F460436

General Info

Members Datasets Scaffolds Average Seq Length
533 295 1066 217

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0043698|Ga0395900_0043698_3187_3882
Length 231
Sequence MEPSALTHVATHVDEHRLREQIVAFGKSLFDRGLTAGSSGNLSARLDDGWLVTPTNASLGSLDPARLSKLDWQGRVLSGDAPSKEAVLHRAVYEERAAAAAIVHLHATHSAAVSCMSGLDADDCIPPLTAYFVMKIGMLPLVPYFRPGDPALANAIRGLAAKHTAVLLANHGPVVSGRSLEAAVHAIEELEETAKLFLLLRGSPTRPLNEAQVAEIRSVFEADARMPGPSI

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
58 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
59 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
118 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
119 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
122 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
127 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
128 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
129 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
133 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
149 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
190 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
241 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
242 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
256 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
257 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
258 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
262 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
263 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
264 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
265 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
266 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
267 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
268 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
269 2738541280 Massilia sp. GV090 Isolate Unclassified
270 2738541300 Massilia sp. GV016 Isolate Unclassified
271 2738543018 Massilia sp. GV045 Isolate Unclassified
272 2738543030 Massilia sp. GV097 Isolate Unclassified
273 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
274 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
275 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
276 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
277 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
278 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
279 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
280 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
281 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
282 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
283 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
284 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
285 2909042592 Labrys sp. LIt4 Isolate Nodule
286 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
287 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
288 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
289 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
290 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
291 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
292 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
293 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
294 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
295 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.43
Metatranscriptomes 0
Isolates 6.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.06
Nodule 3
Rhizoplane 4.69
Rhizosphere 83.86
Stem 0
Stem Tuber 0.19
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0043698 3300037418 Bacteria 4619
2 RicEn_C444 2010549000 Bacteria 1326
3 JGI24751J29686_10004051 3300002459 Bacteria 2966
4 JGI25151J46595_10001469 3300003187 Bacteria 15924
5 rootL2_10059569 3300003322 Bacteria 6557
6 Ga0065165_1048364 3300005262 Bacteria 1222
7 Ga0070658_10003510 3300005327 Bacteria 12884
8 Ga0070658_10032167 3300005327 Bacteria 4218
9 Ga0070658_10120021 3300005327 Bacteria 2184
10 Ga0070683_100293566 3300005329 Bacteria 1546
11 Ga0070670_100036907 3300005331 Bacteria 4205
12 Ga0070670_100206974 3300005331 Bacteria 1705
13 Ga0068869_100352458 3300005334 Bacteria 1200
14 Ga0070680_100292636 3300005336 Bacteria 1380
15 Ga0070660_100010200 3300005339 Bacteria 6633
16 Ga0070660_100011394 3300005339 Bacteria 6315
17 Ga0070661_100140526 3300005344 Bacteria 1819
18 Ga0070661_100248692 3300005344 Bacteria 1371
19 Ga0070659_100181481 3300005366 Bacteria 1727
20 Ga0070667_100000851 3300005367 Bacteria 28385
21 Ga0070663_100000180 3300005455 Bacteria 32121
22 Ga0070662_100190010 3300005457 Bacteria 1623
23 Ga0070662_100411368 3300005457 Bacteria 1117
