182008_10002794 Ga0182008_100027944 434
82 3300014969 Ga0157376_10068349 Ga0157376_100683493 434
83 3300046694 Ga0495649_0102315 Ga0495649_0102315_71_1408 434
84 3300005355 Ga0070671_100010112 Ga0070671_1000101129 435
85 3300005618 Ga0068864_100112909 Ga0068864_1001129092 435
86 3300025206 Ga0209435_102268 Ga0209435_1022682 435
87 3300046455 Ga0495603_0053549 Ga0495603_0053549_699_2129 435
88 3300046475 Ga0495639_0008744 Ga0495639_0008744_2730_4160 435
89 3300046476 Ga0495662_0007636 Ga0495662_0007636_3760_5190 435
90 3300046477 Ga0495664_0005541 Ga0495664_0005541_3154_4584 435
91 3300046507 Ga0495606_0037325 Ga0495606_0037325_1607_3010 435
92 3300046511 Ga0495608_0102407 Ga0495608_0102407_225_1655 435
93 3300046529 Ga0495652_0044883 Ga0495652_0044883_179_1552 435
94 3300046535 Ga0495586_0012344 Ga0495586_0012344_1806_3236 435
95 3300046642 Ga0495634_0008699 Ga0495634_0008699_5617_7047 435
96 3300046679 Ga0495623_0033022 Ga0495623_0033022_33_1463 435
97 3300046680 Ga0495646_0006928 Ga0495646_0006928_178_1608 435
98 3300047319 Ga0495674_0007158 Ga0495674_0007158_1871_3301 435
99 3300009177 Ga0105248_10187683 Ga0105248_101876833 436
100 3300047319 Ga0495674_0025992 Ga0495674_0025992_1388_2764 436
101 3300047320 Ga0495672_0009768 Ga0495672_0009768_3804_5192 436
102 3300048907 Ga0496104_0091689 Ga0496104_0091689_1140_2516 436
103 3300048918 Ga0496115_0012431 Ga0496115_0012431_2747_4114 436
104 3300009093 Ga0105240_10034423 Ga0105240_100344232 437
105 3300009177 Ga0105248_10001430 Ga0105248_100014306 437
106 3300013105 Ga0157369_10008365 Ga0157369_100083658 437
107 3300013105 Ga0157369_10009439 Ga0157369_100094397 437
108 3300013296 Ga0157374_10000766 Ga0157374_1000076618 437
109 3300013307 Ga0157372_10001616 Ga0157372_100016167 437
110 3300013307 Ga0157372_10001867 Ga0157372_100018673 437
111 3300013307 Ga0157372_10005638 Ga0157372_100056387 437
112 3300025929 Ga0207664_10137933 Ga0207664_101379332 437
113 3300033180 Ga0307510_10044183 Ga0307510_100441833 437
114 3300046471 Ga0495650_0000009 Ga0495650_0000009_366034_367392 437
115 3300046472 Ga0495580_0004692 Ga0495580_0004692_9912_11246 437
116 3300046660 Ga0495625_0051306 Ga0495625_0051306_1043_2488 437
117 3300048915 Ga0496112_0037133 Ga0496112_0037133_421_1743 437
118 3300048929 Ga0496126_0009222 Ga0496126_0009222_6900_8249 437
119 3300053093 Ga0500651_0000022 Ga0500651_0000022_115448_116788 437
120 3300053119 Ga0500595_000007 Ga0500595_000007_242868_244214 437
121 3300053119 Ga0500595_004569 Ga0500595_004569_2151_3506 437
122 3300005436 Ga0070713_100005337 Ga0070713_1000053374 438
123 3300006173 Ga0070716_100002097 Ga0070716_1000020972 438
124 3300006175 Ga0070712_100031295 Ga0070712_1000312952 438
125 3300009148 Ga0105243_10161142 Ga0105243_101611421 438
126 3300025906 Ga0207699_10013471 Ga0207699_100134712 438
127 3300025915 Ga0207693_10000160 Ga0207693_100001602 438
128 3300025928 Ga0207700_10001174 Ga0207700_100011744 438
129 3300025928 Ga0207700_10095633 Ga0207700_100956332 438
130 3300025939 Ga0207665_10006958 Ga0207665_100069582 438
131 3300031090 Ga0265760_10025781 Ga0265760_100257812 438
132 3300031241 Ga0265325_10042880 Ga0265325_100428801 438
133 3300031711 Ga0265314_10056419 Ga0265314_100564192 438
134 3300035172 Ga0373955_0102416 Ga0373955_0102416_55_1434 438
135 3300046471 Ga0495650_0000027 Ga0495650_0000027_52376_53713 438
136 3300046694 Ga0495649_0035326 Ga0495649_0035326_588_1916 438
137 3300001989 JGI24739J22299_10001182 JGI24739J22299_100011821 439
138 3300001990 JGI24737J22298_10035923 JGI24737J22298_100359231 439
139 3300002067 JGI24735J21928_10020875 JGI24735J21928_100208751 439
140 3300002075 JGI24738J21930_10004670 JGI24738J21930_100046702 439
141 3300003320 rootH2_10050965 rootH2_100509653 439
142 3300005262 Ga0065165_1000186 Ga0065165_100018641 439
143 3300005434 Ga0070709_10024544 Ga0070709_100245443 439
144 3300005436 Ga0070713_100007637 Ga0070713_1000076374 439
