F460567

General Info

Members Datasets Scaffolds Average Seq Length
534 297 1068 163

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0390867|Ga0495638_0390867_165_662
Length 165
Sequence MLPMDHPLRRPEEILAYRSLQQILTAKPRGLWTVGPGNDAIVALRLMAEKNIGFLVVVEPGGTIVGVLSERDCVRRLILAGKPPETTPVADIMVRDVIKTDLSHTYADCLRLMHAHGIRHLPVVENDTAIGVVSIRDLLKEAVEHHAKIIGALERERMTMLTSMA

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
290 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
293 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
294 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
295 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
296 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
297 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.04
Nodule 0.19
Rhizoplane 6.18
Rhizosphere 76.59
Stem 0
Stem Tuber 0
Unclassified 7.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0390867 3300046460 Unclassified 724
2 JGI24739J22299_10075711 3300001989 Bacteria 1040
3 rootH2_10120495 3300003320 Bacteria 1878
4 rootL2_10046323 3300003322 Bacteria 3521
5 rootH1_10209999 3300003323 Bacteria 2013
6 Ga0065707_10189156 3300005295 Bacteria 1371
7 Ga0065707_10830704 3300005295 Unclassified 589
8 Ga0070670_100607860 3300005331 Bacteria 979
9 Ga0068869_100013799 3300005334 Bacteria 5384
10 Ga0070666_10115582 3300005335 Bacteria 1858
11 Ga0070680_100062717 3300005336 Bacteria 3044
12 Ga0070682_100161481 3300005337 Bacteria 1548
13 Ga0070682_100590539 3300005337 Unclassified 875
14 Ga0068868_100022976 3300005338 Bacteria 4715
15 Ga0070689_100116551 3300005340 Bacteria 2130
16 Ga0070689_100294345 3300005340 Bacteria 1350
17 Ga0070687_100085648 3300005343 Bacteria 1730
18 Ga0070661_100193757 3300005344 Bacteria 1551
19 Ga0070661_100538534 3300005344 Bacteria 938
20 Ga0070668_100029711 3300005347 Bacteria 4152
21 Ga0070669_100248856 3300005353 Bacteria 1415
22 Ga0070675_101034983 3300005354 Bacteria 754
23 Ga0070671_101199483 3300005355 Bacteria 668
24 Ga0070674_100611900 3300005356 Bacteria 922
25 Ga0070673_100135249 3300005364 Bacteria 2074
26 Ga0070659_100499962 3300005366 Bacteria 1036
27 Ga0070659_100602787 3300005366 Unclassified 944
28 Ga0070667_100135281 3300005367 Bacteria 2155
29 Ga0070710_10156894 3300005437 Bacteria 1408
30 Ga0070711_100329486 3300005439 Bacteria 1222
31 Ga0070705_100262166 3300005440 Unclassified 1219
32 Ga0070700_100341685 3300005441 Bacteria 1107
33 Ga0070708_101096504 3300005445 Unclassified 746
34 Ga0070663_100020753 3300005455 Bacteria 4353
35 Ga0070663_100062902 3300005455 Bacteria 2677
36 Ga0070663_100348188 3300005455 Bacteria 1199
37 Ga0070678_100111161 3300005456 Bacteria 2144
38 Ga0070662_100016209 3300005457 Bacteria 5000
39 Ga0070681_10323660 3300005458 Bacteria 1451
40 Ga0070681_10438164 3300005458 Bacteria 1219
41 Ga0070681_11013462 3300005458 Unclassified 750
42 Ga0068867_100326391 3300005459 Bacteria 1273
43 Ga0070706_100104955 3300005467 Bacteria 2629
44 Ga0070699_100290601 3300005518 Bacteria 1466
45 Ga0070697_100442674 3300005536 Bacteria 1131
46 Ga0068853_100138724 3300005539 Bacteria 2182
47 Ga0068853_100485065 3300005539 Bacteria 1165
48 Ga0070672_100929506 3300005543 Bacteria 769
49 Ga0070672_101227228 3300005543 Unclassified 668
50 Ga0070686_100666972 3300005544 Bacteria 826
51 Ga0070696_100126671 3300005546 Bacteria 1854
52 Ga0070693_100014050 3300005547 Bacteria 4092
53 Ga0070693_100254177 3300005547 Bacteria 1166
54 Ga0070665_100076322 3300005548 Bacteria 3358
55 Ga0070665_100167620 3300005548 Bacteria 2198
56 Ga0070665_101392255 3300005548 Bacteria 710
57 Ga0068855_100425048 3300005563 Bacteria 1453
58 Ga0070664_100244295 3300005564 Bacteria 1612
59 Ga0068857_100176871 3300005577 Bacteria 1941
60 Ga0068856_100009139 3300005614 Bacteria 9635
61 Ga0068856_101537564 3300005614 Unclassified 679
62 Ga0070702_100285915 3300005615 Bacteria 1134
63 Ga0068852_100068611 3300005616 Bacteria 3104
64 Ga0068852_101359250 3300005616 Bacteria 732
65 Ga0068859_100290258 3300005617 Bacteria 1729
66 Ga0068859_101029642 3300005617 Unclassified 905
67 Ga0068864_100075934 3300005618 Bacteria 2935
68 Ga0068864_101066261 3300005618 Bacteria 803
69 Ga0068861_100018587 3300005719 Bacteria 4952
70 Ga0068870_10083733 3300005840 Bacteria 1769
71 Ga0068863_100211154 3300005841 Bacteria 1869
72 Ga0068858_100348492 3300005842 Bacteria 1418
73 Ga0068860_100151681 3300005843 Bacteria 2232
74 Ga0068860_100613621 3300005843 Bacteria 1094
75 Ga0068862_100023420 3300005844 Bacteria 5175
76 Ga0068862_100076669 3300005844 Bacteria 2894
77 Ga0081455_10007349 3300005937 Bacteria 11617
78 Ga0081455_10016840 3300005937 Bacteria 7030
79 Ga0081455_10047113 3300005937 Bacteria 3735
80 Ga0081455_10216379 3300005937 Bacteria 1424
81 Ga0081455_10292953 3300005937 Bacteria 1171
82 Ga0081540_1002604 3300005983 Bacteria 14664
83 Ga0081540_1009312 3300005983 Bacteria 6775
84 Ga0081540_1009802 3300005983 Bacteria 6556
85 Ga0081540_1197570 3300005983 Bacteria 735
86 Ga0081539_10049554 3300005985 Bacteria 2382
87 Ga0070717_10514224 3300006028 Bacteria 1083