24 Ga0070679_100012972 3300005530 Bacteria 7982
25 Ga0068853_100010135 3300005539 Bacteria 7616
26 Ga0068853_100084593 3300005539 Bacteria 2780
27 Ga0068855_100004604 3300005563 Bacteria 16834
28 Ga0068855_100016254 3300005563 Bacteria 8949
29 Ga0068855_100096742 3300005563 Bacteria 3400
30 Ga0070664_100595025 3300005564 Bacteria 1025
31 Ga0068857_100000339 3300005577 Bacteria 32219
32 Ga0068857_100234794 3300005577 Bacteria 1678
33 Ga0068852_100108324 3300005616 Bacteria 2521
34 Ga0068859_100005767 3300005617 Bacteria 12590
35 Ga0068861_100000333 3300005719 Bacteria 26666
36 Ga0068863_100004683 3300005841 Bacteria 13479
37 Ga0068858_100466182 3300005842 Bacteria 1218
38 Ga0068860_100012224 3300005843 Bacteria 8459
39 Ga0068862_100001937 3300005844 Bacteria 18793
40 Ga0081539_10087317 3300005985 Bacteria 1621
41 Ga0075430_100095644 3300006846 Bacteria 2482
42 Ga0075431_100020612 3300006847 Bacteria 6737
43 Ga0075431_100164306 3300006847 Bacteria 2282
44 Ga0075429_100282907 3300006880 Bacteria 1452
45 Ga0097620_100005767 3300006931 Bacteria 12590
46 Ga0075435_100406083 3300007076 Bacteria 1172
47 Ga0105240_10025479 3300009093 Bacteria 7771
48 Ga0105247_10406646 3300009101 Unclassified 971
49 Ga0114129_10101187 3300009147 Bacteria 3988
50 Ga0114129_10615938 3300009147 Bacteria 1405
51 Ga0105243_10081577 3300009148 Bacteria 2641
52 Ga0105241_10036138 3300009174 Bacteria 3717
53 Ga0105242_10023709 3300009176 Bacteria 4838
54 Ga0105248_10000157 3300009177 Bacteria 79064
55 Ga0105238_10335831 3300009551 Unclassified 1499
56 Ga0105249_10003342 3300009553 Bacteria 13886
57 Ga0105239_10777130 3300010375 Bacteria 1097
58 Ga0105239_10841366 3300010375 Bacteria 1052
59 Ga0157371_10440402 3300013102 Bacteria 957
60 Ga0157370_10000427 3300013104 Bacteria 52545
61 Ga0157369_10001398 3300013105 Bacteria 29621
62 Ga0157374_10382670 3300013296 Bacteria 1402
63 Ga0157372_10102626 3300013307 Bacteria 3267
64 Ga0163163_10030208 3300014325 Bacteria 5218
65 Ga0157380_10050766 3300014326 Bacteria 3277
66 Ga0182008_10000481 3300014497 Bacteria 30439
67 Ga0182006_1000002 3300015261 Bacteria 887990
68 Ga0182007_10000045 3300015262 Bacteria 106028
69 Ga0182005_1000002 3300015265 Bacteria 908499
70 Ga0214544_1000097 3300021320 Bacteria 116548
71 Ga0214542_1023744 3300021321 Bacteria 3586
72 Ga0214543_1012294 3300021327 Bacteria 11473
73 Ga0214543_1019848 3300021327 Bacteria 5634
74 Ga0214543_1020933 3300021327 Bacteria 5108
75 Ga0213876_10000476 3300021384 Bacteria 31958
76 Ga0213876_10125898 3300021384 Bacteria 1361
77 Ga0213871_10020536 3300021441 Bacteria 1638
78 Ga0209129_1000016 3300025258 Bacteria 485491
79 Ga0209233_1013610 3300025261 Bacteria 2319
80 Ga0209025_1000126 3300025294 Bacteria 200866
81 Ga0209051_1006374 3300025303 Bacteria 6670
82 Ga0207705_10000252 3300025909 Bacteria 52384
83 Ga0207705_10001741 3300025909 Bacteria 17244
84 Ga0207705_10061897 3300025909 Bacteria 2703
85 Ga0207705_10148781 3300025909 Bacteria 1753
86 Ga0207654_10010235 3300025911 Bacteria 4773
87 Ga0207695_10163479 3300025913 Bacteria 2155
88 Ga0207660_10240536 3300025917 Bacteria 1426
89 Ga0207657_10009070 3300025919 Bacteria 10043
90 Ga0207657_10076548 3300025919 Bacteria 2822
91 Ga0207657_10081782 3300025919 Bacteria 2712
92 Ga0207649_10213246 3300025920 Bacteria 1371
93 Ga0207652_10005747 3300025921 Bacteria 10067
94 Ga0207650_10010241 3300025925 Bacteria 6426
95 Ga0207690_10261855 3300025932 Bacteria 1340
96 Ga0207706_10124831 3300025933 Bacteria 2264
97 Ga0207686_10011341 3300025934 Bacteria 4878
98 Ga0207709_10055364 3300025935 Bacteria 2450
99 Ga0207711_10004750 3300025941 Bacteria 11535
100 Ga0207661_10241980 3300025944 Bacteria 1601
101 Ga0207679_10091651 3300025945 Bacteria 2352
102 Ga0207679_10411095 3300025945 Bacteria 1192
103 Ga0207679_10521403 3300025945 Bacteria 1063
104 Ga0207667_10001409 3300025949 Bacteria 30094
105 Ga0207712_10000454 3300025961 Bacteria 34905
106 Ga0207640_10060682 3300025981 Bacteria 2501
107 Ga0207658_10005952 3300025986 Bacteria 8329
108 Ga0207639_10082821 3300026041 Bacteria 2544
109 Ga0207639_10102020 3300026041 Bacteria 2321
110 Ga0207678_10000763 3300026067 Bacteria 29365
111 Ga0207678_10302395 3300026067 Bacteria 1375
112 Ga0207678_10320577 3300026067 Bacteria 1333
113 Ga0207641_10003687 3300026088 Bacteria 13496
114 Ga0207674_10001295 3300026116 Bacteria 32659
115 Ga0207674_10261066 3300026116 Bacteria 1679
116 Ga0207675_100001097 3300026118 Bacteria 26813
117 Ga0209981_1004301 3300027378 Bacteria 1865
118 Ga0209996_1008302 3300027395 Bacteria 1360
119 Ga0210000_1004124 3300027462 Bacteria 2100
120 Ga0210000_1009700 3300027462 Bacteria 1419
