F460474

General Info

Members Datasets Scaffolds Average Seq Length
533 313 1066 319

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_19344_c1|nmdc:mga00v17_19344_c1_1067_2110
Length 347
Sequence VVRPERTGPEEKSDMSNVVVTGGYGFVGSHLVTALLARGDSVTVFDFAKNTHDTSIDFDRHPHFRFVQGDVTDLTALEAAVTADVDTVFHLASVVGVNKYVEDPLRVVDVSVTGTRNVLELCHRHGARVVFTSTSEVYGKNPATPWAEDDDRVVGSTRTARWSYSTSKAMAEHMVFGMHDAYGLPVTVVRFFNVYGPRQNPIFVISKSIHRILNGREPLLYDSGDQTRCFTYVDDAVAGTLLAADSDGAIGQVFNIGSMTETTMRDAVDLAIKIAKVDSVSTTAAFDSAKRYGASYEDIPRRVPDSTKAQRELGWRLEVDLEEGLRRTIEWARANPWYLKESGDDPS

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
168 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
169 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
170 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
259 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
266 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
267 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
268 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
269 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
270 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
271 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
272 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
273 2643221729 Bacillus sp. Root11 Isolate Unclassified
274 2643221730 Bacillus sp. Root131 Isolate Unclassified
275 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
276 2684622632 Bacillus cereus 905 Isolate Unclassified
277 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
278 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
279 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
280 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
281 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
282 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
283 2738541358 Bacillus sp. OV752 Isolate Unclassified
284 2738543006 Bacillus sp. OK077 Isolate Unclassified
285 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
286 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
287 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
288 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
289 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
290 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
291 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
292 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
293 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
294 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
295 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
296 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
297 2938917290 Bacillus sp. CR71 Isolate Unclassified
298 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
299 2965761152 Bacillus sp. COPE52 Isolate Unclassified
300 2969141011 Bacillus velezensis MH25 Isolate Unclassified
301 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
302 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
303 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
304 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
305 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
306 8023438354 Bacillus sp. BH2 Isolate Unclassified
307 8023444577 Bacillus sp. BH32 Isolate Unclassified
308 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
309 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
310 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
311 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
312 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
313 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.81
Metatranscriptomes 0
Isolates 9.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.38
Nodule 0
Rhizoplane 4.13
Rhizosphere 82.74
Stem 0
Stem Tuber 0
Unclassified 5.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_19344_c1 3300050491 Bacteria 3886
2 MRS1b_contig_1885129 2162886011 Bacteria 1409
3 JGI25159J45721_1001285 3300002987 Bacteria 10600
4 JGI25159J45721_1009786 3300002987 Bacteria 2500
5 JGI25159J45721_1012695 3300002987 Bacteria 1994
6 JGI25151J46595_10004393 3300003187 Bacteria 7471
7 JGI25151J46595_10005289 3300003187 Bacteria 6686
8 JGI25151J46595_10008871 3300003187 Bacteria 4804
9 JGI25151J46595_10012228 3300003187 Bacteria 3911
10 Ga0065712_10070278 3300005290 Bacteria 6154
11 Ga0065712_10131857 3300005290 Bacteria 1536
12 Ga0065715_10017944 3300005293 Bacteria 2196
13 Ga0065715_10154387 3300005293 Bacteria 1693
14 Ga0065707_10121459 3300005295 Unclassified 2110
15 Ga0065707_10166403 3300005295 Bacteria 1513
16 Ga0070676_10001529 3300005328 Bacteria 11698
17 Ga0070676_10043539 3300005328 Bacteria 2609
18 Ga0070683_100020565 3300005329 Bacteria 5873
19 Ga0070683_100224643 3300005329 Bacteria 1785
20 Ga0070670_100022748 3300005331 Bacteria 5394
21 Ga0070666_10015331 3300005335 Bacteria 4887
22 Ga0070666_10036683 3300005335 Bacteria 3256
23 Ga0070666_10154027 3300005335 Bacteria 1604
24 Ga0070680_100050062 3300005336 Unclassified 3407
25 Ga0070682_100174800 3300005337 Bacteria 1495
26 Ga0070689_100122853 3300005340 Unclassified 2075
27 Ga0070691_10007116 3300005341 Bacteria 5131
28 Ga0070687_100055999 3300005343 Bacteria 2062
29 Ga0070668_100096502 3300005347 Bacteria 2336
30 Ga0070669_100001159 3300005353 Bacteria 19254
31 Ga0070669_100111819 3300005353 Bacteria 2073
32 Ga0070669_100235935 3300005353 Bacteria 1451
33 Ga0070669_100358057 3300005353 Bacteria 1186
34 Ga0070675_100030153 3300005354 Unclassified 4377
35 Ga0070671_100016979 3300005355 Bacteria 5886
36 Ga0070671_100039446 3300005355 Bacteria 3920
37 Ga0070671_100143672 3300005355 Bacteria 2014
38 Ga0070671_100371079 3300005355 Bacteria 1222
39 Ga0070674_100006041 3300005356 Bacteria 7040
40 Ga0070674_100038991 3300005356 Bacteria 3206
41 Ga0070674_100187771 3300005356 Bacteria 1587
42 Ga0070674_100290450 3300005356 Bacteria 1300
43 Ga0070688_100031178 3300005365 Bacteria 3206
44 Ga0070659_100065670 3300005366 Bacteria 2874