88 Ga0075365_10001258 3300006038 Bacteria 11238
89 Ga0075365_10015050 3300006038 Bacteria 4669
90 Ga0075365_10031674 3300006038 Bacteria 3393
91 Ga0075365_10067438 3300006038 Bacteria 2402
92 Ga0075365_10166594 3300006038 Bacteria 1537
93 Ga0075365_10308375 3300006038 Bacteria 1114
94 Ga0075365_10446753 3300006038 Bacteria 913
95 Ga0075363_100004654 3300006048 Bacteria 6034
96 Ga0075363_100021177 3300006048 Bacteria 3271
97 Ga0075363_100027483 3300006048 Bacteria 2918
98 Ga0075363_100051680 3300006048 Bacteria 2192
99 Ga0075363_100148750 3300006048 Bacteria 1321
100 Ga0075364_10004205 3300006051 Bacteria 8261
101 Ga0075364_10021037 3300006051 Bacteria 4109
102 Ga0075364_10044458 3300006051 Bacteria 2889
103 Ga0075364_10311631 3300006051 Bacteria 1072
104 Ga0075362_10034717 3300006177 Bacteria 2199
105 Ga0075362_10041218 3300006177 Bacteria 2035
106 Ga0075362_10095041 3300006177 Bacteria 1387
107 Ga0075362_10163365 3300006177 Bacteria 1073
108 Ga0075367_10015646 3300006178 Bacteria 4129
109 Ga0075367_10066363 3300006178 Bacteria 2162
110 Ga0075367_10068310 3300006178 Bacteria 2132
111 Ga0075367_10163083 3300006178 Bacteria 1386
112 Ga0075367_10174756 3300006178 Bacteria 1338
113 Ga0075369_10008318 3300006186 Bacteria 3990
114 Ga0075369_10085750 3300006186 Bacteria 1401
115 Ga0075366_10078463 3300006195 Bacteria 1971
116 Ga0075366_10114859 3300006195 Bacteria 1621
117 Ga0075366_10196141 3300006195 Bacteria 1227
118 Ga0075366_10324210 3300006195 Bacteria 944
119 Ga0075366_10398991 3300006195 Bacteria 846
120 Ga0097621_100153050 3300006237 Bacteria 1978
121 Ga0075370_10004812 3300006353 Bacteria 6611
122 Ga0075370_10106834 3300006353 Bacteria 1623
123 Ga0075370_10189240 3300006353 Bacteria 1212
124 Ga0075370_10214187 3300006353 Bacteria 1138
125 Ga0068871_100030886 3300006358 Bacteria 4222
126 Ga0068871_100622450 3300006358 Bacteria 983
127 Ga0068871_100868022 3300006358 Bacteria 835
128 Ga0075428_100148350 3300006844 Bacteria 2548
129 Ga0075428_100971623 3300006844 Unclassified 899
130 Ga0075430_100319766 3300006846 Unclassified 1283
131 Ga0075430_100843768 3300006846 Bacteria 755
132 Ga0075431_100259436 3300006847 Bacteria 1764
133 Ga0075431_100470382 3300006847 Bacteria 1251
134 Ga0075433_10528322 3300006852 Bacteria 1038
135 Ga0075434_100060807 3300006871 Bacteria 3758
136 Ga0075434_100161424 3300006871 Bacteria 2261
137 Ga0075434_100508357 3300006871 Bacteria 1225
138 Ga0075429_100070514 3300006880 Bacteria 3043
139 Ga0075429_100152186 3300006880 Bacteria 2026
140 Ga0075429_100401877 3300006880 Bacteria 1200
141 Ga0097620_100290220 3300006931 Bacteria 1729
142 Ga0097620_101029750 3300006931 Unclassified 905
143 Ga0075435_100302135 3300007076 Bacteria 1369
144 Ga0105240_10173091 3300009093 Bacteria 2555
145 Ga0105240_11078226 3300009093 Bacteria 856
146 Ga0111539_10289425 3300009094 Bacteria 1906
147 Ga0111539_12537137 3300009094 Bacteria 594
148 Ga0105245_10214279 3300009098 Bacteria 1855
149 Ga0105245_10840463 3300009098 Bacteria 958
150 Ga0105247_10016354 3300009101 Bacteria 4444
151 Ga0105247_10029599 3300009101 Bacteria 3319
152 Ga0105247_10139542 3300009101 Bacteria 1587
153 Ga0114129_10093449 3300009147 Unclassified 4166
154 Ga0114129_10667436 3300009147 Bacteria 1340
155 Ga0105243_10061306 3300009148 Bacteria 3008
156 Ga0105243_11125813 3300009148 Bacteria 794
157 Ga0105241_10010704 3300009174 Bacteria 6730
158 Ga0105241_10359393 3300009174 Bacteria 1267
159 Ga0105242_10061429 3300009176 Bacteria 3091
160 Ga0105248_10065408 3300009177 Bacteria 4083
161 Ga0105248_12641099 3300009177 Bacteria 573
162 Ga0105237_10695520 3300009545 Bacteria 1023
163 Ga0105238_10031814 3300009551 Bacteria 5369
164 Ga0105238_10068114 3300009551 Bacteria 3560
165 Ga0105238_10862155 3300009551 Bacteria 923
166 Ga0105249_10012168 3300009553 Bacteria 7577
167 Ga0105239_10236768 3300010375 Bacteria 2049
168 Ga0105239_10466351 3300010375 Bacteria 1434
169 Ga0105246_10024178 3300011119 Bacteria 3943
170 Ga0105246_10092291 3300011119 Bacteria 2185
171 Ga0157370_10600721 3300013104 Bacteria 1007
172 Ga0157374_10063522 3300013296 Bacteria 3463
173 Ga0157378_10363336 3300013297 Bacteria 1417
174 Ga0163162_10541963 3300013306 Bacteria 1292
175 Ga0157375_10159362 3300013308 Bacteria 2398
176 Ga0157375_11730517 3300013308 Bacteria 741
177 Ga0163163_10049500 3300014325 Bacteria 4137
178 Ga0163163_10164666 3300014325 Bacteria 2263
179 Ga0163163_10792461 3300014325 Bacteria 1011
180 Ga0157380_10804312 3300014326 Bacteria 957
181 Ga0182008_10197289 3300014497 Bacteria 1023
182 Ga0157377_10082925 3300014745 Bacteria 1877
183 Ga0157377_10629381 3300014745 Unclassified 769
184 Ga0157379_10061230 3300014968 Bacteria 3365
185 Ga0157376_10332730 3300014969 Bacteria 1448
186 Ga0157376_11621598 3300014969 Unclassified 681
187 Ga0209758_1037649 3300025297 Bacteria 1866
188 Ga0207697_10095446 3300025315 Bacteria 1263
189 Ga0207710_10199751 3300025900 Bacteria 987
190 Ga0207688_10062231 3300025901 Bacteria 2104
191 Ga0207680_10144830 3300025903 Bacteria 1578