121 Ga0209971_1011867 3300027682 Bacteria 2062
122 Ga0268265_10000535 3300028380 Bacteria 38794
123 Ga0268264_10003100 3300028381 Bacteria 14391
124 Ga0307408_100001181 3300031548 Bacteria 19768
125 Ga0307408_100086373 3300031548 Bacteria 2358
126 Ga0307408_100195737 3300031548 Bacteria 1632
127 Ga0307408_100332068 3300031548 Bacteria 1284
128 Ga0307408_100366871 3300031548 Bacteria 1227
129 Ga0307405_10285846 3300031731 Bacteria 1244
130 Ga0307406_10441986 3300031901 Bacteria 1041
131 Ga0307407_10244609 3300031903 Bacteria 1226
132 Ga0307412_10144704 3300031911 Bacteria 1746
133 Ga0307412_10555253 3300031911 Bacteria 965
134 Ga0307412_10767053 3300031911 Bacteria 834
135 Ga0307409_100352411 3300031995 Bacteria 1389
136 Ga0307416_100065516 3300032002 Bacteria 2986
137 Ga0307416_100267355 3300032002 Bacteria 1676
138 Ga0307416_100985828 3300032002 Bacteria 945
139 Ga0307414_10624450 3300032004 Bacteria 969
140 Ga0307411_10064261 3300032005 Bacteria 2457
141 Ga0307411_10285911 3300032005 Bacteria 1315
142 Ga0307415_100010090 3300032126 Bacteria 5330
143 Ga0316582_0011908 3300036647 Bacteria 4832
144 Ga0316584_0363934 3300036712 Bacteria 1036
145 Ga0395899_0002075 3300037312 Bacteria 16464
146 Ga0395899_0002873 3300037312 Bacteria 13843
147 Ga0395899_0008200 3300037312 Bacteria 8049
148 Ga0395899_0016039 3300037312 Bacteria 5712
149 Ga0395899_0016354 3300037312 Bacteria 5654
150 Ga0395899_0118617 3300037312 Bacteria 1897
151 Ga0395899_0331402 3300037312 Bacteria 1023
152 Ga0395900_0000569 3300037418 Bacteria 51069
153 Ga0395900_0009601 3300037418 Bacteria 9920
154 Ga0395900_0013459 3300037418 Bacteria 8359
155 Ga0395900_0026670 3300037418 Bacteria 5915
156 Ga0395900_0030998 3300037418 Bacteria 5492
157 Ga0395900_0098654 3300037418 Bacteria 3001
158 Ga0395900_0176705 3300037418 Bacteria 2171
159 Ga0395900_0228873 3300037418 Bacteria 1870
160 Ga0395898_0012134 3300037466 Bacteria 8916
161 Ga0395898_0027211 3300037466 Bacteria 5743
162 Ga0395898_0029282 3300037466 Bacteria 5517
163 Ga0395898_0057592 3300037466 Bacteria 3786
164 Ga0395898_0141739 3300037466 Bacteria 2301
165 Ga0395898_0208894 3300037466 Bacteria 1862
166 Ga0395898_0457682 3300037466 Bacteria 1215
167 Ga0395905_0005689 3300037471 Bacteria 12668
168 Ga0395905_0012499 3300037471 Bacteria 8171
169 Ga0395905_0027702 3300037471 Bacteria 5343
170 Ga0395905_0054836 3300037471 Bacteria 3730
171 Ga0395905_0083920 3300037471 Bacteria 2984
172 Ga0395905_0115454 3300037471 Bacteria 2523
173 Ga0395905_1003571 3300037471 Bacteria 738
174 Ga0436364_1038359 3300037853 Bacteria 3204
175 Ga0395901_0000378 3300038443 Bacteria 53368
176 Ga0395901_0020945 3300038443 Bacteria 6699
177 Ga0395901_0043729 3300038443 Bacteria 4645
178 Ga0395901_0121840 3300038443 Bacteria 2741
179 Ga0395901_0129032 3300038443 Bacteria 2657
180 Ga0395901_0244345 3300038443 Bacteria 1871
181 Ga0395901_0271935 3300038443 Bacteria 1762
182 Ga0395901_0301521 3300038443 Bacteria 1661
183 Ga0395901_0355954 3300038443 Bacteria 1510
184 Ga0395901_0527522 3300038443 Bacteria 1199
185 Ga0400483_051407 3300039062 Unclassified 1649
186 Ga0400483_289189 3300039062 Unclassified 1786
187 Ga0436365_0090629 3300039437 Bacteria 57501
188 Ga0436365_0715113 3300039437 Bacteria 6807
189 Ga0436365_1933157 3300039437 Bacteria 2330
190 Ga0436360_0174938 3300039438 Bacteria 688
191 Ga0436360_0214974 3300039438 Bacteria 2552
192 Ga0436362_0159667 3300039453 Bacteria 889
193 Ga0439438_000008 3300041405 Bacteria 178072
194 Ga0439453_0034815 3300041408 Bacteria 968
195 Ga0439466_0017581 3300041411 Bacteria 2576
196 Ga0439466_0025382 3300041411 Bacteria 2068
197 Ga0439466_0031328 3300041411 Bacteria 1819
198 Ga0439466_0071812 3300041411 Bacteria 1101
199 Ga0439465_0004054 3300041413 Bacteria 4775
200 Ga0439431_0000002 3300041997 Bacteria 63493
201 Ga0439443_011861 3300042003 Bacteria 1283
202 Ga0439448_0001414 3300042005 Bacteria 6194
203 Ga0439432_010853 3300042006 Bacteria 3146
204 Ga0439432_036004 3300042006 Bacteria 1585
205 Ga0439449_0017368 3300042007 Bacteria 2702
206 Ga0439449_0033351 3300042007 Bacteria 1918
207 Ga0439455_0002920 3300042012 Bacteria 3195
208 Ga0439456_009770 3300042013 Bacteria 1979
209 Ga0450902_024144 3300042137 Bacteria 1011
210 Ga0450910_000042 3300042147 Bacteria 13527
211 Ga0439446_0000152 3300042156 Bacteria 12085
212 Ga0439435_0003559 3300042436 Bacteria 3254
213 Ga0439444_0012362 3300042437 Bacteria 1398
214 Ga0450893_0048874 3300042532 Bacteria 789
215 Ga0451577_0106038 3300042876 Bacteria 2512
216 Ga0451577_0195958 3300042876 Bacteria 1823
217 Ga0451577_0452846 3300042876 Bacteria 1165
218 Ga0451577_0831085 3300042876 Bacteria 834