145 3300005439 Ga0070711_100008179 Ga0070711_1000081792 439
146 3300005455 Ga0070663_100015653 Ga0070663_1000156532 439
147 3300005563 Ga0068855_100032809 Ga0068855_1000328094 439
148 3300005564 Ga0070664_100146668 Ga0070664_1001466682 439
149 3300005577 Ga0068857_100000189 Ga0068857_10000018925 439
150 3300005578 Ga0068854_100009911 Ga0068854_1000099112 439
151 3300005842 Ga0068858_100010102 Ga0068858_1000101025 439
152 3300006028 Ga0070717_10003643 Ga0070717_100036435 439
153 3300009093 Ga0105240_10262823 Ga0105240_102628231 439
154 3300009545 Ga0105237_10000136 Ga0105237_1000013638 439
155 3300010375 Ga0105239_10003222 Ga0105239_100032222 439
156 3300012500 Ga0157314_1000157 Ga0157314_10001572 439
157 3300013105 Ga0157369_10068901 Ga0157369_100689012 439
158 3300015261 Ga0182006_1001703 Ga0182006_10017037 439
159 3300015265 Ga0182005_1003469 Ga0182005_10034693 439
160 3300025258 Ga0209129_1002144 Ga0209129_10021441 439
161 3300025304 Ga0209257_1015973 Ga0209257_10159732 439
162 3300025904 Ga0207647_10111319 Ga0207647_101113191 439
163 3300025906 Ga0207699_10024760 Ga0207699_100247602 439
164 3300025913 Ga0207695_10000694 Ga0207695_1000069456 439
165 3300025914 Ga0207671_10000059 Ga0207671_1000005938 439
166 3300025916 Ga0207663_10026305 Ga0207663_100263052 439
167 3300025928 Ga0207700_10021384 Ga0207700_100213843 439
168 3300025949 Ga0207667_10000292 Ga0207667_100002924 439
169 3300025981 Ga0207640_10000995 Ga0207640_1000099510 439
170 3300026035 Ga0207703_10008600 Ga0207703_100086002 439
171 3300026067 Ga0207678_10022118 Ga0207678_100221182 439
172 3300026116 Ga0207674_10000298 Ga0207674_1000029838 439
173 3300026142 Ga0207698_10164529 Ga0207698_101645292 439
174 3300031731 Ga0307405_10155385 Ga0307405_101553851 439
175 3300041404 Ga0439436_0000006 Ga0439436_0000006_83499_84959 439
176 3300041413 Ga0439465_0000030 Ga0439465_0000030_1368_2828 439
177 3300042184 Ga0450908_000095 Ga0450908_000095_171_1544 439
178 3300044672 Ga0466982_0000033 Ga0466982_0000033_23191_24561 439
179 3300046492 Ga0495585_0000021 Ga0495585_0000021_137336_138700 439
180 3300046512 Ga0495610_0001176 Ga0495610_0001176_842_2302 439
181 3300046518 Ga0495631_0000060 Ga0495631_0000060_50905_52269 439
182 3300046524 Ga0495648_0000688 Ga0495648_0000688_17690_19054 439
183 3300046665 Ga0495661_0000353 Ga0495661_0000353_31709_33073 439
184 3300046691 Ga0495670_0005163 Ga0495670_0005163_4691_6064 439
185 3300048920 Ga0496117_0006370 Ga0496117_0006370_8502_9938 439
186 3300048921 Ga0496118_0000780 Ga0496118_0000780_23399_24835 439
187 3300048922 Ga0496119_0037017 Ga0496119_0037017_78_1538 439
188 3300048924 Ga0496121_0001215 Ga0496121_0001215_29932_31368 439
189 3300048924 Ga0496121_0005667 Ga0496121_0005667_7482_8834 439
190 3300048926 Ga0496123_0076145 Ga0496123_0076145_436_1809 439
191 3300048928 Ga0496125_0000453 Ga0496125_0000453_59587_60939 439
192 3300049460 Ga0495682_0000253 Ga0495682_0000253_30142_31506 439
193 3300053730 Ga0500645_000125 Ga0500645_000125_42085_43449 439
194 iso_pu_bacteria 2818991440 2819562553 439
195 iso_pu_bacteria 2842918807 2842921615 439
196 iso_pu_bacteria 2904463128 2904463155 439
197 iso_pu_bacteria 2941471342 2941472429 439
198 iso_pu_bacteria 2953994433 2953997630 439
199 3300005435 Ga0070714_100018479 Ga0070714_1000184795 440
200 3300005436 Ga0070713_100000240 Ga0070713_10000024043 440
201 3300005548 Ga0070665_100077635 Ga0070665_1000776353 440
202 3300005563 Ga0068855_100016759 Ga0068855_1000167591 440
203 3300005563 Ga0068855_100027044 Ga0068855_1000270442 440
204 3300005578 Ga0068854_100004478 Ga0068854_1000044781 440
205 3300006173 Ga0070716_100165402 Ga0070716_1001654021 440
206 3300006175 Ga0070712_100087564 Ga0070712_1000875642 440
207 3300009177 Ga0105248_10000003 Ga0105248_1000000377 440
208 3300009551 Ga0105238_10210933 Ga0105238_102109332 440
209 3300012497 Ga0157319_1000005 Ga0157319_1000005164 440
210 3300013104 Ga0157370_10024061 Ga0157370_100240615 440