45 Ga0070667_100062356 3300005367 Bacteria 3158
46 Ga0070667_100311387 3300005367 Bacteria 1419
47 Ga0070714_100000076 3300005435 Bacteria 84569
48 Ga0070713_100088633 3300005436 Unclassified 2656
49 Ga0070701_10057035 3300005438 Bacteria 2046
50 Ga0070711_100314921 3300005439 Unclassified 1248
51 Ga0070711_100425568 3300005439 Bacteria 1083
52 Ga0070705_100018149 3300005440 Bacteria 3683
53 Ga0070700_100011570 3300005441 Bacteria 4891
54 Ga0070700_100175198 3300005441 Bacteria 1488
55 Ga0070694_100212288 3300005444 Bacteria 1448
56 Ga0070708_100208264 3300005445 Bacteria 1832
57 Ga0070663_100014145 3300005455 Bacteria 5115
58 Ga0070678_100009398 3300005456 Bacteria 5922
59 Ga0070662_100180025 3300005457 Bacteria 1666
60 Ga0070681_10496956 3300005458 Bacteria 1133
61 Ga0068867_100008739 3300005459 Bacteria 7150
62 Ga0070706_100326608 3300005467 Unclassified 1431
63 Ga0070706_100424213 3300005467 Bacteria 1238
64 Ga0070707_100250191 3300005468 Bacteria 1725
65 Ga0070699_100066475 3300005518 Bacteria 3130
66 Ga0070699_100147999 3300005518 Unclassified 2076
67 Ga0070699_100261641 3300005518 Bacteria 1547
68 Ga0070699_100300665 3300005518 Bacteria 1440
69 Ga0070699_100380105 3300005518 Bacteria 1275
70 Ga0070684_100000084 3300005535 Bacteria 61595
71 Ga0070697_100053325 3300005536 Bacteria 3287
72 Ga0070697_100366029 3300005536 Bacteria 1247
73 Ga0070697_100474226 3300005536 Bacteria 1092
74 Ga0070672_100107341 3300005543 Bacteria 2272
75 Ga0070672_100188707 3300005543 Bacteria 1720
76 Ga0070686_100018843 3300005544 Bacteria 4058
77 Ga0070686_100028671 3300005544 Bacteria 3378
78 Ga0070686_100243634 3300005544 Bacteria 1310
79 Ga0070695_100001395 3300005545 Bacteria 13393
80 Ga0070696_100002228 3300005546 Bacteria 12776
81 Ga0070696_100013727 3300005546 Bacteria 5440
82 Ga0070696_100056000 3300005546 Bacteria 2750
83 Ga0070704_100049966 3300005549 Bacteria 2937
84 Ga0070704_100139043 3300005549 Bacteria 1893
85 Ga0070704_100219848 3300005549 Bacteria 1544
86 Ga0070704_100236136 3300005549 Bacteria 1494
87 Ga0068855_100024725 3300005563 Bacteria 7186
88 Ga0070664_100000177 3300005564 Bacteria 44970
89 Ga0068854_100019967 3300005578 Bacteria 4523
90 Ga0070702_100016052 3300005615 Bacteria 3836
91 Ga0068859_100573768 3300005617 Bacteria 1222
92 Ga0068864_100036284 3300005618 Bacteria 4201
93 Ga0068864_100469466 3300005618 Bacteria 1206
94 Ga0068864_100520838 3300005618 Bacteria 1146
95 Ga0068866_10124040 3300005718 Bacteria 1459
96 Ga0068861_100090193 3300005719 Bacteria 2417
97 Ga0068861_100105320 3300005719 Bacteria 2252
98 Ga0068861_100109766 3300005719 Bacteria 2209
99 Ga0068870_10102202 3300005840 Bacteria 1622
100 Ga0068863_100286451 3300005841 Bacteria 1597
101 Ga0068858_100201871 3300005842 Bacteria 1880
102 Ga0068860_100208838 3300005843 Bacteria 1894
103 Ga0068860_100242392 3300005843 Bacteria 1754
104 Ga0068860_100387257 3300005843 Bacteria 1381
105 Ga0068862_100012312 3300005844 Bacteria 7073
106 Ga0068862_100035433 3300005844 Bacteria 4226
107 Ga0068862_100038548 3300005844 Bacteria 4053
108 Ga0068862_100045614 3300005844 Unclassified 3740
109 Ga0068862_100252826 3300005844 Bacteria 1607
110 Ga0081538_10010627 3300005981 Bacteria 7534
111 Ga0081539_10036381 3300005985 Bacteria 2947
112 Ga0081539_10071082 3300005985 Bacteria 1865
113 Ga0070717_10084140 3300006028 Bacteria 2676
114 Ga0075365_10170012 3300006038 Bacteria 1521
115 Ga0075364_10006660 3300006051 Bacteria 6810
116 Ga0075364_10073939 3300006051 Archaea 2247
117 Ga0075364_10113886 3300006051 Bacteria 1807
118 Ga0070716_100019267 3300006173 Bacteria 3564
119 Ga0075362_10067182 3300006177 Bacteria 1631
120 Ga0075367_10006394 3300006178 Bacteria 5950
121 Ga0075366_10039350 3300006195 Bacteria 2796
122 Ga0097621_100032668 3300006237 Bacteria 4139
123 Ga0068871_100006797 3300006358 Bacteria 8130
124 Ga0075428_100014331 3300006844 Bacteria 8813
125 Ga0075428_100026365 3300006844 Bacteria 6433
126 Ga0075428_100045938 3300006844 Bacteria 4798
127 Ga0075428_100102082 3300006844 Bacteria 3127
128 Ga0075428_100121651 3300006844 Bacteria 2842
129 Ga0075428_100412403 3300006844 Archaea 1447
130 Ga0075430_100059040 3300006846 Unclassified 3224
131 Ga0075430_100177821 3300006846 Bacteria 1770
132 Ga0075430_100437389 3300006846 Archaea 1080
133 Ga0075431_100005672 3300006847 Bacteria 12342
134 Ga0075431_100025029 3300006847 Bacteria 6119
135 Ga0075431_100036203 3300006847 Bacteria 5083
136 Ga0075431_100121722 3300006847 Bacteria 2692
137 Ga0075431_100252778 3300006847 Bacteria 1790
138 Ga0075431_100332116 3300006847 Unclassified 1531
139 Ga0075433_10000165 3300006852 Bacteria 36232
140 Ga0075433_10002186 3300006852 Bacteria 14820
141 Ga0075433_10027328 3300006852 Bacteria 4838
142 Ga0075433_10030734 3300006852 Bacteria 4585
143 Ga0075433_10192551 3300006852 Bacteria 1814
144 Ga0075433_10257036 3300006852 Bacteria 1549
145 Ga0075434_100002048 3300006871 Bacteria 17501
146 Ga0075434_100006067 3300006871 Bacteria 11052
147 Ga0075434_100036054 3300006871 Bacteria 4891
148 Ga0075434_100087790 3300006871 Bacteria 3111
149 Ga0075434_100092742 3300006871 Bacteria 3023
150 Ga0075434_100171959 3300006871 Bacteria 2186
151 Ga0075429_100019914 3300006880 Bacteria 5818
152 Ga0075429_100047944 3300006880 Unclassified 3715
153 Ga0075429_100049131 3300006880 Bacteria 3668
154 Ga0075429_100115418 3300006880 Bacteria 2347
155 Ga0075429_100239827 3300006880 Bacteria 1588
156 Ga0068865_100062332 3300006881 Bacteria 2617
157 Ga0075436_100000960 3300006914 Bacteria 19340
158 Ga0075436_100001502 3300006914 Bacteria 15906
159 Ga0075436_100005838 3300006914 Bacteria 8453
160 Ga0075436_100093442 3300006914 Bacteria 2091
161 Ga0097620_100573859 3300006931 Bacteria 1222
162 Ga0075435_100000200 3300007076 Bacteria 35997
163 Ga0075435_100000623 3300007076 Bacteria 21789
164 Ga0075435_100003467 3300007076 Bacteria 10698
165 Ga0075435_100015230 3300007076 Bacteria 5776
166 Ga0075435_100063870 3300007076 Bacteria 2990