219 Ga0466972_0004009 3300044658 Bacteria 7338
220 Ga0466972_0035510 3300044658 Bacteria 2439
221 Ga0453683_0080462 3300044673 Bacteria 2041
222 Ga0466965_0016618 3300044683 Bacteria 3505
223 Ga0466965_0044371 3300044683 Bacteria 2197
224 Ga0466965_0046083 3300044683 Bacteria 2157
225 Ga0466965_0070189 3300044683 Bacteria 1760
226 Ga0466966_0006853 3300044684 Bacteria 7545
227 Ga0466966_0060776 3300044684 Bacteria 2384
228 Ga0466964_0000165 3300044706 Bacteria 18344
229 Ga0466964_0013068 3300044706 Bacteria 3146
230 Ga0466964_0023135 3300044706 Bacteria 2414
231 Ga0466964_0083251 3300044706 Bacteria 1377
232 Ga0453684_0005063 3300044712 Bacteria 26699
233 Ga0453684_0018189 3300044712 Bacteria 10812
234 Ga0453684_0018355 3300044712 Bacteria 10741
235 Ga0453684_0045911 3300044712 Bacteria 5820
236 Ga0453684_0095208 3300044712 Bacteria 3660
237 Ga0453684_0414727 3300044712 Bacteria 1505
238 Ga0466968_0000780 3300044735 Bacteria 11085
239 Ga0466968_0033640 3300044735 Bacteria 2136
240 Ga0466970_0219065 3300044765 Bacteria 1062
241 Ga0466957_0000050 3300044842 Bacteria 43926
242 Ga0466957_0203082 3300044842 Bacteria 1302
243 Ga0466960_0037986 3300044901 Bacteria 2262
244 Ga0466959_0522628 3300045049 Bacteria 801
245 Ga0451576_0073373 3300045051 Bacteria 3561
246 Ga0451576_0162592 3300045051 Bacteria 2330
247 Ga0451576_0184815 3300045051 Bacteria 2176
248 Ga0451576_0784635 3300045051 Bacteria 1000
249 Ga0451576_0952408 3300045051 Bacteria 900
250 Ga0466958_0058681 3300045836 Bacteria 2340
251 Ga0466958_0081765 3300045836 Bacteria 1988
252 Ga0495617_001319 3300046452 Bacteria 11034
253 Ga0495617_005883 3300046452 Bacteria 4326
254 Ga0495617_074824 3300046452 Bacteria 1111
255 Ga0495590_0005255 3300046457 Bacteria 5137
256 Ga0495590_0110122 3300046457 Bacteria 983
257 Ga0495638_0001049 3300046460 Bacteria 27280
258 Ga0495638_0040005 3300046460 Bacteria 2973
259 Ga0495638_0156221 3300046460 Bacteria 1319
260 Ga0495605_0000667 3300046474 Bacteria 26082
261 Ga0495605_0061485 3300046474 Bacteria 1797
262 Ga0495639_0294235 3300046475 Bacteria 809
263 Ga0495584_0000887 3300046491 Bacteria 19216
264 Ga0495584_0001572 3300046491 Bacteria 13498
265 Ga0495584_0032936 3300046491 Bacteria 2621
266 Ga0495585_0000032 3300046492 Bacteria 143439
267 Ga0495585_0001004 3300046492 Bacteria 23546
268 Ga0495585_0005054 3300046492 Bacteria 8411
269 Ga0495585_0005316 3300046492 Bacteria 8131
270 Ga0495585_0018054 3300046492 Bacteria 4070
271 Ga0495585_0026492 3300046492 Bacteria 3311
272 Ga0495585_0034110 3300046492 Bacteria 2877
273 Ga0495585_0036092 3300046492 Bacteria 2791
274 Ga0495596_0001900 3300046500 Bacteria 11593
275 Ga0495607_0030391 3300046501 Bacteria 3317
276 Ga0495607_0038140 3300046501 Bacteria 2880
277 Ga0495607_0040162 3300046501 Bacteria 2788
278 Ga0495607_0063897 3300046501 Bacteria 2080
279 Ga0495607_0078070 3300046501 Bacteria 1827
280 Ga0495607_0094971 3300046501 Bacteria 1607
281 Ga0495583_0000040 3300046506 Bacteria 236558
282 Ga0495583_0000317 3300046506 Bacteria 76193
283 Ga0495583_0003229 3300046506 Bacteria 12751
284 Ga0495583_0007839 3300046506 Bacteria 6632
285 Ga0495583_0012039 3300046506 Bacteria 4926
286 Ga0495583_0056678 3300046506 Bacteria 1765
287 Ga0495606_0002586 3300046507 Bacteria 20710
288 Ga0495606_0048857 3300046507 Bacteria 2779
289 Ga0495606_0053096 3300046507 Bacteria 2631
290 Ga0495616_0000235 3300046513 Bacteria 44974
291 Ga0495616_0003225 3300046513 Bacteria 10504
292 Ga0495616_0011752 3300046513 Bacteria 5002
293 Ga0495616_0040417 3300046513 Bacteria 2383
294 Ga0495620_0002480 3300046515 Bacteria 10695
295 Ga0495631_0003779 3300046518 Bacteria 8238
296 Ga0495631_0027068 3300046518 Bacteria 2627
297 Ga0495637_0035958 3300046520 Bacteria 2161
298 Ga0495643_0000929 3300046522 Bacteria 30608
299 Ga0495643_0007806 3300046522 Bacteria 6845
300 Ga0495643_0009548 3300046522 Bacteria 6023
301 Ga0495644_0000073 3300046523 Bacteria 49382
302 Ga0495644_0001674 3300046523 Bacteria 8994
303 Ga0495644_0054679 3300046523 Bacteria 1499
304 Ga0495648_0021612 3300046524 Bacteria 4452
305 Ga0495648_0129881 3300046524 Bacteria 1341
306 Ga0495648_0216140 3300046524 Bacteria 949
307 Ga0495663_0013835 3300046525 Bacteria 2256
308 Ga0495642_0016293 3300046528 Bacteria 2895
309 Ga0495642_0037400 3300046528 Bacteria 1964
310 Ga0495642_0114299 3300046528 Bacteria 1156
311 Ga0495654_0005238 3300046530 Bacteria 7567
312 Ga0495654_0012540 3300046530 Bacteria 4549
313 Ga0495609_0000131 3300046538 Bacteria 80952
314 Ga0495609_0000588 3300046538 Bacteria 28544
315 Ga0495609_0001265 3300046538 Bacteria 17299
316 Ga0495609_0001762 3300046538 Bacteria 13898