211 3300013105 Ga0157369_10367965 Ga0157369_103679652 440
212 3300013307 Ga0157372_10131281 Ga0157372_101312811 440
213 3300025304 Ga0209257_1014211 Ga0209257_10142112 440
214 3300025906 Ga0207699_10008055 Ga0207699_100080552 440
215 3300025913 Ga0207695_10051777 Ga0207695_100517773 440
216 3300025915 Ga0207693_10000084 Ga0207693_1000008413 440
217 3300025928 Ga0207700_10096828 Ga0207700_100968281 440
218 3300025941 Ga0207711_10000012 Ga0207711_10000012344 440
219 3300025949 Ga0207667_10000031 Ga0207667_1000003125 440
220 3300025949 Ga0207667_10079052 Ga0207667_100790522 440
221 3300025981 Ga0207640_10000061 Ga0207640_1000006113 440
222 3300028379 Ga0268266_10002599 Ga0268266_100025993 440
223 3300037312 Ga0395899_0000195 Ga0395899_0000195_84736_86088 440
224 3300037418 Ga0395900_0000018 Ga0395900_0000018_290488_291840 440
225 3300037466 Ga0395898_0000533 Ga0395898_0000533_2817_4169 440
226 3300038443 Ga0395901_0140952 Ga0395901_0140952_330_1679 440
227 3300044656 Ga0466969_0003759 Ga0466969_0003759_5447_6799 440
228 3300044656 Ga0466969_0019326 Ga0466969_0019326_266_1627 440
229 3300044658 Ga0466972_0040378 Ga0466972_0040378_118_1473 440
230 3300044661 Ga0466975_0093908 Ga0466975_0093908_769_2121 440
231 3300044672 Ga0466982_0000010 Ga0466982_0000010_128_1483 440
232 3300044684 Ga0466966_0047532 Ga0466966_0047532_960_2321 440
233 3300044684 Ga0466966_0103263 Ga0466966_0103263_41_1390 440
234 3300044693 Ga0466961_0000604 Ga0466961_0000604_16458_17810 440
235 3300044693 Ga0466961_0010585 Ga0466961_0010585_2133_3494 440
236 3300044693 Ga0466961_0028013 Ga0466961_0028013_1739_3091 440
237 3300044719 Ga0466971_0082505 Ga0466971_0082505_82_1443 440
238 3300044765 Ga0466970_0003423 Ga0466970_0003423_4459_5814 440
239 3300044765 Ga0466970_0004581 Ga0466970_0004581_185_1537 440
240 3300044842 Ga0466957_0004881 Ga0466957_0004881_3943_5295 440
241 3300045049 Ga0466959_0000043 Ga0466959_0000043_16304_17656 440
242 3300045049 Ga0466959_0017254 Ga0466959_0017254_1313_2674 440
243 3300045836 Ga0466958_0059425 Ga0466958_0059425_164_1513 440
244 3300046471 Ga0495650_0005128 Ga0495650_0005128_2760_4175 440
245 3300046519 Ga0495632_0000003 Ga0495632_0000003_147738_149117 440
246 3300049569 Ga0501032_0049466 Ga0501032_0049466_1170_2546 440
247 3300050514 nmdc:mga08x19_78068_c1 nmdc:mga08x19_78068_c1_520_1872 440
248 3300053088 Ga0500644_0023228 Ga0500644_0023228_113_1462 440
249 3300002067 JGI24735J21928_10017091 JGI24735J21928_100170912 441
250 3300002741 JGI25157J39369_1001576 JGI25157J39369_10015763 441
251 3300005327 Ga0070658_10184919 Ga0070658_101849191 441
252 3300005329 Ga0070683_100037549 Ga0070683_1000375492 441
253 3300005331 Ga0070670_100063050 Ga0070670_1000630502 441
254 3300005334 Ga0068869_100003330 Ga0068869_1000033303 441
255 3300005335 Ga0070666_10000008 Ga0070666_1000000840 441
256 3300005338 Ga0068868_100000995 Ga0068868_1000009955 441
257 3300005347 Ga0070668_100100073 Ga0070668_1001000732 441
258 3300005435 Ga0070714_100019180 Ga0070714_1000191804 441
259 3300005435 Ga0070714_100145569 Ga0070714_1001455691 441
260 3300005436 Ga0070713_100001393 Ga0070713_1000013937 441
261 3300005458 Ga0070681_10007232 Ga0070681_100072325 441
262 3300005459 Ga0068867_100083052 Ga0068867_1000830522 441
263 3300005468 Ga0070707_100043551 Ga0070707_1000435512 441
264 3300005530 Ga0070679_100097174 Ga0070679_1000971742 441
265 3300005535 Ga0070684_100022318 Ga0070684_1000223183 441
266 3300005539 Ga0068853_100000020 Ga0068853_10000002079 441
267 3300005548 Ga0070665_100033023 Ga0070665_1000330233 441
268 3300005563 Ga0068855_100022030 Ga0068855_1000220304 441
269 3300005564 Ga0070664_100101771 Ga0070664_1001017712 441
270 3300005577 Ga0068857_100001376 Ga0068857_1000013768 441
271 3300005578 Ga0068854_100000112 Ga0068854_10000011243 441
272 3300005578 Ga0068854_100008457 Ga0068854_1000084573 441
273 3300005614 Ga0068856_100000179 Ga0068856_10000017913 441