167 Ga0099794_10005597 3300007265 Bacteria 5050
168 Ga0099794_10185225 3300007265 Bacteria 1063
169 Ga0105251_10003451 3300009011 Bacteria 11471
170 Ga0105244_10003509 3300009036 Bacteria 11140
171 Ga0105244_10030791 3300009036 Bacteria 2852
172 Ga0105244_10046550 3300009036 Bacteria 2228
173 Ga0105250_10002199 3300009092 Bacteria 9950
174 Ga0105250_10004105 3300009092 Bacteria 6759
175 Ga0105240_10155742 3300009093 Bacteria 2718
176 Ga0111539_10001317 3300009094 Bacteria 33152
177 Ga0111539_10005326 3300009094 Bacteria 16650
178 Ga0111539_10005841 3300009094 Bacteria 15910
179 Ga0111539_10034170 3300009094 Bacteria 6169
180 Ga0111539_10042971 3300009094 Bacteria 5422
181 Ga0111539_10045884 3300009094 Bacteria 5229
182 Ga0111539_10131699 3300009094 Bacteria 2928
183 Ga0111539_10328380 3300009094 Bacteria 1780
184 Ga0105245_10033359 3300009098 Bacteria 4563
185 Ga0105245_10399727 3300009098 Bacteria 1373
186 Ga0105247_10009538 3300009101 Bacteria 5891
187 Ga0114129_10000186 3300009147 Bacteria 69381
188 Ga0114129_10007736 3300009147 Bacteria 15292
189 Ga0114129_10008891 3300009147 Bacteria 14320
190 Ga0114129_10013713 3300009147 Bacteria 11550
191 Ga0114129_10092062 3300009147 Bacteria 4200
192 Ga0114129_10100957 3300009147 Bacteria 3992
193 Ga0114129_10300296 3300009147 Bacteria 2140
194 Ga0114129_10315872 3300009147 Bacteria 2078
195 Ga0105243_10228580 3300009148 Bacteria 1649
196 Ga0105241_10427493 3300009174 Bacteria 1167
197 Ga0105242_10072924 3300009176 Bacteria 2853
198 Ga0105242_10236867 3300009176 Bacteria 1639
199 Ga0105248_10005522 3300009177 Bacteria 13886
200 Ga0105248_10011952 3300009177 Bacteria 9575
201 Ga0105248_10135934 3300009177 Bacteria 2773
202 Ga0105248_10140260 3300009177 Bacteria 2727
203 Ga0105249_10369034 3300009553 Bacteria 1458
204 Ga0105249_10602872 3300009553 Bacteria 1153
205 Ga0105239_10174799 3300010375 Bacteria 2402
206 Ga0105246_10121091 3300011119 Unclassified 1939
207 Ga0157375_10592661 3300013308 Bacteria 1268
208 Ga0163163_10013572 3300014325 Bacteria 7462
209 Ga0163163_10041689 3300014325 Bacteria 4491
210 Ga0157380_10076518 3300014326 Bacteria 2724
211 Ga0157380_10339348 3300014326 Bacteria 1401
212 Ga0157379_10119719 3300014968 Bacteria 2368
213 Ga0157379_10299004 3300014968 Bacteria 1467
214 Ga0213873_10023414 3300021358 Bacteria 1472
215 Ga0213876_10061523 3300021384 Bacteria 1981
216 Ga0209147_100427 3300025229 Bacteria 27385
217 Ga0209147_105116 3300025229 Bacteria 2022
218 Ga0209130_1000781 3300025284 Bacteria 27446
219 Ga0209130_1001629 3300025284 Bacteria 13820
220 Ga0209130_1002631 3300025284 Bacteria 8625
221 Ga0209025_1000540 3300025294 Bacteria 71185
222 Ga0209025_1000677 3300025294 Bacteria 58481
223 Ga0209025_1002080 3300025294 Bacteria 22703
224 Ga0209025_1004929 3300025294 Bacteria 11220
225 Ga0209025_1006248 3300025294 Bacteria 9332
226 Ga0209025_1028908 3300025294 Bacteria 2699
227 Ga0207696_1000591 3300025711 Bacteria 27664
228 Ga0207696_1010563 3300025711 Bacteria 3377
229 Ga0207696_1025062 3300025711 Bacteria 1864
230 Ga0207655_1006044 3300025728 Bacteria 8093
231 Ga0207655_1052042 3300025728 Bacteria 1650
232 Ga0207713_1014154 3300025735 Bacteria 4161
233 Ga0207682_10091763 3300025893 Bacteria 1318
234 Ga0207682_10175784 3300025893 Bacteria 976
235 Ga0207680_10011266 3300025903 Bacteria 4512
236 Ga0207680_10048934 3300025903 Bacteria 2513
237 Ga0207680_10096973 3300025903 Bacteria 1887
238 Ga0207680_10116029 3300025903 Bacteria 1744
239 Ga0207699_10248839 3300025906 Bacteria 1224
240 Ga0207645_10019006 3300025907 Bacteria 4512
241 Ga0207645_10149094 3300025907 Bacteria 1526
242 Ga0207643_10105597 3300025908 Bacteria 1655
243 Ga0207684_10411339 3300025910 Bacteria 1163
244 Ga0207695_10033810 3300025913 Bacteria 5569
245 Ga0207695_10482363 3300025913 Bacteria 1122
246 Ga0207662_10003913 3300025918 Bacteria 7760
247 Ga0207662_10040474 3300025918 Bacteria 2740
248 Ga0207646_10008874 3300025922 Bacteria 10014
249 Ga0207646_10129201 3300025922 Bacteria 2273
250 Ga0207646_10138026 3300025922 Bacteria 2196
251 Ga0207646_10173450 3300025922 Unclassified 1947
252 Ga0207681_10048218 3300025923 Bacteria 2874
253 Ga0207681_10048311 3300025923 Bacteria 2871
254 Ga0207681_10147778 3300025923 Bacteria 1758
255 Ga0207650_10069325 3300025925 Bacteria 2649
256 Ga0207650_10117590 3300025925 Bacteria 2066
257 Ga0207659_10031838 3300025926 Unclassified 3614
258 Ga0207687_10273801 3300025927 Bacteria 1350
259 Ga0207664_10000335 3300025929 Bacteria 34750
260 Ga0207706_10217169 3300025933 Bacteria 1675
261 Ga0207706_10247080 3300025933 Bacteria 1559
262 Ga0207686_10114792 3300025934 Bacteria 1823
263 Ga0207709_10102290 3300025935 Bacteria 1897
264 Ga0207704_10099348 3300025938 Bacteria 1936
265 Ga0207691_10119173 3300025940 Bacteria 2341
266 Ga0207691_10183682 3300025940 Bacteria 1826
267 Ga0207691_10245464 3300025940 Bacteria 1547
268 Ga0207711_10009215 3300025941 Bacteria 8243
269 Ga0207711_10057559 3300025941 Bacteria 3342
270 Ga0207711_10397147 3300025941 Bacteria 1281
271 Ga0207689_10035560 3300025942 Bacteria 4138
272 Ga0207661_10013822 3300025944 Bacteria 5901
273 Ga0207661_10196082 3300025944 Bacteria 1773
274 Ga0207679_10058807 3300025945 Bacteria 2850
275 Ga0207679_10110081 3300025945 Unclassified 2172
276 Ga0207667_10540549 3300025949 Bacteria 1179
277 Ga0207712_10084859 3300025961 Bacteria 2315
278 Ga0207712_10231701 3300025961 Unclassified 1483
279 Ga0207668_10088326 3300025972 Bacteria 2270
280 Ga0207640_10114041 3300025981 Bacteria 1922
281 Ga0207640_10131596 3300025981 Bacteria 1809
282 Ga0207658_10042374 3300025986 Bacteria 3302
283 Ga0207658_10266641 3300025986 Bacteria 1462
284 Ga0207703_10027933 3300026035 Bacteria 4443
285 Ga0207678_10027295 3300026067 Bacteria 4979
286 Ga0207708_10001907 3300026075 Bacteria 15412
287 Ga0207708_10002265 3300026075 Bacteria 14172
288 Ga0207708_10065565 3300026075 Bacteria 2776
289 Ga0207708_10127601 3300026075 Bacteria 1986