317 Ga0495621_0052527 3300046539 Bacteria 1461
318 Ga0495597_0007273 3300046542 Bacteria 5640
319 Ga0495597_0011490 3300046542 Bacteria 4292
320 Ga0495622_0005542 3300046557 Bacteria 5851
321 Ga0495622_0006089 3300046557 Bacteria 5604
322 Ga0495622_0048675 3300046557 Bacteria 1969
323 Ga0495622_0072070 3300046557 Bacteria 1594
324 Ga0495633_0000779 3300046558 Bacteria 28510
325 Ga0495633_0000801 3300046558 Bacteria 28059
326 Ga0495633_0002197 3300046558 Bacteria 13967
327 Ga0495633_0006450 3300046558 Bacteria 6953
328 Ga0495633_0011022 3300046558 Bacteria 4904
329 Ga0495633_0157352 3300046558 Bacteria 1048
330 Ga0495656_0004181 3300046615 Bacteria 4928
331 Ga0495656_0014135 3300046615 Bacteria 2986
332 Ga0495656_0284605 3300046615 Bacteria 843
333 Ga0495656_0333005 3300046615 Bacteria 784
334 Ga0495668_0019224 3300046616 Bacteria 3941
335 Ga0495668_0028423 3300046616 Bacteria 3162
336 Ga0495668_0034391 3300046616 Bacteria 2843
337 Ga0495611_0000240 3300046648 Bacteria 37890
338 Ga0495611_0001965 3300046648 Bacteria 9756
339 Ga0495611_0008112 3300046648 Bacteria 4454
340 Ga0495625_0005695 3300046660 Bacteria 11284
341 Ga0495625_0024472 3300046660 Bacteria 4594
342 Ga0495625_0114376 3300046660 Bacteria 1842
343 Ga0495625_0125924 3300046660 Bacteria 1739
344 Ga0495625_0255990 3300046660 Bacteria 1134
345 Ga0495659_0000068 3300046664 Bacteria 46175
346 Ga0495659_0006414 3300046664 Bacteria 3713
347 Ga0495661_0000525 3300046665 Bacteria 39654
348 Ga0495661_0005826 3300046665 Bacteria 8713
349 Ga0495661_0011728 3300046665 Bacteria 5937
350 Ga0495661_0064672 3300046665 Bacteria 2157
351 Ga0495661_0165509 3300046665 Bacteria 1183
352 Ga0495669_0000608 3300046684 Bacteria 15651
353 Ga0495670_0000316 3300046691 Bacteria 22961
354 Ga0495670_0000560 3300046691 Bacteria 17705
355 Ga0495670_0006509 3300046691 Bacteria 5741
356 Ga0495671_0000533 3300046692 Bacteria 28745
357 Ga0495671_0002761 3300046692 Bacteria 10997
358 Ga0495671_0046919 3300046692 Bacteria 2159
359 Ga0495660_0007456 3300046810 Bacteria 6421
360 Ga0495660_0014655 3300046810 Bacteria 4534
361 Ga0495660_0265875 3300046810 Bacteria 790
362 Ga0495636_0000671 3300047318 Bacteria 12512
363 Ga0495636_0008179 3300047318 Bacteria 4125
364 Ga0495636_0021154 3300047318 Bacteria 2625
365 Ga0495636_0073943 3300047318 Bacteria 1459
366 Ga0495636_0262598 3300047318 Bacteria 801
367 Ga0495672_0003809 3300047320 Bacteria 12695
368 Ga0495672_0004462 3300047320 Bacteria 11443
369 Ga0495672_0028514 3300047320 Bacteria 3531
370 Ga0495683_0017210 3300047323 Bacteria 3748
371 Ga0495683_0022870 3300047323 Bacteria 3214
372 Ga0495683_0064101 3300047323 Bacteria 1815
373 Ga0495683_0068382 3300047323 Bacteria 1747
374 Ga0495683_0109910 3300047323 Bacteria 1317
375 Ga0495687_002138 3300047443 Bacteria 16504
376 Ga0495687_045436 3300047443 Bacteria 1901
377 Ga0495687_059229 3300047443 Bacteria 1585
378 Ga0495677_0000189 3300047445 Bacteria 28413
379 Ga0495677_0000352 3300047445 Bacteria 19895
380 Ga0495677_0003132 3300047445 Bacteria 6451
381 Ga0495677_0026208 3300047445 Bacteria 2115
382 Ga0495679_004538 3300047446 Bacteria 6366
383 Ga0495679_019583 3300047446 Bacteria 2374
384 Ga0495685_000125 3300047447 Bacteria 26465
385 Ga0495685_028832 3300047447 Bacteria 1909
386 Ga0495673_0005278 3300047469 Bacteria 7850
387 Ga0495681_0003645 3300047470 Bacteria 10695
388 Ga0495681_0021304 3300047470 Bacteria 3496
389 Ga0495615_0009653 3300048090 Bacteria 1906
390 Ga0495626_0002377 3300048091 Bacteria 13144
391 Ga0496101_0096229 3300048904 Bacteria 2210
392 Ga0496102_0020087 3300048905 Bacteria 5897
393 Ga0496102_0048471 3300048905 Bacteria 3862
394 Ga0496102_0101812 3300048905 Bacteria 2669
395 Ga0496103_0004772 3300048906 Bacteria 8193
396 Ga0496103_0082690 3300048906 Bacteria 2021
397 Ga0496103_0102732 3300048906 Bacteria 1810
398 Ga0496104_0138220 3300048907 Bacteria 2341
399 Ga0496104_0792148 3300048907 Bacteria 854
400 Ga0496105_0085383 3300048908 Bacteria 2608
401 Ga0496106_0010233 3300048909 Bacteria 6933
402 Ga0496106_0077636 3300048909 Bacteria 2547
403 Ga0496107_0046923 3300048910 Bacteria 3110
404 Ga0496107_0094607 3300048910 Bacteria 2186
405 Ga0496107_0159193 3300048910 Bacteria 1673
406 Ga0496108_0227322 3300048911 Bacteria 1622
407 Ga0496109_0175913 3300048912 Bacteria 2009
408 Ga0496110_0118093 3300048913 Bacteria 2388
409 Ga0496110_0676186 3300048913 Bacteria 933
410 Ga0496111_0001230 3300048914 Bacteria 14311
411 Ga0496112_0432296 3300048915 Bacteria 1255
412 Ga0496113_0457175 3300048916 Bacteria 1026
413 Ga0496117_0000001 3300048920 Bacteria 2526244
414 Ga0496118_0000078 3300048921 Bacteria 190946