274 3300005617 Ga0068859_100001235 Ga0068859_1000012353 441
275 3300005618 Ga0068864_100000129 Ga0068864_10000012957 441
276 3300005842 Ga0068858_100002550 Ga0068858_10000255011 441
277 3300005983 Ga0081540_1004420 Ga0081540_10044207 441
278 3300006028 Ga0070717_10001325 Ga0070717_100013256 441
279 3300006028 Ga0070717_10082016 Ga0070717_100820161 441
280 3300006237 Ga0097621_100146124 Ga0097621_1001461242 441
281 3300006931 Ga0097620_100001235 Ga0097620_1000012353 441
282 3300009093 Ga0105240_10008820 Ga0105240_100088202 441
283 3300009093 Ga0105240_10033803 Ga0105240_100338036 441
284 3300009177 Ga0105248_10036718 Ga0105248_100367185 441
285 3300010375 Ga0105239_10011958 Ga0105239_100119582 441
286 3300013100 Ga0157373_10056710 Ga0157373_100567102 441
287 3300013105 Ga0157369_10106526 Ga0157369_101065263 441
288 3300013105 Ga0157369_10108577 Ga0157369_101085773 441
289 3300013105 Ga0157369_10177274 Ga0157369_101772742 441
290 3300013296 Ga0157374_10004453 Ga0157374_100044533 441
291 3300013297 Ga0157378_10000009 Ga0157378_1000000929 441
292 3300013306 Ga0163162_10000851 Ga0163162_1000085123 441
293 3300013307 Ga0157372_10000140 Ga0157372_1000014046 441
294 3300013307 Ga0157372_10002812 Ga0157372_1000281211 441
295 3300015262 Ga0182007_10012089 Ga0182007_100120892 441
296 3300025226 Ga0209674_102281 Ga0209674_1022812 441
297 3300025250 Ga0209026_1000010 Ga0209026_1000010120 441
298 3300025898 Ga0207692_10111578 Ga0207692_101115781 441
299 3300025903 Ga0207680_10000005 Ga0207680_10000005195 441
300 3300025909 Ga0207705_10058789 Ga0207705_100587891 441
301 3300025912 Ga0207707_10023053 Ga0207707_100230534 441
302 3300025913 Ga0207695_10007696 Ga0207695_100076967 441
303 3300025913 Ga0207695_10026127 Ga0207695_100261274 441
304 3300025915 Ga0207693_10061240 Ga0207693_100612402 441
305 3300025922 Ga0207646_10078840 Ga0207646_100788402 441
306 3300025928 Ga0207700_10001774 Ga0207700_100017744 441
307 3300025939 Ga0207665_10010350 Ga0207665_100103504 441
308 3300025941 Ga0207711_10149384 Ga0207711_101493842 441
309 3300025942 Ga0207689_10020634 Ga0207689_100206344 441
310 3300025945 Ga0207679_10024016 Ga0207679_100240162 441
311 3300025949 Ga0207667_10019177 Ga0207667_100191774 441
312 3300025981 Ga0207640_10000001 Ga0207640_10000001447 441
313 3300025981 Ga0207640_10023791 Ga0207640_100237911 441
314 3300026035 Ga0207703_10006688 Ga0207703_100066884 441
315 3300026041 Ga0207639_10000023 Ga0207639_1000002367 441
316 3300026078 Ga0207702_10035149 Ga0207702_100351492 441
317 3300026089 Ga0207648_10073278 Ga0207648_100732782 441
318 3300026095 Ga0207676_10003562 Ga0207676_100035624 441
319 3300026116 Ga0207674_10000763 Ga0207674_1000076316 441
320 3300028379 Ga0268266_10000004 Ga0268266_100000041329 441
321 3300028381 Ga0268264_10058948 Ga0268264_100589483 441
322 3300031711 Ga0265314_10001468 Ga0265314_1000146811 441
323 3300046522 Ga0495643_0046181 Ga0495643_0046181_779_2131 441
324 3300046660 Ga0495625_0018234 Ga0495625_0018234_2408_3790 441
325 3300047472 Ga0495686_0004810 Ga0495686_0004810_5327_6658 441
326 3300048924 Ga0496121_0047961 Ga0496121_0047961_460_1806 441
327 3300048925 Ga0496122_0038959 Ga0496122_0038959_494_1891 441
328 3300048926 Ga0496123_0056615 Ga0496123_0056615_1144_2541 441
329 3300048927 Ga0496124_0003509 Ga0496124_0003509_3677_5056 441
330 3300048927 Ga0496124_0004598 Ga0496124_0004598_11922_13301 441
331 3300049569 Ga0501032_0033565 Ga0501032_0033565_1319_2698 441
332 3300049570 Ga0501033_0003097 Ga0501033_0003097_12308_13687 441
333 3300049572 Ga0501036_0005483 Ga0501036_0005483_3014_4393 441
334 3300049573 Ga0501037_0002833 Ga0501037_0002833_8304_9683 441
335 3300049574 Ga0501038_0002468 Ga0501038_0002468_1158_2537 441
336 3300049575 Ga0501039_0110293 Ga0501039_0110293_759_2138 441
337 3300049579 Ga0501043_0003939 Ga0501043_0003939_4706_6085 441
338 3300049580 Ga0501046_0001610 Ga0501046_0001610_16221_17600 441
339 3300049581 Ga0501047_0009097 Ga0501047_0009097_3985_5364 441