192 Ga0207645_10084934 3300025907 Bacteria 2032
193 Ga0207643_10065274 3300025908 Bacteria 2085
194 Ga0207684_10731687 3300025910 Bacteria 839
195 Ga0207654_10177172 3300025911 Bacteria 1389
196 Ga0207707_10512374 3300025912 Bacteria 1022
197 Ga0207671_10019603 3300025914 Bacteria 5169
198 Ga0207693_10311725 3300025915 Bacteria 1232
199 Ga0207663_10272719 3300025916 Bacteria 1254
200 Ga0207660_10272496 3300025917 Bacteria 1341
201 Ga0207660_10524854 3300025917 Bacteria 962
202 Ga0207662_10068792 3300025918 Bacteria 2139
203 Ga0207649_10750145 3300025920 Bacteria 759
204 Ga0207649_11194299 3300025920 Bacteria 601
205 Ga0207694_10112648 3300025924 Bacteria 2165
206 Ga0207694_10602670 3300025924 Bacteria 924
207 Ga0207650_10050341 3300025925 Bacteria 3080
208 Ga0207687_10150811 3300025927 Bacteria 1774
209 Ga0207644_10122730 3300025931 Bacteria 1980
210 Ga0207706_10023653 3300025933 Bacteria 5516
211 Ga0207709_10237547 3300025935 Bacteria 1324
212 Ga0207669_10285271 3300025937 Bacteria 1247
213 Ga0207691_10281954 3300025940 Bacteria 1429
214 Ga0207711_10037386 3300025941 Bacteria 4123
215 Ga0207689_10021652 3300025942 Bacteria 5406
216 Ga0207667_11005233 3300025949 Bacteria 821
217 Ga0207712_10292823 3300025961 Bacteria 1333
218 Ga0207668_10027384 3300025972 Bacteria 3711
219 Ga0207658_10061541 3300025986 Bacteria 2806
220 Ga0207677_10043717 3300026023 Bacteria 2980
221 Ga0207703_10082354 3300026035 Bacteria 2685
222 Ga0207639_10119565 3300026041 Bacteria 2162
223 Ga0207639_10329468 3300026041 Bacteria 1358
224 Ga0207678_10019882 3300026067 Bacteria 5902
225 Ga0207678_10047488 3300026067 Bacteria 3712
226 Ga0207678_10392827 3300026067 Bacteria 1200
227 Ga0207708_10072122 3300026075 Bacteria 2646
228 Ga0207648_10332508 3300026089 Bacteria 1367
229 Ga0207676_10016706 3300026095 Bacteria 5315
230 Ga0207676_10953992 3300026095 Bacteria 843
231 Ga0207674_10022409 3300026116 Bacteria 6783
232 Ga0207675_100034620 3300026118 Bacteria 4709
233 Ga0207683_10059791 3300026121 Bacteria 3348
234 Ga0209813_10132956 3300027866 Bacteria 877
235 Ga0207428_10834123 3300027907 Bacteria 654
236 Ga0207428_10915854 3300027907 Unclassified 619
237 Ga0268266_10000807 3300028379 Bacteria 41568
238 Ga0268266_10025228 3300028379 Bacteria 5060
239 Ga0268266_10137307 3300028379 Bacteria 2191
240 Ga0268266_10386106 3300028379 Bacteria 1322
241 Ga0268265_10101873 3300028380 Bacteria 2321
242 Ga0268264_10720287 3300028381 Bacteria 992
243 Ga0307511_10152875 3300030521 Bacteria 1319
244 Ga0307509_10038464 3300031507 Bacteria 5218
245 Ga0307509_10224955 3300031507 Bacteria 1685
246 Ga0307406_10663326 3300031901 Bacteria 867
247 Ga0307415_100638749 3300032126 Unclassified 953
248 Ga0373926_0044597 3300035083 Bacteria 1589
249 Ga0373926_0134216 3300035083 Bacteria 938
250 Ga0373934_0024367 3300035086 Bacteria 2340
251 Ga0373944_0066913 3300035089 Bacteria 1163
252 Ga0373923_0057626 3300035111 Bacteria 1643
253 Ga0373923_0090955 3300035111 Bacteria 1335
254 Ga0373945_0006415 3300035116 Bacteria 3795
255 Ga0373953_0123616 3300035117 Bacteria 1100
256 Ga0373953_0253891 3300035117 Bacteria 764
257 Ga0373954_0006034 3300035118 Bacteria 5270
258 Ga0373954_0010774 3300035118 Bacteria 4043
259 Ga0373954_0023669 3300035118 Bacteria 2795
260 Ga0373956_0006515 3300035119 Bacteria 4680
261 Ga0373956_0008179 3300035119 Bacteria 4232
262 Ga0373957_0146055 3300035120 Bacteria 969
263 Ga0373943_0062176 3300035170 Bacteria 1868
264 Ga0373943_0210594 3300035170 Bacteria 1079
265 Ga0373943_0266686 3300035170 Unclassified 965
266 Ga0373946_0353303 3300035171 Bacteria 735
267 Ga0373955_0003182 3300035172 Bacteria 7189
268 Ga0373955_0030679 3300035172 Bacteria 2809
269 Ga0373924_0267350 3300035410 Bacteria 758
270 Ga0373931_0526765 3300035691 Bacteria 765
271 Ga0373935_0005538 3300035692 Bacteria 7440
272 Ga0373935_0123433 3300035692 Bacteria 1733
273 Ga0373927_0001649 3300035695 Bacteria 16726
274 Ga0373927_0191221 3300035695 Bacteria 1343
275 Ga0373927_0249609 3300035695 Bacteria 1166
276 Ga0373933_0026643 3300035724 Bacteria 3321
277 Ga0373933_0032878 3300035724 Bacteria 3015
278 Ga0373947_0042261 3300035725 Bacteria 2720
279 Ga0373947_0052992 3300035725 Bacteria 2445
280 Ga0373947_0576639 3300035725 Bacteria 766
281 Ga0373937_0005546 3300036401 Bacteria 10823
282 Ga0373937_0006983 3300036401 Bacteria 9745
283 Ga0373937_0052028 3300036401 Bacteria 3754
284 Ga0373937_0699220 3300036401 Bacteria 960
285 Ga0373937_0761619 3300036401 Bacteria 915
286 Ga0373925_0001973 3300037068 Bacteria 16990
287 Ga0373925_0498111 3300037068 Bacteria 1000
288 Ga0395899_0012551 3300037312 Bacteria 6495
289 Ga0395900_0002116 3300037418 Bacteria 22233
290 Ga0395898_0004650 3300037466 Bacteria 14963
291 Ga0395901_0007798 3300038443 Bacteria 10800
292 Ga0439465_0150542 3300041413 Bacteria 831
293 Ga0451853_0222781 3300041512 Bacteria 2294
294 Ga0451853_3673315 3300041512 Bacteria 798
295 Ga0453683_1064516 3300044673 Unclassified 538
296 Ga0453684_0869143 3300044712 Unclassified 968
297 Ga0495592_0035111 3300046454 Bacteria 3779