415 Ga0496120_0029617 3300048923 Bacteria 3341
416 Ga0496121_0004875 3300048924 Bacteria 17620
417 Ga0496121_0005928 3300048924 Bacteria 15460
418 Ga0496122_0005070 3300048925 Bacteria 15911
419 Ga0496123_0005445 3300048926 Bacteria 12818
420 Ga0496124_0061850 3300048927 Bacteria 3136
421 Ga0496124_0102283 3300048927 Bacteria 2319
422 Ga0495678_003499 3300049459 Bacteria 9661
423 Ga0495682_0000216 3300049460 Bacteria 45881
424 Ga0495682_0001577 3300049460 Bacteria 11879
425 Ga0495682_0007567 3300049460 Bacteria 4313
426 Ga0501031_0063460 3300049568 Bacteria 2406
427 Ga0501032_0058089 3300049569 Bacteria 2597
428 Ga0501032_0272510 3300049569 Bacteria 1096
429 Ga0501033_0001387 3300049570 Bacteria 21551
430 Ga0501033_0012028 3300049570 Bacteria 6608
431 Ga0501034_0105544 3300049571 Bacteria 2810
432 Ga0501036_0013017 3300049572 Bacteria 6906
433 Ga0501037_0003605 3300049573 Bacteria 11225
434 Ga0501037_0024368 3300049573 Bacteria 4475
435 Ga0501037_0274402 3300049573 Bacteria 1176
436 Ga0501038_0051184 3300049574 Bacteria 3566
437 Ga0501039_0060263 3300049575 Bacteria 2939
438 Ga0501039_0568366 3300049575 Bacteria 889
439 Ga0501040_0233799 3300049576 Bacteria 1309
440 Ga0501042_0184724 3300049578 Bacteria 1504
441 Ga0501042_0409294 3300049578 Bacteria 983
442 Ga0501043_0057602 3300049579 Bacteria 3051
443 Ga0501046_0016244 3300049580 Bacteria 6241
444 Ga0501047_0044503 3300049581 Bacteria 4289
445 Ga0501047_0085957 3300049581 Bacteria 3021
446 Ga0501047_0170540 3300049581 Bacteria 2045
447 Ga0501047_0267825 3300049581 Bacteria 1555
448 Ga0501048_0004184 3300049582 Bacteria 11002
449 Ga0501048_0017935 3300049582 Bacteria 5208
450 Ga0501048_0571992 3300049582 Unclassified 811
451 Ga0501067_0017640 3300049583 Bacteria 3951
452 Ga0501067_0024972 3300049583 Bacteria 3314
453 Ga0501067_0262435 3300049583 Bacteria 962
454 Ga0501068_0024454 3300049584 Bacteria 3547
455 Ga0501068_0035268 3300049584 Bacteria 2985
456 Ga0501068_0235622 3300049584 Bacteria 1164
457 Ga0501069_0017731 3300049585 Bacteria 3837
458 Ga0501070_0003195 3300049586 Bacteria 14252
459 Ga0501071_0002972 3300049587 Bacteria 10479
460 Ga0501071_0058235 3300049587 Bacteria 2793
461 Ga0501072_0249406 3300049588 Bacteria 1414
462 Ga0501073_0049230 3300049589 Bacteria 2956
463 Ga0501074_0023766 3300049590 Bacteria 4455
464 Ga0501074_0035557 3300049590 Bacteria 3609
465 Ga0501076_0397592 3300049592 Bacteria 1133
466 Ga0501216_057717 3300049660 Bacteria 776
467 Ga0501230_041489 3300049667 Bacteria 892
468 Ga0501235_059783 3300049669 Bacteria 892
469 Ga0501079_0018785 3300049741 Bacteria 5281
470 Ga0501079_0126109 3300049741 Bacteria 1991
471 Ga0501079_0293235 3300049741 Bacteria 1272
472 Ga0501080_0002713 3300049742 Bacteria 15518
473 Ga0501080_0909007 3300049742 Bacteria 767
474 Ga0501081_0532807 3300049743 Bacteria 876
475 Ga0501083_0010555 3300049744 Bacteria 6501
476 Ga0501280_023205 3300049776 Bacteria 935
477 Ga0501035_0001776 3300049822 Bacteria 21781
478 Ga0501035_0005816 3300049822 Bacteria 11625
479 Ga0501035_0010765 3300049822 Bacteria 8469
480 Ga0501035_0034886 3300049822 Bacteria 4569
481 Ga0501044_0031713 3300049823 Bacteria 5559
482 Ga0501044_0032570 3300049823 Bacteria 5478
483 Ga0501044_0105714 3300049823 Bacteria 2827
484 Ga0501044_0212469 3300049823 Bacteria 1888
485 Ga0501045_0104004 3300049824 Bacteria 2103
486 nmdc:mga05p37_182560_c1 3300050507 Bacteria 2552
487 nmdc:mga09592_37979_c1 3300050508 Bacteria 4041
488 nmdc:mga0qj67_132180_c1 3300050509 Bacteria 2021
489 nmdc:mga0qj67_19321_c1 3300050509 Bacteria 5204
490 nmdc:mga06r32_108372_c1 3300050510 Bacteria 2731
491 nmdc:mga06r32_12823_c1 3300050510 Bacteria 7576
492 Ga0500562_008906 3300053108 Bacteria 2535
493 Ga0500607_048122 3300053121 Bacteria 2281
494 Ga0500622_0008862 3300053156 Bacteria 5599
495 Ga0500634_0000507 3300053161 Bacteria 12661
496 Ga0501084_0013177 3300054114 Bacteria 6840
497 Ga0501082_0023892 3300060353 Bacteria 5270
498 Ga0501082_0088157 3300060353 Bacteria 2677
499 2513910859 2513237144 Bacteria 7530820
500 2513927222 2513237146 Bacteria 7166346
501 2558862617 2558860100 Bacteria 8458965
502 2599415337 2599185170 Bacteria 7295545
503 2599501623 2599185188 Bacteria 6164180
504 2599931455 2599185300 Bacteria 6062622
505 2601667423 2600255292 Bacteria 6300551
506 2644031420 2643221603 Bacteria 6147767
507 2738740513 2738541280 Bacteria 6630198
508 2738843234 2738541300 Bacteria 6675882
509 2739272129 2738543018 Bacteria 6718814
510 2739341173 2738543030 Bacteria 6719714
511 2794597979 2791355520 Bacteria 5948615
512 2812478081 2811994917 Bacteria 7761064
513 2838038938 2838035591 Bacteria 7166484