340 3300049590 Ga0501074_0064294 Ga0501074_0064294_405_1784 441
341 3300049822 Ga0501035_0003319 Ga0501035_0003319_8477_9856 441
342 3300049823 Ga0501044_0002842 Ga0501044_0002842_124_1503 441
343 iso_pu_bacteria 2842914999 2842915272 441
344 iso_pu_bacteria 2884215851 2884217272 441
345 3300002737 JGI25162J39368_1000066 JGI25162J39368_100006611 442
346 3300002737 JGI25162J39368_1000876 JGI25162J39368_10008764 442
347 3300002741 JGI25157J39369_1000050 JGI25157J39369_100005011 442
348 3300002741 JGI25157J39369_1000957 JGI25157J39369_10009574 442
349 3300002771 JGI25163J39215_1002659 JGI25163J39215_10026591 442
350 3300002772 JGI25164J39214_1000056 JGI25164J39214_100005695 442
351 3300003214 JGI25165J46597_1000009 JGI25165J46597_100000911 442
352 3300003751 Ga0055538_1002563 Ga0055538_10025632 442
353 3300003752 Ga0055539_1000614 Ga0055539_10006145 442
354 3300003756 Ga0055533_1000913 Ga0055533_10009135 442
355 3300003759 Ga0055525_1000856 Ga0055525_10008565 442
356 3300003760 Ga0055527_1000271 Ga0055527_100027120 442
357 3300003760 Ga0055527_1000273 Ga0055527_10002736 442
358 3300003761 Ga0055535_1000045 Ga0055535_100004511 442
359 3300003761 Ga0055535_1000567 Ga0055535_100056720 442
360 3300003761 Ga0055535_1000574 Ga0055535_10005746 442
361 3300003762 Ga0055542_1000010 Ga0055542_1000010251 442
362 3300003762 Ga0055542_1000079 Ga0055542_100007911 442
363 3300003762 Ga0055542_1000591 Ga0055542_10005916 442
364 3300003762 Ga0055542_1000597 Ga0055542_100059719 442
365 3300003763 Ga0055529_1000122 Ga0055529_100012295 442
366 3300003763 Ga0055529_1000556 Ga0055529_10005566 442
367 3300003763 Ga0055529_1000815 Ga0055529_100081512 442
368 3300005329 Ga0070683_100113830 Ga0070683_1001138302 442
369 3300005340 Ga0070689_100017194 Ga0070689_1000171943 442
370 3300005365 Ga0070688_100054144 Ga0070688_1000541442 442
371 3300005439 Ga0070711_100045408 Ga0070711_1000454082 442
372 3300005439 Ga0070711_100050361 Ga0070711_1000503612 442
373 3300005455 Ga0070663_100134224 Ga0070663_1001342241 442
374 3300005535 Ga0070684_100025054 Ga0070684_1000250543 442
375 3300005539 Ga0068853_100030721 Ga0068853_1000307213 442
376 3300005563 Ga0068855_100002105 Ga0068855_10000210516 442
377 3300005578 Ga0068854_100049730 Ga0068854_1000497302 442
378 3300005614 Ga0068856_100000323 Ga0068856_10000032310 442
379 3300005614 Ga0068856_100014695 Ga0068856_1000146953 442
380 3300005614 Ga0068856_100244498 Ga0068856_1002444982 442
381 3300005841 Ga0068863_100004744 Ga0068863_10000474411 442
382 3300005842 Ga0068858_100104791 Ga0068858_1001047912 442
383 3300005843 Ga0068860_100098222 Ga0068860_1000982222 442
384 3300005843 Ga0068860_100143097 Ga0068860_1001430972 442
385 3300006175 Ga0070712_100021376 Ga0070712_1000213762 442
386 3300006175 Ga0070712_100105388 Ga0070712_1001053882 442
387 3300006237 Ga0097621_100002345 Ga0097621_1000023452 442
388 3300006358 Ga0068871_100000476 Ga0068871_10000047610 442
389 3300009093 Ga0105240_10000884 Ga0105240_100008845 442
390 3300009093 Ga0105240_10001842 Ga0105240_1000184222 442
391 3300009551 Ga0105238_10039610 Ga0105238_100396102 442
392 3300010375 Ga0105239_10000050 Ga0105239_1000005022 442
393 3300013105 Ga0157369_10084831 Ga0157369_100848312 442
394 3300014969 Ga0157376_10153187 Ga0157376_101531872 442
395 3300015687 Ga0183368_1004 Ga0183368_1004687 442
396 3300025224 Ga0209784_100013 Ga0209784_100013481 442
397 3300025226 Ga0209674_100053 Ga0209674_10005347 442
398 3300025226 Ga0209674_100063 Ga0209674_100063162 442
399 3300025228 Ga0209672_100009 Ga0209672_100009332 442
400 3300025228 Ga0209672_100024 Ga0209672_100024284 442
401 3300025230 Ga0209563_100127 Ga0209563_10012777 442
402 3300025231 Ga0207427_100030 Ga0207427_100030282 442
403 3300025233 Ga0209437_100012 Ga0209437_100012732 442
404 3300025233 Ga0209437_100416 Ga0209437_10041624 442
405 3300025242 Ga0209258_100011 Ga0209258_100011312 442
406 3300025242 Ga0209258_100019 Ga0209258_10001957 442