298 Ga0495592_0036064 3300046454 Bacteria 3725
299 Ga0495603_0001827 3300046455 Bacteria 12557
300 Ga0495603_0235879 3300046455 Bacteria 1054
301 Ga0495590_0194822 3300046457 Bacteria 743
302 Ga0495629_0001739 3300046459 Bacteria 17078
303 Ga0495629_0003254 3300046459 Bacteria 12299
304 Ga0495629_0161607 3300046459 Bacteria 1556
305 Ga0495629_0402474 3300046459 Unclassified 930
306 Ga0495629_0842447 3300046459 Unclassified 603
307 Ga0495629_1003682 3300046459 Unclassified 543
308 Ga0495638_0063370 3300046460 Bacteria 2279
309 Ga0495641_0005678 3300046461 Bacteria 8314
310 Ga0495641_0077821 3300046461 Bacteria 1487
311 Ga0495651_0003244 3300046462 Bacteria 12482
312 Ga0495651_0161371 3300046462 Bacteria 1605
313 Ga0495653_0004181 3300046463 Bacteria 11682
314 Ga0495653_0078720 3300046463 Bacteria 2444
315 Ga0495580_0008936 3300046472 Bacteria 7925
316 Ga0495580_0171381 3300046472 Bacteria 1501
317 Ga0495582_0000547 3300046473 Bacteria 20786
318 Ga0495582_0267931 3300046473 Bacteria 980
319 Ga0495639_0000163 3300046475 Bacteria 34576
320 Ga0495639_0209725 3300046475 Unclassified 956
321 Ga0495662_0000616 3300046476 Bacteria 16523
322 Ga0495664_0059104 3300046477 Bacteria 2282
323 Ga0495584_0064476 3300046491 Bacteria 1842
324 Ga0495584_0069616 3300046491 Bacteria 1768
325 Ga0495584_0156486 3300046491 Bacteria 1158
326 Ga0495585_0290961 3300046492 Unclassified 805
327 Ga0495585_0450294 3300046492 Bacteria 616
328 Ga0495594_0001043 3300046499 Bacteria 14436
329 Ga0495594_0059673 3300046499 Bacteria 2110
330 Ga0495606_0063799 3300046507 Bacteria 2347
331 Ga0495608_0006286 3300046511 Bacteria 8425
332 Ga0495610_0177329 3300046512 Unclassified 889
333 Ga0495628_0087389 3300046516 Bacteria 2417
334 Ga0495628_0119318 3300046516 Bacteria 2024
335 Ga0495628_0443168 3300046516 Bacteria 944
336 Ga0495630_0028859 3300046517 Bacteria 4123
337 Ga0495630_0160413 3300046517 Bacteria 1712
338 Ga0495630_0238464 3300046517 Bacteria 1390
339 Ga0495648_0094337 3300046524 Bacteria 1667
340 Ga0495666_0021186 3300046526 Bacteria 3218
341 Ga0495666_0198845 3300046526 Bacteria 922
342 Ga0495652_0005447 3300046529 Bacteria 11989
343 Ga0495652_0104342 3300046529 Bacteria 2292
344 Ga0495652_0815183 3300046529 Unclassified 620
345 Ga0495665_0003016 3300046531 Bacteria 9100
346 Ga0495665_0163618 3300046531 Bacteria 1159
347 Ga0495640_0014858 3300046533 Bacteria 5874
348 Ga0495640_0217344 3300046533 Bacteria 1206
349 Ga0495587_0001343 3300046536 Bacteria 16342
350 Ga0495587_0006120 3300046536 Bacteria 7853
351 Ga0495587_0072054 3300046536 Bacteria 2009
352 Ga0495645_0057061 3300046543 Bacteria 2835
353 Ga0495645_0127346 3300046543 Bacteria 1788
354 Ga0495622_0003321 3300046557 Bacteria 7597
355 Ga0495622_0079355 3300046557 Bacteria 1511
356 Ga0495667_0002429 3300046559 Bacteria 12441
357 Ga0495667_0010384 3300046559 Bacteria 6302
358 Ga0495667_0201917 3300046559 Bacteria 1272
359 Ga0495667_0225504 3300046559 Bacteria 1195
360 Ga0495667_0615515 3300046559 Unclassified 676
361 Ga0495656_0036291 3300046615 Bacteria 2030
362 Ga0495668_0173394 3300046616 Bacteria 1182
363 Ga0495634_0022303 3300046642 Bacteria 4461
364 Ga0495634_0359162 3300046642 Bacteria 871
365 Ga0495611_0049917 3300046648 Bacteria 1884
366 Ga0495625_0080245 3300046660 Bacteria 2273
367 Ga0495625_0238531 3300046660 Bacteria 1185
368 Ga0495625_0663964 3300046660 Unclassified 619
369 Ga0495635_0002402 3300046663 Bacteria 12759
370 Ga0495635_0008016 3300046663 Bacteria 7379
371 Ga0495635_0049811 3300046663 Bacteria 2887
372 Ga0495635_0079331 3300046663 Bacteria 2247
373 Ga0495635_0245021 3300046663 Bacteria 1209
374 Ga0495588_0134878 3300046674 Bacteria 1303
375 Ga0495657_0003700 3300046675 Bacteria 12383
376 Ga0495657_0254158 3300046675 Bacteria 1057
377 Ga0495599_0002232 3300046678 Bacteria 11280
378 Ga0495599_0022079 3300046678 Bacteria 3973
379 Ga0495623_0013967 3300046679 Bacteria 5203
380 Ga0495623_0119427 3300046679 Bacteria 1588
381 Ga0495646_0060133 3300046680 Bacteria 2267
382 Ga0495646_0193420 3300046680 Unclassified 1111
383 Ga0495647_0004539 3300046681 Bacteria 4518
384 Ga0495647_0064477 3300046681 Bacteria 1453
385 Ga0495658_0004596 3300046683 Bacteria 6794
386 Ga0495613_0004558 3300046689 Bacteria 10393
387 Ga0495613_0069512 3300046689 Bacteria 2567
388 Ga0495613_0472430 3300046689 Bacteria 847
389 Ga0495624_0003121 3300046690 Bacteria 12384
390 Ga0495624_0194840 3300046690 Bacteria 1232
391 Ga0495671_0310028 3300046692 Bacteria 759
392 Ga0495589_0107768 3300046794 Bacteria 1346
393 Ga0495589_0258903 3300046794 Bacteria 812
394 Ga0495589_0422391 3300046794 Bacteria 611
395 Ga0495600_0001685 3300046809 Bacteria 12349
396 Ga0495600_0073017 3300046809 Bacteria 2240
397 Ga0495581_0000979 3300047315 Bacteria 15353
398 Ga0495604_0003832 3300047317 Bacteria 11979
399 Ga0495604_0035530 3300047317 Bacteria 3936
400 Ga0495604_0139248 3300047317 Bacteria 1735
401 Ga0495674_0005950 3300047319 Bacteria 11703
402 Ga0495674_0811220 3300047319 Unclassified 727
403 Ga0495676_0245897 3300047321 Bacteria 1223