514 2838664472 2838661181 Bacteria 7385261
515 2855022095 2855020534 Bacteria 3204685
516 2855872831 2855872281 Bacteria 6964271
517 2857551855 2857547612 Bacteria 6179999
518 2874123955 2874123672 Bacteria 7238285
519 2885080711 2885080285 Bacteria 6355622
520 2887376676 2887375801 Bacteria 5334027
521 2896385500 2896384573 Bacteria 7700774
522 2908813856 2908811453 Bacteria 5478616
523 2909042694 2909042592 Bacteria 6499737
524 2919707876 2919704043 Bacteria 5560311
525 2929203918 2929199973 Bacteria 7260745
526 2932411035 2932410948 Bacteria 6312192
527 2932419398 2932416698 Bacteria 6315112
528 2933022957 2933016740 Bacteria 6355406
529 3005413793 3005409236 Bacteria 7188837
530 3007256448 3007252601 Bacteria 4559114
531 643824818 643692032 Bacteria 6891900
532 8054565569 8054563764 Bacteria 5592885
533 8055912936 8055909800 Bacteria 7278581
534 Ga0395900_0043698
535 RicEn_C444
536 JGI24751J29686_10004051
537 JGI25151J46595_10001469
538 rootL2_10059569
539 Ga0065165_1048364
540 Ga0070658_10003510
541 Ga0070658_10032167
542 Ga0070658_10120021
543 Ga0070683_100293566
544 Ga0070670_100036907
545 Ga0070670_100206974
546 Ga0068869_100352458
547 Ga0070680_100292636
548 Ga0070660_100010200
549 Ga0070660_100011394
550 Ga0070661_100140526
551 Ga0070661_100248692
552 Ga0070659_100181481
553 Ga0070667_100000851
554 Ga0070663_100000180
555 Ga0070662_100190010
556 Ga0070662_100411368
557 Ga0070679_100012972
558 Ga0068853_100010135
559 Ga0068853_100084593
560 Ga0068855_100004604
561 Ga0068855_100016254
562 Ga0068855_100096742
563 Ga0070664_100595025
564 Ga0068857_100000339
565 Ga0068857_100234794
566 Ga0068852_100108324
567 Ga0068859_100005767
568 Ga0068861_100000333
569 Ga0068863_100004683
570 Ga0068858_100466182
571 Ga0068860_100012224
572 Ga0068862_100001937
573 Ga0081539_10087317
574 Ga0075430_100095644
575 Ga0075431_100020612
576 Ga0075431_100164306
577 Ga0075429_100282907
578 Ga0097620_100005767
579 Ga0075435_100406083
580 Ga0105240_10025479
581 Ga0105247_10406646
582 Ga0114129_10101187
583 Ga0114129_10615938
584 Ga0105243_10081577
585 Ga0105241_10036138
586 Ga0105242_10023709
587 Ga0105248_10000157
588 Ga0105238_10335831
589 Ga0105249_10003342
590 Ga0105239_10777130
591 Ga0105239_10841366
592 Ga0157371_10440402
593 Ga0157370_10000427
594 Ga0157369_10001398
595 Ga0157374_10382670
596 Ga0157372_10102626
597 Ga0163163_10030208
598 Ga0157380_10050766
599 Ga0182008_10000481
600 Ga0182006_1000002
601 Ga0182007_10000045
602 Ga0182005_1000002
603 Ga0214544_1000097
604 Ga0214542_1023744
605 Ga0214543_1012294
606 Ga0214543_1019848
607 Ga0214543_1020933
608 Ga0213876_10000476
609 Ga0213876_10125898
610 Ga0213871_10020536
611 Ga0209129_1000016
612 Ga0209233_1013610
613 Ga0209025_1000126
614 Ga0209051_1006374
615 Ga0207705_10000252
616 Ga0207705_10001741
617 Ga0207705_10061897
618 Ga0207705_10148781
619 Ga0207654_10010235
620 Ga0207695_10163479
621 Ga0207660_10240536
622 Ga0207657_10009070
623 Ga0207657_10076548
624 Ga0207657_10081782
625 Ga0207649_10213246
626 Ga0207652_10005747
627 Ga0207650_10010241
628 Ga0207690_10261855
629 Ga0207706_10124831
630 Ga0207686_10011341
631 Ga0207709_10055364
632 Ga0207711_10004750
633 Ga0207661_10241980
634 Ga0207679_10091651
635 Ga0207679_10411095
636 Ga0207679_10521403
637 Ga0207667_10001409
638 Ga0207712_10000454
639 Ga0207640_10060682
640 Ga0207658_10005952
641 Ga0207639_10082821
642 Ga0207639_10102020
643 Ga0207678_10000763
644 Ga0207678_10302395
645 Ga0207678_10320577
646 Ga0207641_10003687
647 Ga0207674_10001295
648 Ga0207674_10261066
649 Ga0207675_100001097
650 Ga0209981_1004301
651 Ga0209996_1008302
652 Ga0210000_1004124
653 Ga0210000_1009700
654 Ga0209971_1011867
655 Ga0268265_10000535
656 Ga0268264_10003100
657 Ga0307408_100001181
658 Ga0307408_100086373
659 Ga0307408_100195737
660 Ga0307408_100332068
661 Ga0307408_100366871
662 Ga0307405_10285846
663 Ga0307406_10441986
664 Ga0307407_10244609
665 Ga0307412_10144704
666 Ga0307412_10555253
667 Ga0307412_10767053
668 Ga0307409_100352411
669 Ga0307416_100065516
670 Ga0307416_100267355
671 Ga0307416_100985828
672 Ga0307414_10624450
673 Ga0307411_10064261
674 Ga0307411_10285911
675 Ga0307415_100010090
676 Ga0316582_0011908
677 Ga0316584_0363934
678 Ga0395899_0002075
679 Ga0395899_0002873
680 Ga0395899_0008200
681 Ga0395899_0016039
682 Ga0395899_0016354
683 Ga0395899_0118617
684 Ga0395899_0331402
685 Ga0395900_0000569
686 Ga0395900_0009601
687 Ga0395900_0013459
688 Ga0395900_0026670
689 Ga0395900_0030998
690 Ga0395900_0098654
691 Ga0395900_0176705
692 Ga0395900_0228873
693 Ga0395898_0012134
694 Ga0395898_0027211
695 Ga0395898_0029282
696 Ga0395898_0057592
697 Ga0395898_0141739
698 Ga0395898_0208894