407 3300025242 Ga0209258_100047 Ga0209258_100047284 442
408 3300025242 Ga0209258_101028 Ga0209258_1010281 442
409 3300025246 Ga0209646_1000458 Ga0209646_10004585 442
410 3300025250 Ga0209026_1000015 Ga0209026_1000015376 442
411 3300025250 Ga0209026_1000163 Ga0209026_100016321 442
412 3300025250 Ga0209026_1005397 Ga0209026_10053973 442
413 3300025254 Ga0209148_1000001 Ga0209148_10000012243 442
414 3300025254 Ga0209148_1000005 Ga0209148_100000597 442
415 3300025254 Ga0209148_1000013 Ga0209148_1000013312 442
416 3300025254 Ga0209148_1000054 Ga0209148_1000054284 442
417 3300025256 Ga0209759_1000023 Ga0209759_1000023224 442
418 3300025256 Ga0209759_1000622 Ga0209759_100062221 442
419 3300025261 Ga0209233_1000002 Ga0209233_100000257 442
420 3300025272 Ga0209455_1000012 Ga0209455_1000012312 442
421 3300025272 Ga0209455_1000027 Ga0209455_1000027489 442
422 3300025272 Ga0209455_1000052 Ga0209455_1000052284 442
423 3300025315 Ga0207697_10072531 Ga0207697_100725311 442
424 3300025913 Ga0207695_10000198 Ga0207695_1000019816 442
425 3300025913 Ga0207695_10002325 Ga0207695_1000232524 442
426 3300025914 Ga0207671_10031622 Ga0207671_100316222 442
427 3300025915 Ga0207693_10031338 Ga0207693_100313382 442
428 3300025915 Ga0207693_10031475 Ga0207693_100314752 442
429 3300025916 Ga0207663_10009342 Ga0207663_100093424 442
430 3300025933 Ga0207706_10039908 Ga0207706_100399083 442
431 3300025936 Ga0207670_10006704 Ga0207670_100067043 442
432 3300025981 Ga0207640_10103020 Ga0207640_101030202 442
433 3300026023 Ga0207677_10023622 Ga0207677_100236222 442
434 3300026035 Ga0207703_10091740 Ga0207703_100917402 442
435 3300026078 Ga0207702_10006103 Ga0207702_100061037 442
436 3300026078 Ga0207702_10013707 Ga0207702_100137075 442
437 3300026078 Ga0207702_10014687 Ga0207702_100146872 442
438 3300026088 Ga0207641_10005114 Ga0207641_100051142 442
439 3300028381 Ga0268264_10149612 Ga0268264_101496122 442
440 3300028800 Ga0265338_10002332 Ga0265338_100023322 442
441 3300030760 Ga0265762_1000396 Ga0265762_10003963 442
442 3300031090 Ga0265760_10013641 Ga0265760_100136411 442
443 3300031344 Ga0265316_10015042 Ga0265316_100150424 442
444 3300035118 Ga0373954_0000981 Ga0373954_0000981_6746_8134 442
445 3300036401 Ga0373937_0003120 Ga0373937_0003120_9113_10501 442
446 3300046460 Ga0495638_0000009 Ga0495638_0000009_275831_277198 442
447 3300046460 Ga0495638_0000052 Ga0495638_0000052_197598_198965 442
448 3300046471 Ga0495650_0000122 Ga0495650_0000122_57751_59118 442
449 3300046507 Ga0495606_0000056 Ga0495606_0000056_65257_66624 442
450 3300046557 Ga0495622_0006997 Ga0495622_0006997_215_1582 442
451 3300046660 Ga0495625_0013321 Ga0495625_0013321_5020_6387 442
452 3300047471 Ga0495684_0021024 Ga0495684_0021024_1910_3298 442
453 3300048088 Ga0495602_0006491 Ga0495602_0006491_4023_5411 442
454 3300048904 Ga0496101_0042667 Ga0496101_0042667_1446_2870 442
455 3300048918 Ga0496115_0000013 Ga0496115_0000013_127960_129327 442
456 3300048918 Ga0496115_0000044 Ga0496115_0000044_17451_18818 442
457 3300048918 Ga0496115_0051691 Ga0496115_0051691_1075_2445 442
458 3300048920 Ga0496117_0017189 Ga0496117_0017189_1986_3410 442
459 3300048920 Ga0496117_0020746 Ga0496117_0020746_586_1956 442
460 3300048921 Ga0496118_0000636 Ga0496118_0000636_44246_45670 442
461 3300048921 Ga0496118_0004166 Ga0496118_0004166_11227_12597 442
462 3300048922 Ga0496119_0000109 Ga0496119_0000109_70283_71707 442
463 3300048923 Ga0496120_0000150 Ga0496120_0000150_70284_71708 442
464 3300048924 Ga0496121_0000013 Ga0496121_0000013_143963_145387 442
465 3300048924 Ga0496121_0018867 Ga0496121_0018867_2199_3623 442
466 3300048929 Ga0496126_0002275 Ga0496126_0002275_20250_21620 442
467 3300048929 Ga0496126_0010917 Ga0496126_0010917_4354_5721 442
468 3300049460 Ga0495682_0031178 Ga0495682_0031178_163_1530 442
469 iso_pu_bacteria 2928963466 2928963865 442
470 3300002737 JGI25162J39368_1000623 JGI25162J39368_10006233 443