404 Ga0495680_0006343 3300047322 Bacteria 11008
405 Ga0495680_0087296 3300047322 Bacteria 2346
406 Ga0495680_0295563 3300047322 Bacteria 1138
407 Ga0495675_0002204 3300047444 Bacteria 11613
408 Ga0495675_0023105 3300047444 Bacteria 3962
409 Ga0495673_0053048 3300047469 Bacteria 1770
410 Ga0495684_0003840 3300047471 Bacteria 11705
411 Ga0495684_0015191 3300047471 Bacteria 5930
412 Ga0495684_0118286 3300047471 Bacteria 1997
413 Ga0495686_0566327 3300047472 Unclassified 592
414 Ga0495593_0006169 3300047673 Bacteria 7050
415 Ga0495593_0006375 3300047673 Bacteria 6920
416 Ga0495593_0141872 3300047673 Bacteria 1217
417 Ga0495602_0007101 3300048088 Bacteria 11757
418 Ga0495602_0176310 3300048088 Bacteria 1653
419 Ga0495614_0167068 3300048089 Bacteria 986
420 Ga0496100_0044951 3300048903 Bacteria 2832
421 Ga0496100_0085230 3300048903 Bacteria 2144
422 Ga0496101_0170274 3300048904 Bacteria 1674
423 Ga0496101_0491136 3300048904 Bacteria 970
424 Ga0496102_0096302 3300048905 Bacteria 2744
425 Ga0496102_0216331 3300048905 Bacteria 1806
426 Ga0496104_0197366 3300048907 Bacteria 1924
427 Ga0496104_0276422 3300048907 Bacteria 1592
428 Ga0496104_0312870 3300048907 Bacteria 1483
429 Ga0496105_0483021 3300048908 Bacteria 974
430 Ga0496106_0014892 3300048909 Bacteria 5752
431 Ga0496106_0302017 3300048909 Bacteria 1284
432 Ga0496107_0018337 3300048910 Bacteria 4928
433 Ga0496107_0071392 3300048910 Bacteria 2523
434 Ga0496108_0001200 3300048911 Bacteria 20310
435 Ga0496108_0063613 3300048911 Bacteria 3107
436 Ga0496108_0658661 3300048911 Bacteria 910
437 Ga0496109_0003922 3300048912 Bacteria 12432
438 Ga0496110_0019705 3300048913 Bacteria 5683
439 Ga0496110_0106931 3300048913 Bacteria 2511
440 Ga0496110_0280261 3300048913 Bacteria 1518
441 Ga0496111_0207923 3300048914 Bacteria 1454
442 Ga0496111_0276499 3300048914 Bacteria 1246
443 Ga0496111_0623787 3300048914 Unclassified 788
444 Ga0496112_0017894 3300048915 Bacteria 6669
445 Ga0496112_0139107 3300048915 Bacteria 2397
446 Ga0496112_0995868 3300048915 Bacteria 758
447 Ga0496113_0056591 3300048916 Bacteria 2945
448 Ga0496113_0184124 3300048916 Bacteria 1656
449 Ga0496113_0296031 3300048916 Bacteria 1295
450 Ga0496115_0031522 3300048918 Bacteria 4178
451 Ga0496115_0342872 3300048918 Bacteria 1219
452 Ga0496115_0837704 3300048918 Unclassified 713
453 Ga0496119_0529848 3300048922 Bacteria 544
454 Ga0496121_0044200 3300048924 Bacteria 3846
455 Ga0496121_0067602 3300048924 Bacteria 2895
456 Ga0496125_0055788 3300048928 Bacteria 3215
457 Ga0496126_0025817 3300048929 Bacteria 5644
458 Ga0496126_0188469 3300048929 Bacteria 1748
459 Ga0496126_0785211 3300048929 Unclassified 732
460 Ga0495682_0025520 3300049460 Bacteria 2199
461 Ga0501032_0110178 3300049569 Bacteria 1822
462 Ga0501033_0058513 3300049570 Bacteria 2847
463 Ga0501037_0059761 3300049573 Bacteria 2780
464 Ga0501038_0086191 3300049574 Bacteria 2639
465 Ga0501043_0153112 3300049579 Bacteria 1804
466 Ga0501047_0054457 3300049581 Bacteria 3869
467 Ga0501069_0829620 3300049585 Bacteria 561
468 Ga0501035_0364426 3300049822 Bacteria 1207
469 nmdc:mga03683_105626_c1 3300050489 Bacteria 1241
470 nmdc:mga03683_18059_c1 3300050489 Bacteria 2677
471 nmdc:mga03683_189702_c1 3300050489 Bacteria 940
472 nmdc:mga03n38_15865_c1 3300050490 Bacteria 2918
473 nmdc:mga03n38_174438_c1 3300050490 Bacteria 1097
474 nmdc:mga03n38_191113_c1 3300050490 Bacteria 1055
475 nmdc:mga03n38_340407_c1 3300050490 Bacteria 814
476 nmdc:mga03n38_7752_c1 3300050490 Bacteria 3810
477 nmdc:mga00v17_138062_c1 3300050491 Bacteria 1562
478 nmdc:mga00v17_14590_c2 3300050491 Bacteria 4025
479 nmdc:mga00v17_19839_c1 3300050491 Bacteria 3844
480 nmdc:mga00v17_4622_c1 3300050491 Bacteria 7179
481 nmdc:mga0yw44_15454_c1 3300050492 Bacteria 4090
482 nmdc:mga0yw44_269799_c1 3300050492 Bacteria 1136
483 nmdc:mga0yw44_534412_c1 3300050492 Bacteria 796
484 nmdc:mga0yw44_90020_c1 3300050492 Bacteria 1938
485 nmdc:mga0k408_177522_c1 3300050493 Bacteria 1270
486 nmdc:mga0k408_40768_c1 3300050493 Bacteria 2673
487 nmdc:mga0k408_44407_c1 3300050493 Bacteria 2563
488 nmdc:mga0k408_70584_c1 3300050493 Bacteria 2038
489 nmdc:mga06z11_237598_c1 3300050494 Bacteria 1069
490 nmdc:mga06z11_40595_c1 3300050494 Bacteria 2323
491 nmdc:mga06z11_590241_c1 3300050494 Bacteria 676
492 nmdc:mga04h51_155388_c1 3300050495 Bacteria 877
493 nmdc:mga04h51_24767_c1 3300050495 Bacteria 1841
494 nmdc:mga07m45_191113_c1 3300050496 Unclassified 1191
495 nmdc:mga05p37_159736_c1 3300050507 Unclassified 2753
496 nmdc:mga05p37_643421_c1 3300050507 Bacteria 1189
497 nmdc:mga09592_130826_c1 3300050508 Bacteria 2159
498 nmdc:mga09592_340138_c1 3300050508 Bacteria 1299
499 nmdc:mga09592_544849_c1 3300050508 Unclassified 997
500 nmdc:mga0qj67_304524_c1 3300050509 Unclassified 1291
501 nmdc:mga06r32_257935_c1 3300050510 Bacteria 1731
502 nmdc:mga08y16_925691_c1 3300050511 Bacteria 856
503 nmdc:mga0n895_301468_c1 3300050512 Bacteria 1624
504 nmdc:mga0n895_64115_c1 3300050512 Bacteria 3634
505 nmdc:mga0rr50_287047_c1 3300050513 Bacteria 1374