290 Ga0207648_10010632 3300026089 Bacteria 8701
291 Ga0207648_10135624 3300026089 Bacteria 2168
292 Ga0207676_10037586 3300026095 Bacteria 3690
293 Ga0207674_10118940 3300026116 Unclassified 2612
294 Ga0207675_100019356 3300026118 Bacteria 6351
295 Ga0207675_100099386 3300026118 Bacteria 2740
296 Ga0207675_100100489 3300026118 Bacteria 2725
297 Ga0207683_10207639 3300026121 Bacteria 1782
298 Ga0207683_10252832 3300026121 Bacteria 1608
299 Ga0207428_10006036 3300027907 Bacteria 11204
300 Ga0207428_10038780 3300027907 Bacteria 3871
301 Ga0207428_10132386 3300027907 Bacteria 1907
302 Ga0268266_10008440 3300028379 Bacteria 9158
303 Ga0268265_10090843 3300028380 Bacteria 2440
304 Ga0268265_10197885 3300028380 Bacteria 1740
305 Ga0268264_10327893 3300028381 Bacteria 1450
306 Ga0268264_10449465 3300028381 Bacteria 1248
307 Ga0265318_10023005 3300028577 Unclassified 2487
308 Ga0237817_10017 3300030083 Bacteria 68499
309 Ga0237817_10207 3300030083 Bacteria 15530
310 Ga0265330_10031861 3300031235 Bacteria 2363
311 Ga0265332_10000237 3300031238 Bacteria 43903
312 Ga0265325_10009898 3300031241 Bacteria 5547
313 Ga0265329_10004961 3300031242 Bacteria 5448
314 Ga0265339_10000198 3300031249 Bacteria 49802
315 Ga0265331_10000336 3300031250 Bacteria 50300
316 Ga0265316_10000347 3300031344 Bacteria 51995
317 Ga0265316_10038809 3300031344 Bacteria 3832
318 Ga0307513_10016795 3300031456 Bacteria 8808
319 Ga0265314_10000494 3300031711 Bacteria 51177
320 Ga0265314_10000793 3300031711 Bacteria 37530
321 Ga0265342_10003572 3300031712 Bacteria 12708
322 Ga0265342_10009587 3300031712 Bacteria 6801
323 Ga0316576_10103503 3300031727 Bacteria 2130
324 Ga0307413_10000125 3300031824 Bacteria 19886
325 Ga0307410_10069994 3300031852 Unclassified 2429
326 Ga0307409_100465643 3300031995 Bacteria 1223
327 Ga0307415_100203634 3300032126 Bacteria 1573
328 Ga0373950_0001360 3300034818 Bacteria 3174
329 Ga0373959_0021679 3300034820 Bacteria 1235
330 Ga0373938_0001382 3300034957 Bacteria 3881
331 Ga0373928_0000854 3300035084 Bacteria 5983
332 Ga0373929_0007379 3300035085 Bacteria 2006
333 Ga0373940_0008175 3300035088 Bacteria 2392
334 Ga0373944_0075357 3300035089 Bacteria 1106
335 Ga0373949_0026306 3300035090 Bacteria 1362
336 Ga0373939_0001273 3300035114 Bacteria 6147
337 Ga0373941_0000390 3300035115 Bacteria 8723
338 Ga0373945_0040134 3300035116 Bacteria 1689
339 Ga0373960_0002494 3300035121 Bacteria 4139
340 Ga0373943_0001254 3300035170 Bacteria 11354
341 Ga0373943_0046969 3300035170 Bacteria 2109
342 Ga0373942_0000066 3300035207 Bacteria 21966
343 Ga0373961_0002961 3300035241 Bacteria 4291
344 Ga0373961_0054273 3300035241 Bacteria 1198
345 Ga0316574_0083973 3300035398 Bacteria 2025
346 Ga0373931_0001723 3300035691 Bacteria 9477
347 Ga0373935_0011677 3300035692 Bacteria 5275
348 Ga0373927_0098863 3300035695 Bacteria 1897
349 Ga0316584_0144991 3300036712 Bacteria 1769
350 Ga0373925_0011896 3300037068 Bacteria 6298
351 Ga0237819_00031 3300038705 Bacteria 48525
352 Ga0237819_01125 3300038705 Bacteria 7785
353 Ga0436365_0539475 3300039437 Bacteria 2019
354 Ga0436365_1285903 3300039437 Bacteria 4141
355 Ga0436361_0482933 3300039447 Bacteria 1457
356 Ga0436362_0535802 3300039453 Bacteria 1853
357 Ga0439450_001354 3300042008 Bacteria 3563
358 Ga0439446_0052212 3300042156 Bacteria 1223
359 Ga0439464_0037166 3300042439 Bacteria 1380
360 Ga0439460_0044472 3300042461 Bacteria 1315
361 Ga0439440_0032788 3300042993 Bacteria 1235
362 Ga0466966_0009025 3300044684 Bacteria 6608
363 Ga0466961_0021424 3300044693 Bacteria 4160
364 Ga0466968_0009593 3300044735 Bacteria 3727
365 Ga0466970_0043423 3300044765 Bacteria 2392
366 Ga0466957_0019468 3300044842 Bacteria 3993
367 Ga0466959_0001917 3300045049 Bacteria 13083
368 Ga0451576_0123528 3300045051 Bacteria 2696
369 Ga0466958_0003988 3300045836 Bacteria 7737
370 Ga0466967_0001610 3300045976 Bacteria 13319
371 Ga0466967_0036859 3300045976 Bacteria 4179
372 Ga0466967_0113908 3300045976 Bacteria 2489
373 Ga0466967_0289340 3300045976 Bacteria 1574
374 Ga0495638_0025947 3300046460 Bacteria 3804
375 Ga0495653_0152032 3300046463 Bacteria 1616
376 Ga0495580_0014226 3300046472 Bacteria 6041
377 Ga0495639_0030619 3300046475 Bacteria 2392
378 Ga0495639_0080497 3300046475 Unclassified 1516
379 Ga0495608_0002043 3300046511 Bacteria 14503
380 Ga0495618_0024250 3300046514 Unclassified 3755
381 Ga0495628_0073752 3300046516 Unclassified 2659
382 Ga0495630_0055506 3300046517 Bacteria 2968
383 Ga0495640_0091097 3300046533 Bacteria 2012
384 Ga0495586_0066514 3300046535 Bacteria 1965
385 Ga0495587_0102151 3300046536 Bacteria 1651
386 Ga0495645_0001898 3300046543 Bacteria 14206
387 Ga0495667_0167966 3300046559 Bacteria 1410
388 Ga0495634_0054704 3300046642 Bacteria 2670
389 Ga0495635_0157661 3300046663 Bacteria 1545
390 Ga0495647_0051772 3300046681 Bacteria 1597
391 Ga0495613_0001654 3300046689 Bacteria 16971
392 Ga0495674_0073128 3300047319 Bacteria 2956
393 Ga0495680_0046927 3300047322 Bacteria 3403
394 Ga0496100_0004749 3300048903 Bacteria 7247
395 Ga0496101_0002157 3300048904 Bacteria 12017
396 Ga0496101_0300541 3300048904 Bacteria 1257
397 Ga0496102_0251016 3300048905 Bacteria 1668
398 Ga0496104_0001005 3300048907 Bacteria 24151
399 Ga0496104_0002447 3300048907 Bacteria 15987
400 Ga0496104_0193451 3300048907 Bacteria 1946
401 Ga0496104_0243927 3300048907 Bacteria 1709
402 Ga0496105_0012918 3300048908 Bacteria 6619
403 Ga0496105_0277876 3300048908 Bacteria 1351
404 Ga0496106_0004451 3300048909 Bacteria 10388
405 Ga0496106_0231257 3300048909 Bacteria 1476
406 Ga0496108_0000350 3300048911 Bacteria 38965
407 Ga0496108_0079968 3300048911 Bacteria 2768
408 Ga0496109_0000257 3300048912 Bacteria 51399
409 Ga0496110_0000390 3300048913 Bacteria 29574
410 Ga0496111_0002799 3300048914 Bacteria 10626
411 Ga0496112_0002169 3300048915 Bacteria 15596
412 Ga0496112_0005794 3300048915 Bacteria 10748
413 Ga0496114_0001406 3300048917 Bacteria 18262