471 3300002772 JGI25164J39214_1000061 JGI25164J39214_100006128 443
472 3300003214 JGI25165J46597_1000151 JGI25165J46597_100015165 443
473 3300003320 rootH2_10078932 rootH2_100789323 443
474 3300003761 Ga0055535_1000466 Ga0055535_100046623 443
475 3300003762 Ga0055542_1001011 Ga0055542_100101123 443
476 3300003763 Ga0055529_1000140 Ga0055529_100014072 443
477 3300005344 Ga0070661_100021595 Ga0070661_1000215952 443
478 3300005457 Ga0070662_100025419 Ga0070662_1000254192 443
479 3300005539 Ga0068853_100037155 Ga0068853_1000371552 443
480 3300005577 Ga0068857_100186220 Ga0068857_1001862202 443
481 3300005614 Ga0068856_100010763 Ga0068856_1000107634 443
482 3300005937 Ga0081455_10176541 Ga0081455_101765411 443
483 3300009545 Ga0105237_10037387 Ga0105237_100373873 443
484 3300009551 Ga0105238_10058975 Ga0105238_100589753 443
485 3300010375 Ga0105239_10182592 Ga0105239_101825922 443
486 3300025228 Ga0209672_100107 Ga0209672_10010766 443
487 3300025231 Ga0207427_100021 Ga0207427_100021317 443
488 3300025233 Ga0209437_100150 Ga0209437_10015065 443
489 3300025242 Ga0209258_100299 Ga0209258_10029951 443
490 3300025246 Ga0209646_1000553 Ga0209646_10005539 443
491 3300025254 Ga0209148_1000205 Ga0209148_100020571 443
492 3300025256 Ga0209759_1004122 Ga0209759_10041221 443
493 3300025261 Ga0209233_1000023 Ga0209233_1000023305 443
494 3300025272 Ga0209455_1000081 Ga0209455_100008139 443
495 3300025904 Ga0207647_10001010 Ga0207647_100010108 443
496 3300025914 Ga0207671_10067946 Ga0207671_100679462 443
497 3300025919 Ga0207657_10046151 Ga0207657_100461512 443
498 3300025924 Ga0207694_10027366 Ga0207694_100273662 443
499 3300025932 Ga0207690_10011373 Ga0207690_100113732 443
500 3300026041 Ga0207639_10096811 Ga0207639_100968112 443
501 3300026116 Ga0207674_10207554 Ga0207674_102075542 443
502 3300037312 Ga0395899_0004130 Ga0395899_0004130_2338_3699 443
503 3300037466 Ga0395898_0000530 Ga0395898_0000530_65706_67067 443
504 3300044683 Ga0466965_0034225 Ga0466965_0034225_856_2229 443
505 3300044693 Ga0466961_0002035 Ga0466961_0002035_10935_12296 443
506 3300044693 Ga0466961_0005214 Ga0466961_0005214_2937_4310 443
507 3300044719 Ga0466971_0003869 Ga0466971_0003869_4092_5465 443
508 3300045049 Ga0466959_0009477 Ga0466959_0009477_5039_6412 443
509 3300045836 Ga0466958_0009428 Ga0466958_0009428_1906_3279 443
510 3300047472 Ga0495686_0007061 Ga0495686_0007061_1714_3093 443
511 3300048929 Ga0496126_0001475 Ga0496126_0001475_957_2330 443
512 3300061719 Ga0466962_0003669 Ga0466962_0003669_4153_5526 443
513 3300005842 Ga0068858_100000272 Ga0068858_10000027218 444
514 3300009101 Ga0105247_10012902 Ga0105247_100129021 444
515 3300026035 Ga0207703_10000365 Ga0207703_1000036518 444
516 3300039447 Ga0436361_0534850 Ga0436361_0534850_26647_27996 444
517 3300039447 Ga0436361_0944579 Ga0436361_0944579_1513_2859 444
518 3300048903 Ga0496100_0048526 Ga0496100_0048526_1285_2700 444
519 3300048924 Ga0496121_0039847 Ga0496121_0039847_1745_3160 444
520 3300048928 Ga0496125_0000599 Ga0496125_0000599_18480_19895 444
521 3300048929 Ga0496126_0006890 Ga0496126_0006890_7884_9233 447
522 3300000546 LJNas_1000307 LJNas_10003074 448
523 3300013307 Ga0157372_10182515 Ga0157372_101825152 448
524 3300014325 Ga0163163_10002757 Ga0163163_100027579 448
525 3300014969 Ga0157376_10003224 Ga0157376_100032246 448
526 3300025904 Ga0207647_10004877 Ga0207647_100048777 448
527 3300028379 Ga0268266_10055850 Ga0268266_100558503 448
528 3300046660 Ga0495625_0130807 Ga0495625_0130807_105_1451 448
529 3300048904 Ga0496101_0141191 Ga0496101_0141191_41_1387 448
530 3300048907 Ga0496104_0164181 Ga0496104_0164181_660_2006 448
531 3300048908 Ga0496105_0003575 Ga0496105_0003575_6828_8174 448
532 3300048915 Ga0496112_0211488 Ga0496112_0211488_449_1795 448
533 3300048916 Ga0496113_0002616 Ga0496113_0002616_41_1387 448
534 3300048918 Ga0496115_0104355 Ga0496115_0104355_408_1754 448
535 3300053077 Ga0495601_0049721 Ga0495601_0049721_713_2065 448