506 nmdc:mga0rr50_388008_c1 3300050513 Bacteria 1178
507 nmdc:mga0sz30_20790_c1 3300050516 Bacteria 2650
508 nmdc:mga0sz30_36379_c1 3300050516 Bacteria 2057
509 Ga0495601_0010230 3300053077 Bacteria 5577
510 Ga0495601_0060456 3300053077 Bacteria 2404
511 Ga0495601_0151634 3300053077 Bacteria 1513
512 Ga0495601_0337679 3300053077 Bacteria 980
513 Ga0495601_0632171 3300053077 Bacteria 685
514 Ga0495612_0018838 3300053078 Bacteria 2764
515 Ga0495612_0060384 3300053078 Bacteria 1569
516 Ga0495595_0000325 3300053084 Bacteria 18606
517 Ga0495595_0056504 3300053084 Bacteria 1829
518 Ga0495595_0173589 3300053084 Bacteria 1067
519 Ga0495595_0183533 3300053084 Bacteria 1038
520 Ga0495619_0002729 3300053085 Bacteria 11534
521 Ga0495619_0030068 3300053085 Bacteria 3514
522 Ga0495619_0169252 3300053085 Bacteria 1510
523 Ga0495619_0178947 3300053085 Bacteria 1467
524 Ga0500578_0453740 3300053086 Bacteria 729
525 Ga0500651_0017082 3300053093 Bacteria 4468
526 Ga0500650_0059885 3300053098 Bacteria 1777
527 Ga0500569_177231 3300053109 Bacteria 724
528 Ga0500658_0157105 3300053134 Bacteria 1028
529 Ga0500604_0069012 3300053151 Bacteria 1124
530 Ga0500627_0164882 3300053158 Bacteria 999
531 Ga0500633_0120267 3300053160 Bacteria 977
532 Ga0500634_0106972 3300053161 Bacteria 1388
533 2728753169 2728368998 Bacteria 8720350
534 2885414965 2885409591 Bacteria 9235467
535 Ga0495638_0390867
536 JGI24739J22299_10075711
537 rootH2_10120495
538 rootL2_10046323
539 rootH1_10209999
540 Ga0065707_10189156
541 Ga0065707_10830704
542 Ga0070670_100607860
543 Ga0068869_100013799
544 Ga0070666_10115582
545 Ga0070680_100062717
546 Ga0070682_100161481
547 Ga0070682_100590539
548 Ga0068868_100022976
549 Ga0070689_100116551
550 Ga0070689_100294345
551 Ga0070687_100085648
552 Ga0070661_100193757
553 Ga0070661_100538534
554 Ga0070668_100029711
555 Ga0070669_100248856
556 Ga0070675_101034983
557 Ga0070671_101199483
558 Ga0070674_100611900
559 Ga0070673_100135249
560 Ga0070659_100499962
561 Ga0070659_100602787
562 Ga0070667_100135281
563 Ga0070710_10156894
564 Ga0070711_100329486
565 Ga0070705_100262166
566 Ga0070700_100341685
567 Ga0070708_101096504
568 Ga0070663_100020753
569 Ga0070663_100062902
570 Ga0070663_100348188
571 Ga0070678_100111161
572 Ga0070662_100016209
573 Ga0070681_10323660
574 Ga0070681_10438164
575 Ga0070681_11013462
576 Ga0068867_100326391
577 Ga0070706_100104955
578 Ga0070699_100290601
579 Ga0070697_100442674
580 Ga0068853_100138724
581 Ga0068853_100485065
582 Ga0070672_100929506
583 Ga0070672_101227228
584 Ga0070686_100666972
585 Ga0070696_100126671
586 Ga0070693_100014050
587 Ga0070693_100254177
588 Ga0070665_100076322
589 Ga0070665_100167620
590 Ga0070665_101392255
591 Ga0068855_100425048
592 Ga0070664_100244295
593 Ga0068857_100176871
594 Ga0068856_100009139
595 Ga0068856_101537564
596 Ga0070702_100285915
597 Ga0068852_100068611
598 Ga0068852_101359250
599 Ga0068859_100290258
600 Ga0068859_101029642
601 Ga0068864_100075934
602 Ga0068864_101066261
603 Ga0068861_100018587
604 Ga0068870_10083733
605 Ga0068863_100211154
606 Ga0068858_100348492
607 Ga0068860_100151681
608 Ga0068860_100613621
609 Ga0068862_100023420
610 Ga0068862_100076669
611 Ga0081455_10007349
612 Ga0081455_10016840
613 Ga0081455_10047113
614 Ga0081455_10216379
615 Ga0081455_10292953
616 Ga0081540_1002604
617 Ga0081540_1009312
618 Ga0081540_1009802
619 Ga0081540_1197570
620 Ga0081539_10049554
621 Ga0070717_10514224
622 Ga0075365_10001258
623 Ga0075365_10015050
624 Ga0075365_10031674
625 Ga0075365_10067438
626 Ga0075365_10166594
627 Ga0075365_10308375
628 Ga0075365_10446753
629 Ga0075363_100004654
630 Ga0075363_100021177
631 Ga0075363_100027483
632 Ga0075363_100051680
633 Ga0075363_100148750
634 Ga0075364_10004205
635 Ga0075364_10021037
636 Ga0075364_10044458
637 Ga0075364_10311631
638 Ga0075362_10034717
639 Ga0075362_10041218
640 Ga0075362_10095041
641 Ga0075362_10163365
642 Ga0075367_10015646
643 Ga0075367_10066363
644 Ga0075367_10068310
645 Ga0075367_10163083
646 Ga0075367_10174756
647 Ga0075369_10008318
648 Ga0075369_10085750
649 Ga0075366_10078463
650 Ga0075366_10114859
651 Ga0075366_10196141
652 Ga0075366_10324210
653 Ga0075366_10398991
654 Ga0097621_100153050
655 Ga0075370_10004812
656 Ga0075370_10106834
657 Ga0075370_10189240
658 Ga0075370_10214187
659 Ga0068871_100030886
660 Ga0068871_100622450
661 Ga0068871_100868022
662 Ga0075428_100148350
663 Ga0075428_100971623
664 Ga0075430_100319766
665 Ga0075430_100843768
666 Ga0075431_100259436
667 Ga0075431_100470382
668 Ga0075433_10528322
669 Ga0075434_100060807
670 Ga0075434_100161424
671 Ga0075434_100508357
672 Ga0075429_100070514
673 Ga0075429_100152186
674 Ga0075429_100401877
675 Ga0097620_100290220
676 Ga0097620_101029750
677 Ga0075435_100302135
678 Ga0105240_10173091
679 Ga0105240_11078226
680 Ga0111539_10289425
681 Ga0111539_12537137
682 Ga0105245_10214279
683 Ga0105245_10840463
684 Ga0105247_10016354
685 Ga0105247_10029599
686 Ga0105247_10139542
687 Ga0114129_10093449
688 Ga0114129_10667436
689 Ga0105243_10061306
690 Ga0105243_11125813