414 Ga0496114_0105459 3300048917 Bacteria 2411
415 Ga0496114_0454473 3300048917 Bacteria 1134
416 Ga0496118_0000572 3300048921 Bacteria 61029
417 Ga0496126_0016979 3300048929 Bacteria 7261
418 Ga0501299_015850 3300049522 Bacteria 1328
419 Ga0501036_0178338 3300049572 Bacteria 1789
420 Ga0501040_0289475 3300049576 Bacteria 1170
421 Ga0501048_0286545 3300049582 Bacteria 1171
422 Ga0501048_0314746 3300049582 Bacteria 1115
423 Ga0501070_0079964 3300049586 Bacteria 2705
424 Ga0501076_0387551 3300049592 Bacteria 1149
425 Ga0501035_0167937 3300049822 Bacteria 1897
426 Ga0501045_0024705 3300049824 Bacteria 4315
427 nmdc:mga03683_63440_c1 3300050489 Bacteria 1566
428 nmdc:mga00v17_55121_c1 3300050491 Bacteria 2427
429 nmdc:mga00v17_62473_c1 3300050491 Archaea 2291
430 nmdc:mga05p37_1386_c1 3300050507 Bacteria 28194
431 nmdc:mga05p37_14584_c1 3300050507 Bacteria 9438
432 nmdc:mga05p37_153228_c1 3300050507 Unclassified 2818
433 nmdc:mga05p37_447883_c1 3300050507 Bacteria 1495
434 nmdc:mga05p37_54647_c1 3300050507 Bacteria 4912
435 nmdc:mga05p37_6847_c1 3300050507 Bacteria 13437
436 nmdc:mga05p37_731_c1 3300050507 Bacteria 27405
437 nmdc:mga09592_123147_c1 3300050508 Unclassified 2228
438 nmdc:mga09592_248242_c1 3300050508 Bacteria 1542
439 nmdc:mga0qj67_24229_c1 3300050509 Bacteria 4677
440 nmdc:mga06r32_21270_c1 3300050510 Bacteria 5987
441 nmdc:mga06r32_573_c3 3300050510 Bacteria 13354
442 nmdc:mga06r32_97072_c1 3300050510 Unclassified 2887
443 nmdc:mga08y16_2225_c1 3300050511 Bacteria 19866
444 nmdc:mga08y16_22961_c1 3300050511 Bacteria 6586
445 nmdc:mga08y16_2702_c1 3300050511 Bacteria 9795
446 nmdc:mga08y16_289061_c1 3300050511 Bacteria 1690
447 nmdc:mga08y16_31230_c2 3300050511 Bacteria 5147
448 nmdc:mga08y16_616141_c1 3300050511 Bacteria 1093
449 nmdc:mga08y16_6411_c1 3300050511 Bacteria 12336
450 nmdc:mga08y16_68268_c1 3300050511 Bacteria 3706
451 nmdc:mga0n895_12247_c1 3300050512 Bacteria 7686
452 nmdc:mga0n895_148883_c1 3300050512 Bacteria 2370
453 nmdc:mga0n895_17619_c1 3300050512 Bacteria 6588
454 nmdc:mga0n895_47791_c1 3300050512 Bacteria 4186
455 nmdc:mga0n895_5183_c1 3300050512 Bacteria 10846
456 nmdc:mga0rr50_144980_c1 3300050513 Unclassified 1913
457 nmdc:mga0rr50_169385_c1 3300050513 Archaea 1778
458 nmdc:mga0rr50_169864_c1 3300050513 Unclassified 1776
459 nmdc:mga0rr50_2007_c1 3300050513 Bacteria 11330
460 nmdc:mga0rr50_237798_c1 3300050513 Bacteria 1509
461 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
462 nmdc:mga08x19_11756_c1 3300050514 Bacteria 5271
463 nmdc:mga08x19_3410_c1 3300050514 Bacteria 9479
464 nmdc:mga08x19_35258_c1 3300050514 Bacteria 3165
465 nmdc:mga08x19_84115_c1 3300050514 Bacteria 2093
466 nmdc:mga08x19_998_c1 3300050514 Bacteria 17682
467 nmdc:mga0a205_10866_c1 3300050515 Bacteria 8375
468 nmdc:mga0a205_169313_c1 3300050515 Bacteria 2080
469 nmdc:mga0a205_315_c1 3300050515 Bacteria 36002
470 nmdc:mga0a205_447340_c1 3300050515 Bacteria 1152
471 nmdc:mga0a205_622_c1 3300050515 Bacteria 28152
472 nmdc:mga0a205_79477_c1 3300050515 Bacteria 3169
473 Ga0495619_0114926 3300053085 Bacteria 1841
474 Ga0495619_0145482 3300053085 Bacteria 1634
475 Ga0500652_007541 3300053131 Bacteria 3568
476 Ga0500627_0000338 3300053158 Bacteria 12693
477 Ga0500627_0014936 3300053158 Bacteria 2987
478 Ga0500645_000108 3300053730 Bacteria 66421
479 Ga0500645_000771 3300053730 Bacteria 19427
480 Ga0590071_000388 3300059421 Bacteria 12950
481 Ga0590075_000600 3300059424 Bacteria 9685
482 Ga0590077_000876 3300059426 Bacteria 7717
483 Ga0466962_0016751 3300061719 Bacteria 3533
484 Ga0530510_0008471 3300061734 Bacteria 7171
485 2511701123 2511231119 Bacteria 4019861
486 2515496483 2515154088 Bacteria 5526283
487 2515757530 2515154137 Bacteria 5711575
488 2516084947 2515154202 Bacteria 5471270
489 2516091714 2515154203 Bacteria 5458536
490 2553394475 2551306519 Bacteria 5465154
491 2631985764 2630968484 Bacteria 3876276
492 2644703014 2643221729 Bacteria 6621700
493 2644711449 2643221730 Bacteria 6523787
494 2674421943 2671180844 Bacteria 4164150
495 2685148409 2684622632 Bacteria 5380049
496 2695629074 2695420354 Bacteria 3922431
497 2698324750 2695420987 Bacteria 6152737
498 2705992353 2703719227 Bacteria 5631989
499 2717915225 2716884898 Bacteria 3928789
500 2721503788 2718218445 Bacteria 5113413
501 2738706905 2738541274 Bacteria 6909446
502 2738707962 2738541274 Bacteria 6909446
503 2739158888 2738541358 Bacteria 5932299
504 2739211400 2738543006 Bacteria 5904091
505 2739333289 2738543028 Bacteria 6917070
506 2791912212 2791354901 Bacteria 8322202
507 2819584182 2818991443 Bacteria 6598732
508 2831907494 2831905167 Bacteria 3319172
509 2864999264 2864997549 Bacteria 5139696
510 2873318394 2873314349 Bacteria 8512634
511 2880172846 2880169592 Bacteria 3900066
512 2895431093 2895427314 Bacteria 13147766
513 2897113127 2897109615 Bacteria 4009619
514 2902801906 2902799365 Bacteria 5419524
515 2904561446 2904560550 Bacteria 4029838
516 2929233658 2929233124 Bacteria 5948380
517 2938917829 2938917290 Bacteria 5914775
518 2947427145 2947426588 Bacteria 5357194
519 2965761606 2965761152 Bacteria 5806513
520 2969144563 2969141011 Bacteria 4118468
521 2971896683 2971893375 Bacteria 3929648
522 2979084141 2979083700 Bacteria 5894929
523 3006882839 3006879489 Bacteria 4064221
524 8022621586 8022621104 Bacteria 5241040
525 8022633271 8022630665 Bacteria 3886130
526 8023438385 8023438354 Bacteria 5779374
527 8023450285 8023444577 Bacteria 5661597
528 8051954375 8051952484 Bacteria 3926774
529 8052175542 8052174270 Bacteria 3881265
530 8053948399 8053945823 Bacteria 8962862
531 8055069598 8055066027 Bacteria 9479577
532 8055176174 8055172936 Bacteria 9305943
533 8057583210 8057582654 Bacteria 5218944
534 nmdc:mga00v17_19344_c1
535 MRS1b_contig_1885129
536 JGI25159J45721_1001285
537 JGI25159J45721_1009786
538 JGI25159J45721_1012695
539 JGI25151J46595_10004393
540 JGI25151J46595_10005289
541 JGI25151J46595_10008871
542 JGI25151J46595_10012228