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00754

F5_F8_type_C

F5/8 type C domain

358

472

0.86

PF01120

Alpha_L_fucos

Alpha-L-fucosidase

94

354

0.85

PF22633

F5_F8_type_C_2

NedA-like, galactose-binding domain

372

458

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oue-assembly2.cif.gz_B crystal structure of an a-l-fucosidase gh29 from bacteroides thetaiotaomicron (bt2192) in complex with iptg 0.9326 24 443
3uet-assembly1.cif.gz_B crystal structure of alpha-1,3/4-fucosidase from bifidobacterium longum subsp. infantis d172a/e217a mutant complexed with lacto-n-fucopentaose ii 0.9183 21 443
8ayr-assembly2.cif.gz_B sialidases and fucosidases of akkermansia muciniphila are key for rapid growth on colonic mucin and nutrient sharing amongst mucin-associated human gut microbiota 0.9166 25 447
3ues-assembly1.cif.gz_A crystal structure of alpha-1,3/4-fucosidase from bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin 0.9135 21 443
6org-assembly2.cif.gz_B crystal structure of spgh29 0.9102 23 443
ID Description Score Start End Superfamily
4ozoB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9464 26 317 3.20.20.80
af_Q7XUR3_35_350_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.929 26 322 3.20.20.80
3gzaA02 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.9281 354 443 2.60.120.260
af_Q7XUR3_364_478_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8967 329 443 2.60.120.260
3mo4A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8919 17 317 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A855K4S6-F1-model_v4 Alpha-L-fucosidase 0.9917 53 143 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A3C1R4S6-F1-model_v4 deleted 0.99 26 143
AF-A0A7J7DZ34-F1-model_v4 alpha-L-fucosidase (EC 3.2.1.51) 0.9848 26 121 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-J9CAZ2-F1-model_v4 Glycoside hydrolase, family 29 (EC 3.2.1.51) 0.9846 26 131 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-K1UJK4-F1-model_v4 Alpha-L-fucosidase 0.9845 26 143 GO:0004560
GO:0005764
GO:0006004
GO:0016139

Feature Viewer

pLDDT pTM Quality
90.98 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map