691 Ga0105241_10010704
692 Ga0105241_10359393
693 Ga0105242_10061429
694 Ga0105248_10065408
695 Ga0105248_12641099
696 Ga0105237_10695520
697 Ga0105238_10031814
698 Ga0105238_10068114
699 Ga0105238_10862155
700 Ga0105249_10012168
701 Ga0105239_10236768
702 Ga0105239_10466351
703 Ga0105246_10024178
704 Ga0105246_10092291
705 Ga0157370_10600721
706 Ga0157374_10063522
707 Ga0157378_10363336
708 Ga0163162_10541963
709 Ga0157375_10159362
710 Ga0157375_11730517
711 Ga0163163_10049500
712 Ga0163163_10164666
713 Ga0163163_10792461
714 Ga0157380_10804312
715 Ga0182008_10197289
716 Ga0157377_10082925
717 Ga0157377_10629381
718 Ga0157379_10061230
719 Ga0157376_10332730
720 Ga0157376_11621598
721 Ga0209758_1037649
722 Ga0207697_10095446
723 Ga0207710_10199751
724 Ga0207688_10062231
725 Ga0207680_10144830
726 Ga0207645_10084934
727 Ga0207643_10065274
728 Ga0207684_10731687
729 Ga0207654_10177172
730 Ga0207707_10512374
731 Ga0207671_10019603
732 Ga0207693_10311725
733 Ga0207663_10272719
734 Ga0207660_10272496
735 Ga0207660_10524854
736 Ga0207662_10068792
737 Ga0207649_10750145
738 Ga0207649_11194299
739 Ga0207694_10112648
740 Ga0207694_10602670
741 Ga0207650_10050341
742 Ga0207687_10150811
743 Ga0207644_10122730
744 Ga0207706_10023653
745 Ga0207709_10237547
746 Ga0207669_10285271
747 Ga0207691_10281954
748 Ga0207711_10037386
749 Ga0207689_10021652
750 Ga0207667_11005233
751 Ga0207712_10292823
752 Ga0207668_10027384
753 Ga0207658_10061541
754 Ga0207677_10043717
755 Ga0207703_10082354
756 Ga0207639_10119565
757 Ga0207639_10329468
758 Ga0207678_10019882
759 Ga0207678_10047488
760 Ga0207678_10392827
761 Ga0207708_10072122
762 Ga0207648_10332508
763 Ga0207676_10016706
764 Ga0207676_10953992
765 Ga0207674_10022409
766 Ga0207675_100034620
767 Ga0207683_10059791
768 Ga0209813_10132956
769 Ga0207428_10834123
770 Ga0207428_10915854
771 Ga0268266_10000807
772 Ga0268266_10025228
773 Ga0268266_10137307
774 Ga0268266_10386106
775 Ga0268265_10101873
776 Ga0268264_10720287
777 Ga0307511_10152875
778 Ga0307509_10038464
779 Ga0307509_10224955
780 Ga0307406_10663326
781 Ga0307415_100638749
782 Ga0373926_0044597
783 Ga0373926_0134216
784 Ga0373934_0024367
785 Ga0373944_0066913
786 Ga0373923_0057626
787 Ga0373923_0090955
788 Ga0373945_0006415
789 Ga0373953_0123616
790 Ga0373953_0253891
791 Ga0373954_0006034
792 Ga0373954_0010774
793 Ga0373954_0023669
794 Ga0373956_0006515
795 Ga0373956_0008179
796 Ga0373957_0146055
797 Ga0373943_0062176
798 Ga0373943_0210594
799 Ga0373943_0266686
800 Ga0373946_0353303
801 Ga0373955_0003182
802 Ga0373955_0030679
803 Ga0373924_0267350
804 Ga0373931_0526765
805 Ga0373935_0005538
806 Ga0373935_0123433
807 Ga0373927_0001649
808 Ga0373927_0191221
809 Ga0373927_0249609
810 Ga0373933_0026643
811 Ga0373933_0032878
812 Ga0373947_0042261
813 Ga0373947_0052992
814 Ga0373947_0576639
815 Ga0373937_0005546
816 Ga0373937_0006983
817 Ga0373937_0052028
818 Ga0373937_0699220
819 Ga0373937_0761619
820 Ga0373925_0001973
821 Ga0373925_0498111
822 Ga0395899_0012551
823 Ga0395900_0002116
824 Ga0395898_0004650
825 Ga0395901_0007798
826 Ga0439465_0150542
827 Ga0451853_0222781
828 Ga0451853_3673315
829 Ga0453683_1064516
830 Ga0453684_0869143
831 Ga0495592_0035111
832 Ga0495592_0036064
833 Ga0495603_0001827
834 Ga0495603_0235879
835 Ga0495590_0194822
836 Ga0495629_0001739
837 Ga0495629_0003254
838 Ga0495629_0161607
839 Ga0495629_0402474
840 Ga0495629_0842447
841 Ga0495629_1003682
842 Ga0495638_0063370
843 Ga0495641_0005678
844 Ga0495641_0077821
845 Ga0495651_0003244
846 Ga0495651_0161371
847 Ga0495653_0004181
848 Ga0495653_0078720
849 Ga0495580_0008936
850 Ga0495580_0171381
851 Ga0495582_0000547
852 Ga0495582_0267931
853 Ga0495639_0000163
854 Ga0495639_0209725
855 Ga0495662_0000616
856 Ga0495664_0059104
857 Ga0495584_0064476
858 Ga0495584_0069616
859 Ga0495584_0156486
860 Ga0495585_0290961
861 Ga0495585_0450294
862 Ga0495594_0001043
863 Ga0495594_0059673
864 Ga0495606_0063799
865 Ga0495608_0006286
866 Ga0495610_0177329
867 Ga0495628_0087389
868 Ga0495628_0119318
869 Ga0495628_0443168
870 Ga0495630_0028859
871 Ga0495630_0160413
872 Ga0495630_0238464
873 Ga0495648_0094337
874 Ga0495666_0021186
875 Ga0495666_0198845
876 Ga0495652_0005447
877 Ga0495652_0104342
878 Ga0495652_0815183
879 Ga0495665_0003016
880 Ga0495665_0163618
881 Ga0495640_0014858
882 Ga0495640_0217344
883 Ga0495587_0001343
884 Ga0495587_0006120
885 Ga0495587_0072054
886 Ga0495645_0057061
887 Ga0495645_0127346
888 Ga0495622_0003321
889 Ga0495622_0079355
890 Ga0495667_0002429
891 Ga0495667_0010384
892 Ga0495667_0201917
893 Ga0495667_0225504
894 Ga0495667_0615515
895 Ga0495656_0036291
896 Ga0495668_0173394
897 Ga0495634_0022303
898 Ga0495634_0359162
899 Ga0495611_0049917
900 Ga0495625_0080245
901 Ga0495625_0238531
902 Ga0495625_0663964
903 Ga0495635_0002402
904 Ga0495635_0008016
905 Ga0495635_0049811
906 Ga0495635_0079331
907 Ga0495635_0245021
908 Ga0495588_0134878
909 Ga0495657_0003700
910 Ga0495657_0254158
911 Ga0495599_0002232
912 Ga0495599_0022079
913 Ga0495623_0013967
914 Ga0495623_0119427
915 Ga0495646_0060133