543 Ga0065712_10070278
544 Ga0065712_10131857
545 Ga0065715_10017944
546 Ga0065715_10154387
547 Ga0065707_10121459
548 Ga0065707_10166403
549 Ga0070676_10001529
550 Ga0070676_10043539
551 Ga0070683_100020565
552 Ga0070683_100224643
553 Ga0070670_100022748
554 Ga0070666_10015331
555 Ga0070666_10036683
556 Ga0070666_10154027
557 Ga0070680_100050062
558 Ga0070682_100174800
559 Ga0070689_100122853
560 Ga0070691_10007116
561 Ga0070687_100055999
562 Ga0070668_100096502
563 Ga0070669_100001159
564 Ga0070669_100111819
565 Ga0070669_100235935
566 Ga0070669_100358057
567 Ga0070675_100030153
568 Ga0070671_100016979
569 Ga0070671_100039446
570 Ga0070671_100143672
571 Ga0070671_100371079
572 Ga0070674_100006041
573 Ga0070674_100038991
574 Ga0070674_100187771
575 Ga0070674_100290450
576 Ga0070688_100031178
577 Ga0070659_100065670
578 Ga0070667_100062356
579 Ga0070667_100311387
580 Ga0070714_100000076
581 Ga0070713_100088633
582 Ga0070701_10057035
583 Ga0070711_100314921
584 Ga0070711_100425568
585 Ga0070705_100018149
586 Ga0070700_100011570
587 Ga0070700_100175198
588 Ga0070694_100212288
589 Ga0070708_100208264
590 Ga0070663_100014145
591 Ga0070678_100009398
592 Ga0070662_100180025
593 Ga0070681_10496956
594 Ga0068867_100008739
595 Ga0070706_100326608
596 Ga0070706_100424213
597 Ga0070707_100250191
598 Ga0070699_100066475
599 Ga0070699_100147999
600 Ga0070699_100261641
601 Ga0070699_100300665
602 Ga0070699_100380105
603 Ga0070684_100000084
604 Ga0070697_100053325
605 Ga0070697_100366029
606 Ga0070697_100474226
607 Ga0070672_100107341
608 Ga0070672_100188707
609 Ga0070686_100018843
610 Ga0070686_100028671
611 Ga0070686_100243634
612 Ga0070695_100001395
613 Ga0070696_100002228
614 Ga0070696_100013727
615 Ga0070696_100056000
616 Ga0070704_100049966
617 Ga0070704_100139043
618 Ga0070704_100219848
619 Ga0070704_100236136
620 Ga0068855_100024725
621 Ga0070664_100000177
622 Ga0068854_100019967
623 Ga0070702_100016052
624 Ga0068859_100573768
625 Ga0068864_100036284
626 Ga0068864_100469466
627 Ga0068864_100520838
628 Ga0068866_10124040
629 Ga0068861_100090193
630 Ga0068861_100105320
631 Ga0068861_100109766
632 Ga0068870_10102202
633 Ga0068863_100286451
634 Ga0068858_100201871
635 Ga0068860_100208838
636 Ga0068860_100242392
637 Ga0068860_100387257
638 Ga0068862_100012312
639 Ga0068862_100035433
640 Ga0068862_100038548
641 Ga0068862_100045614
642 Ga0068862_100252826
643 Ga0081538_10010627
644 Ga0081539_10036381
645 Ga0081539_10071082
646 Ga0070717_10084140
647 Ga0075365_10170012
648 Ga0075364_10006660
649 Ga0075364_10073939
650 Ga0075364_10113886
651 Ga0070716_100019267
652 Ga0075362_10067182
653 Ga0075367_10006394
654 Ga0075366_10039350
655 Ga0097621_100032668
656 Ga0068871_100006797
657 Ga0075428_100014331
658 Ga0075428_100026365
659 Ga0075428_100045938
660 Ga0075428_100102082
661 Ga0075428_100121651
662 Ga0075428_100412403
663 Ga0075430_100059040
664 Ga0075430_100177821
665 Ga0075430_100437389
666 Ga0075431_100005672
667 Ga0075431_100025029
668 Ga0075431_100036203
669 Ga0075431_100121722
670 Ga0075431_100252778
671 Ga0075431_100332116
672 Ga0075433_10000165
673 Ga0075433_10002186
674 Ga0075433_10027328
675 Ga0075433_10030734
676 Ga0075433_10192551
677 Ga0075433_10257036
678 Ga0075434_100002048
679 Ga0075434_100006067
680 Ga0075434_100036054
681 Ga0075434_100087790
682 Ga0075434_100092742
683 Ga0075434_100171959
684 Ga0075429_100019914
685 Ga0075429_100047944
686 Ga0075429_100049131
687 Ga0075429_100115418
688 Ga0075429_100239827
689 Ga0068865_100062332
690 Ga0075436_100000960
691 Ga0075436_100001502
692 Ga0075436_100005838
693 Ga0075436_100093442
694 Ga0097620_100573859
695 Ga0075435_100000200
696 Ga0075435_100000623
697 Ga0075435_100003467
698 Ga0075435_100015230
699 Ga0075435_100063870
700 Ga0099794_10005597
701 Ga0099794_10185225
702 Ga0105251_10003451
703 Ga0105244_10003509
704 Ga0105244_10030791
705 Ga0105244_10046550
706 Ga0105250_10002199
707 Ga0105250_10004105
708 Ga0105240_10155742
709 Ga0111539_10001317
710 Ga0111539_10005326
711 Ga0111539_10005841
712 Ga0111539_10034170
713 Ga0111539_10042971
714 Ga0111539_10045884
715 Ga0111539_10131699
716 Ga0111539_10328380
717 Ga0105245_10033359
718 Ga0105245_10399727
719 Ga0105247_10009538
720 Ga0114129_10000186
721 Ga0114129_10007736
722 Ga0114129_10008891
723 Ga0114129_10013713
724 Ga0114129_10092062
725 Ga0114129_10100957
726 Ga0114129_10300296
727 Ga0114129_10315872
728 Ga0105243_10228580
729 Ga0105241_10427493
730 Ga0105242_10072924
731 Ga0105242_10236867
732 Ga0105248_10005522
733 Ga0105248_10011952
734 Ga0105248_10135934
735 Ga0105248_10140260
736 Ga0105249_10369034
737 Ga0105249_10602872
738 Ga0105239_10174799
739 Ga0105246_10121091
740 Ga0157375_10592661
741 Ga0163163_10013572
742 Ga0163163_10041689
743 Ga0157380_10076518
744 Ga0157380_10339348
745 Ga0157379_10119719
746 Ga0157379_10299004
747 Ga0213873_10023414
748 Ga0213876_10061523
749 Ga0209147_100427
750 Ga0209147_105116
751 Ga0209130_1000781
752 Ga0209130_1001629
753 Ga0209130_1002631
754 Ga0209025_1000540
755 Ga0209025_1000677
756 Ga0209025_1002080
757 Ga0209025_1004929
758 Ga0209025_1006248
759 Ga0209025_1028908
760 Ga0207696_1000591
761 Ga0207696_1010563
762 Ga0207696_1025062
763 Ga0207655_1006044
764 Ga0207655_1052042
765 Ga0207713_1014154
766 Ga0207682_10091763
767 Ga0207682_10175784
768 Ga0207680_10011266
769 Ga0207680_10048934
770 Ga0207680_10096973
771 Ga0207680_10116029
772 Ga0207699_10248839
773 Ga0207645_10019006
774 Ga0207645_10149094
775 Ga0207643_10105597
776 Ga0207684_10411339
777 Ga0207695_10033810
778 Ga0207695_10482363
779 Ga0207662_10003913
780 Ga0207662_10040474
781 Ga0207646_10008874
782 Ga0207646_10129201
783 Ga0207646_10138026
784 Ga0207646_10173450
785 Ga0207681_10048218
786 Ga0207681_10048311
787 Ga0207681_10147778
788 Ga0207650_10069325
789 Ga0207650_10117590
790 Ga0207659_10031838
791 Ga0207687_10273801
792 Ga0207664_10000335
793 Ga0207706_10217169
794 Ga0207706_10247080
795 Ga0207686_10114792
796 Ga0207709_10102290
797 Ga0207704_10099348
798 Ga0207691_10119173
799 Ga0207691_10183682
800 Ga0207691_10245464
801 Ga0207711_10009215
802 Ga0207711_10057559
803 Ga0207711_10397147
804 Ga0207689_10035560
805 Ga0207661_10013822
806 Ga0207661_10196082
807 Ga0207679_10058807
808 Ga0207679_10110081
809 Ga0207667_10540549
810 Ga0207712_10084859
811 Ga0207712_10231701
812 Ga0207668_10088326
813 Ga0207640_10114041
814 Ga0207640_10131596
815 Ga0207658_10042374
816 Ga0207658_10266641
817 Ga0207703_10027933
818 Ga0207678_10027295
819 Ga0207708_10001907
820 Ga0207708_10002265
821 Ga0207708_10065565
822 Ga0207708_10127601
823 Ga0207648_10010632
824 Ga0207648_10135624
825 Ga0207676_10037586
826 Ga0207674_10118940
827 Ga0207675_100019356
828 Ga0207675_100099386
829 Ga0207675_100100489
830 Ga0207683_10207639
831 Ga0207683_10252832
832 Ga0207428_10006036
833 Ga0207428_10038780
834 Ga0207428_10132386
835 Ga0268266_10008440
836 Ga0268265_10090843
837 Ga0268265_10197885
838 Ga0268264_10327893
839 Ga0268264_10449465
840 Ga0265318_10023005
841 Ga0237817_10017
842 Ga0237817_10207
843 Ga0265330_10031861
844 Ga0265332_10000237
845 Ga0265325_10009898
846 Ga0265329_10004961
847 Ga0265339_10000198
848 Ga0265331_10000336
849 Ga0265316_10000347
850 Ga0265316_10038809
851 Ga0307513_10016795
852 Ga0265314_10000494
853 Ga0265314_10000793
854 Ga0265342_10003572
855 Ga0265342_10009587
856 Ga0316576_10103503
857 Ga0307413_10000125
858 Ga0307410_10069994
859 Ga0307409_100465643
860 Ga0307415_100203634
861 Ga0373950_0001360
862 Ga0373959_0021679
863 Ga0373938_0001382
864 Ga0373928_0000854
865 Ga0373929_0007379
866 Ga0373940_0008175
867 Ga0373944_0075357
868 Ga0373949_0026306
869 Ga0373939_0001273
870 Ga0373941_0000390
871 Ga0373945_0040134
872 Ga0373960_0002494
873 Ga0373943_0001254
874 Ga0373943_0046969
875 Ga0373942_0000066
876 Ga0373961_0002961
877 Ga0373961_0054273
878 Ga0316574_0083973
879 Ga0373931_0001723
880 Ga0373935_0011677
881 Ga0373927_0098863
882 Ga0316584_0144991
883 Ga0373925_0011896
884 Ga0237819_00031
885 Ga0237819_01125
886 Ga0436365_0539475
887 Ga0436365_1285903
888 Ga0436361_0482933
889 Ga0436362_0535802
890 Ga0439450_001354
891 Ga0439446_0052212
892 Ga0439464_0037166
893 Ga0439460_0044472
894 Ga0439440_0032788
895 Ga0466966_0009025
896 Ga0466961_0021424
897 Ga0466968_0009593
898 Ga0466970_0043423
899 Ga0466957_0019468
900 Ga0466959_0001917
901 Ga0451576_0123528
902 Ga0466958_0003988
903 Ga0466967_0001610
904 Ga0466967_0036859
905 Ga0466967_0113908
906 Ga0466967_0289340
907 Ga0495638_0025947
908 Ga0495653_0152032
909 Ga0495580_0014226
910 Ga0495639_0030619
911 Ga0495639_0080497
912 Ga0495608_0002043
913 Ga0495618_0024250
914 Ga0495628_0073752
915 Ga0495630_0055506
916 Ga0495640_0091097
917 Ga0495586_0066514
918 Ga0495587_0102151
919 Ga0495645_0001898
920 Ga0495667_0167966
921 Ga0495634_0054704
922 Ga0495635_0157661
923 Ga0495647_0051772
924 Ga0495613_0001654
925 Ga0495674_0073128
926 Ga0495680_0046927
927 Ga0496100_0004749
928 Ga0496101_0002157
929 Ga0496101_0300541
930 Ga0496102_0251016
931 Ga0496104_0001005
932 Ga0496104_0002447
933 Ga0496104_0193451
934 Ga0496104_0243927
935 Ga0496105_0012918
936 Ga0496105_0277876
937 Ga0496106_0004451
938 Ga0496106_0231257
939 Ga0496108_0000350
940 Ga0496108_0079968
941 Ga0496109_0000257
942 Ga0496110_0000390
943 Ga0496111_0002799
944 Ga0496112_0002169
945 Ga0496112_0005794
946 Ga0496114_0001406
947 Ga0496114_0105459
948 Ga0496114_0454473
949 Ga0496118_0000572
950 Ga0496126_0016979
951 Ga0501299_015850
952 Ga0501036_0178338
953 Ga0501040_0289475
954 Ga0501048_0286545
955 Ga0501048_0314746
956 Ga0501070_0079964
957 Ga0501076_0387551
958 Ga0501035_0167937
959 Ga0501045_0024705
960 nmdc:mga03683_63440_c1
961 nmdc:mga00v17_55121_c1
962 nmdc:mga00v17_62473_c1
963 nmdc:mga05p37_1386_c1
964 nmdc:mga05p37_14584_c1
965 nmdc:mga05p37_153228_c1
966 nmdc:mga05p37_447883_c1
967 nmdc:mga05p37_54647_c1
968 nmdc:mga05p37_6847_c1
969 nmdc:mga05p37_731_c1
970 nmdc:mga09592_123147_c1
971 nmdc:mga09592_248242_c1
972 nmdc:mga0qj67_24229_c1
973 nmdc:mga06r32_21270_c1
974 nmdc:mga06r32_573_c3
975 nmdc:mga06r32_97072_c1
976 nmdc:mga08y16_2225_c1
977 nmdc:mga08y16_22961_c1
978 nmdc:mga08y16_2702_c1
979 nmdc:mga08y16_289061_c1
980 nmdc:mga08y16_31230_c2
981 nmdc:mga08y16_616141_c1
982 nmdc:mga08y16_6411_c1
983 nmdc:mga08y16_68268_c1
984 nmdc:mga0n895_12247_c1
985 nmdc:mga0n895_148883_c1
986 nmdc:mga0n895_17619_c1
987 nmdc:mga0n895_47791_c1
988 nmdc:mga0n895_5183_c1
989 nmdc:mga0rr50_144980_c1
990 nmdc:mga0rr50_169385_c1
991 nmdc:mga0rr50_169864_c1
992 nmdc:mga0rr50_2007_c1
993 nmdc:mga0rr50_237798_c1
994 nmdc:mga0rr50_3_c1
995 nmdc:mga08x19_11756_c1
996 nmdc:mga08x19_3410_c1
997 nmdc:mga08x19_35258_c1
998 nmdc:mga08x19_84115_c1
999 nmdc:mga08x19_998_c1
1000 nmdc:mga0a205_10866_c1
1001 nmdc:mga0a205_169313_c1
1002 nmdc:mga0a205_315_c1
1003 nmdc:mga0a205_447340_c1
1004 nmdc:mga0a205_622_c1
1005 nmdc:mga0a205_79477_c1
1006 Ga0495619_0114926
1007 Ga0495619_0145482
1008 Ga0500652_007541
1009 Ga0500627_0000338
1010 Ga0500627_0014936
1011 Ga0500645_000108
1012 Ga0500645_000771
1013 Ga0590071_000388
1014 Ga0590075_000600
1015 Ga0590077_000876
1016 Ga0466962_0016751
1017 Ga0530510_0008471
1018 2511701123
1019 2515496483
1020 2515757530
1021 2516084947
1022 2516091714
1023 2553394475
1024 2631985764
1025 2644703014
1026 2644711449
1027 2674421943
1028 2685148409
1029 2695629074
1030 2698324750
1031 2705992353
1032 2717915225
1033 2721503788
1034 2738706905
1035 2738707962
1036 2739158888
1037 2739211400
1038 2739333289
1039 2791912212
1040 2819584182
1041 2831907494
1042 2864999264
1043 2873318394
1044 2880172846
1045 2895431093
1046 2897113127
1047 2902801906
1048 2904561446
1049 2929233658
1050 2938917829
1051 2947427145
1052 2965761606
1053 2969144563
1054 2971896683
1055 2979084141
1056 3006882839
1057 8022621586
1058 8022633271
1059 8023438385
1060 8023450285
1061 8051954375
1062 8052175542
1063 8053948399
1064 8055069598
1065 8055176174
1066 8057583210