916 Ga0495646_0193420
917 Ga0495647_0004539
918 Ga0495647_0064477
919 Ga0495658_0004596
920 Ga0495613_0004558
921 Ga0495613_0069512
922 Ga0495613_0472430
923 Ga0495624_0003121
924 Ga0495624_0194840
925 Ga0495671_0310028
926 Ga0495589_0107768
927 Ga0495589_0258903
928 Ga0495589_0422391
929 Ga0495600_0001685
930 Ga0495600_0073017
931 Ga0495581_0000979
932 Ga0495604_0003832
933 Ga0495604_0035530
934 Ga0495604_0139248
935 Ga0495674_0005950
936 Ga0495674_0811220
937 Ga0495676_0245897
938 Ga0495680_0006343
939 Ga0495680_0087296
940 Ga0495680_0295563
941 Ga0495675_0002204
942 Ga0495675_0023105
943 Ga0495673_0053048
944 Ga0495684_0003840
945 Ga0495684_0015191
946 Ga0495684_0118286
947 Ga0495686_0566327
948 Ga0495593_0006169
949 Ga0495593_0006375
950 Ga0495593_0141872
951 Ga0495602_0007101
952 Ga0495602_0176310
953 Ga0495614_0167068
954 Ga0496100_0044951
955 Ga0496100_0085230
956 Ga0496101_0170274
957 Ga0496101_0491136
958 Ga0496102_0096302
959 Ga0496102_0216331
960 Ga0496104_0197366
961 Ga0496104_0276422
962 Ga0496104_0312870
963 Ga0496105_0483021
964 Ga0496106_0014892
965 Ga0496106_0302017
966 Ga0496107_0018337
967 Ga0496107_0071392
968 Ga0496108_0001200
969 Ga0496108_0063613
970 Ga0496108_0658661
971 Ga0496109_0003922
972 Ga0496110_0019705
973 Ga0496110_0106931
974 Ga0496110_0280261
975 Ga0496111_0207923
976 Ga0496111_0276499
977 Ga0496111_0623787
978 Ga0496112_0017894
979 Ga0496112_0139107
980 Ga0496112_0995868
981 Ga0496113_0056591
982 Ga0496113_0184124
983 Ga0496113_0296031
984 Ga0496115_0031522
985 Ga0496115_0342872
986 Ga0496115_0837704
987 Ga0496119_0529848
988 Ga0496121_0044200
989 Ga0496121_0067602
990 Ga0496125_0055788
991 Ga0496126_0025817
992 Ga0496126_0188469
993 Ga0496126_0785211
994 Ga0495682_0025520
995 Ga0501032_0110178
996 Ga0501033_0058513
997 Ga0501037_0059761
998 Ga0501038_0086191
999 Ga0501043_0153112
1000 Ga0501047_0054457
1001 Ga0501069_0829620
1002 Ga0501035_0364426
1003 nmdc:mga03683_105626_c1
1004 nmdc:mga03683_18059_c1
1005 nmdc:mga03683_189702_c1
1006 nmdc:mga03n38_15865_c1
1007 nmdc:mga03n38_174438_c1
1008 nmdc:mga03n38_191113_c1
1009 nmdc:mga03n38_340407_c1
1010 nmdc:mga03n38_7752_c1
1011 nmdc:mga00v17_138062_c1
1012 nmdc:mga00v17_14590_c2
1013 nmdc:mga00v17_19839_c1
1014 nmdc:mga00v17_4622_c1
1015 nmdc:mga0yw44_15454_c1
1016 nmdc:mga0yw44_269799_c1
1017 nmdc:mga0yw44_534412_c1
1018 nmdc:mga0yw44_90020_c1
1019 nmdc:mga0k408_177522_c1
1020 nmdc:mga0k408_40768_c1
1021 nmdc:mga0k408_44407_c1
1022 nmdc:mga0k408_70584_c1
1023 nmdc:mga06z11_237598_c1
1024 nmdc:mga06z11_40595_c1
1025 nmdc:mga06z11_590241_c1
1026 nmdc:mga04h51_155388_c1
1027 nmdc:mga04h51_24767_c1
1028 nmdc:mga07m45_191113_c1
1029 nmdc:mga05p37_159736_c1
1030 nmdc:mga05p37_643421_c1
1031 nmdc:mga09592_130826_c1
1032 nmdc:mga09592_340138_c1
1033 nmdc:mga09592_544849_c1
1034 nmdc:mga0qj67_304524_c1
1035 nmdc:mga06r32_257935_c1
1036 nmdc:mga08y16_925691_c1
1037 nmdc:mga0n895_301468_c1
1038 nmdc:mga0n895_64115_c1
1039 nmdc:mga0rr50_287047_c1
1040 nmdc:mga0rr50_388008_c1
1041 nmdc:mga0sz30_20790_c1
1042 nmdc:mga0sz30_36379_c1
1043 Ga0495601_0010230
1044 Ga0495601_0060456
1045 Ga0495601_0151634
1046 Ga0495601_0337679
1047 Ga0495601_0632171
1048 Ga0495612_0018838
1049 Ga0495612_0060384
1050 Ga0495595_0000325
1051 Ga0495595_0056504
1052 Ga0495595_0173589
1053 Ga0495595_0183533
1054 Ga0495619_0002729
1055 Ga0495619_0030068
1056 Ga0495619_0169252
1057 Ga0495619_0178947
1058 Ga0500578_0453740
1059 Ga0500651_0017082
1060 Ga0500650_0059885
1061 Ga0500569_177231
1062 Ga0500658_0157105
1063 Ga0500604_0069012
1064 Ga0500627_0164882
1065 Ga0500633_0120267
1066 Ga0500634_0106972
1067 2728753169
1068 2885414965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

89

144

0.95

PF00571

CBS

CBS domain

23

79

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9751 16 139
2rc3-assembly1.cif.gz_D crystal structure of cbs domain, ne2398 0.9664 16 139
4fry-assembly1.cif.gz_A the structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 0.9639 16 140
3fhm-assembly2.cif.gz_B crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9449 16 138
3fhm-assembly2.cif.gz_C crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9394 16 136
ID Description Score Start End Superfamily
2rc3D00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9664 16 139 3.10.580.10
4fryA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9639 16 140 3.10.580.10
af_Q75K17_104_256_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9529 16 151 3.10.580.10
af_O13965_237_391_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9496 16 138 3.10.580.10
af_Q58629_165_294_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9489 28 141 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A7C5PZW3-F1-model_v4 CBS domain-containing protein 0.9833 16 152
AF-A0A7X5W3V7-F1-model_v4 deleted 0.981 16 152
AF-A0A3M2HL61-F1-model_v4 CBS domain-containing protein 0.9808 15 152
AF-A0A849DVE7-F1-model_v4 CBS domain-containing protein 0.9808 16 152
AF-A0A2V8ULT0-F1-model_v4 Signal transduction protein 0.979 16 150

Map