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

18

257

0.96

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

19

328

0.86

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

18

141

0.84

PF04321

RmlD_sub_bind

RmlD substrate binding domain

15

311

0.83

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

19

248

0.81

PF07993

NAD_binding_4

Male sterility protein

20

216

0.77

PF13460

NAD_binding_10

NAD(P)H-binding

22

207

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sb8-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine 0.9707 2 306
3ruc-assembly1.cif.gz_A specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase 0.9667 2 308
4zrn-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima 0.9642 3 309
3ru9-assembly1.cif.gz_A specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase 0.9641 2 308
6wja-assembly1.cif.gz_A udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac 0.9613 3 304
ID Description Score Start End Superfamily
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9564 2 239 3.40.50.720
4zrmB02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9484 174 308 3.90.25.10
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9482 3 238 3.40.50.720
6dntA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9477 174 309 3.90.25.10
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9433 1 315 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1F8R7A1-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9925 72 305
AF-A0A812PUP2-F1-model_v4 WbgU protein 0.9907 1 313
AF-A0A7V2XJE6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9869 1 311
AF-A0A7C2EL58-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9862 87 314 GO:0016491
AF-A0A2V6YDC7-F1-model_v4 LPS biosynthesis protein WbpP 0.9855 2 311

Map