699 Ga0395898_0457682
700 Ga0395905_0005689
701 Ga0395905_0012499
702 Ga0395905_0027702
703 Ga0395905_0054836
704 Ga0395905_0083920
705 Ga0395905_0115454
706 Ga0395905_1003571
707 Ga0436364_1038359
708 Ga0395901_0000378
709 Ga0395901_0020945
710 Ga0395901_0043729
711 Ga0395901_0121840
712 Ga0395901_0129032
713 Ga0395901_0244345
714 Ga0395901_0271935
715 Ga0395901_0301521
716 Ga0395901_0355954
717 Ga0395901_0527522
718 Ga0400483_051407
719 Ga0400483_289189
720 Ga0436365_0090629
721 Ga0436365_0715113
722 Ga0436365_1933157
723 Ga0436360_0174938
724 Ga0436360_0214974
725 Ga0436362_0159667
726 Ga0439438_000008
727 Ga0439453_0034815
728 Ga0439466_0017581
729 Ga0439466_0025382
730 Ga0439466_0031328
731 Ga0439466_0071812
732 Ga0439465_0004054
733 Ga0439431_0000002
734 Ga0439443_011861
735 Ga0439448_0001414
736 Ga0439432_010853
737 Ga0439432_036004
738 Ga0439449_0017368
739 Ga0439449_0033351
740 Ga0439455_0002920
741 Ga0439456_009770
742 Ga0450902_024144
743 Ga0450910_000042
744 Ga0439446_0000152
745 Ga0439435_0003559
746 Ga0439444_0012362
747 Ga0450893_0048874
748 Ga0451577_0106038
749 Ga0451577_0195958
750 Ga0451577_0452846
751 Ga0451577_0831085
752 Ga0466972_0004009
753 Ga0466972_0035510
754 Ga0453683_0080462
755 Ga0466965_0016618
756 Ga0466965_0044371
757 Ga0466965_0046083
758 Ga0466965_0070189
759 Ga0466966_0006853
760 Ga0466966_0060776
761 Ga0466964_0000165
762 Ga0466964_0013068
763 Ga0466964_0023135
764 Ga0466964_0083251
765 Ga0453684_0005063
766 Ga0453684_0018189
767 Ga0453684_0018355
768 Ga0453684_0045911
769 Ga0453684_0095208
770 Ga0453684_0414727
771 Ga0466968_0000780
772 Ga0466968_0033640
773 Ga0466970_0219065
774 Ga0466957_0000050
775 Ga0466957_0203082
776 Ga0466960_0037986
777 Ga0466959_0522628
778 Ga0451576_0073373
779 Ga0451576_0162592
780 Ga0451576_0184815
781 Ga0451576_0784635
782 Ga0451576_0952408
783 Ga0466958_0058681
784 Ga0466958_0081765
785 Ga0495617_001319
786 Ga0495617_005883
787 Ga0495617_074824
788 Ga0495590_0005255
789 Ga0495590_0110122
790 Ga0495638_0001049
791 Ga0495638_0040005
792 Ga0495638_0156221
793 Ga0495605_0000667
794 Ga0495605_0061485
795 Ga0495639_0294235
796 Ga0495584_0000887
797 Ga0495584_0001572
798 Ga0495584_0032936
799 Ga0495585_0000032
800 Ga0495585_0001004
801 Ga0495585_0005054
802 Ga0495585_0005316
803 Ga0495585_0018054
804 Ga0495585_0026492
805 Ga0495585_0034110
806 Ga0495585_0036092
807 Ga0495596_0001900
808 Ga0495607_0030391
809 Ga0495607_0038140
810 Ga0495607_0040162
811 Ga0495607_0063897
812 Ga0495607_0078070
813 Ga0495607_0094971
814 Ga0495583_0000040
815 Ga0495583_0000317
816 Ga0495583_0003229
817 Ga0495583_0007839
818 Ga0495583_0012039
819 Ga0495583_0056678
820 Ga0495606_0002586
821 Ga0495606_0048857
822 Ga0495606_0053096
823 Ga0495616_0000235
824 Ga0495616_0003225
825 Ga0495616_0011752
826 Ga0495616_0040417
827 Ga0495620_0002480
828 Ga0495631_0003779
829 Ga0495631_0027068
830 Ga0495637_0035958
831 Ga0495643_0000929
832 Ga0495643_0007806
833 Ga0495643_0009548
834 Ga0495644_0000073
835 Ga0495644_0001674
836 Ga0495644_0054679
837 Ga0495648_0021612
838 Ga0495648_0129881
839 Ga0495648_0216140
840 Ga0495663_0013835
841 Ga0495642_0016293
842 Ga0495642_0037400
843 Ga0495642_0114299
844 Ga0495654_0005238
845 Ga0495654_0012540
846 Ga0495609_0000131
847 Ga0495609_0000588
848 Ga0495609_0001265
849 Ga0495609_0001762
850 Ga0495621_0052527
851 Ga0495597_0007273
852 Ga0495597_0011490
853 Ga0495622_0005542
854 Ga0495622_0006089
855 Ga0495622_0048675
856 Ga0495622_0072070
857 Ga0495633_0000779
858 Ga0495633_0000801
859 Ga0495633_0002197
860 Ga0495633_0006450
861 Ga0495633_0011022
862 Ga0495633_0157352
863 Ga0495656_0004181
864 Ga0495656_0014135
865 Ga0495656_0284605
866 Ga0495656_0333005
867 Ga0495668_0019224
868 Ga0495668_0028423
869 Ga0495668_0034391
870 Ga0495611_0000240
871 Ga0495611_0001965
872 Ga0495611_0008112
873 Ga0495625_0005695
874 Ga0495625_0024472
875 Ga0495625_0114376
876 Ga0495625_0125924
877 Ga0495625_0255990
878 Ga0495659_0000068
879 Ga0495659_0006414
880 Ga0495661_0000525
881 Ga0495661_0005826
882 Ga0495661_0011728
883 Ga0495661_0064672
884 Ga0495661_0165509
885 Ga0495669_0000608
886 Ga0495670_0000316
887 Ga0495670_0000560
888 Ga0495670_0006509
889 Ga0495671_0000533
890 Ga0495671_0002761
891 Ga0495671_0046919
892 Ga0495660_0007456
893 Ga0495660_0014655
894 Ga0495660_0265875
895 Ga0495636_0000671
896 Ga0495636_0008179
897 Ga0495636_0021154
898 Ga0495636_0073943
899 Ga0495636_0262598
900 Ga0495672_0003809
901 Ga0495672_0004462
902 Ga0495672_0028514
903 Ga0495683_0017210
904 Ga0495683_0022870
905 Ga0495683_0064101
906 Ga0495683_0068382
907 Ga0495683_0109910
908 Ga0495687_002138
909 Ga0495687_045436
910 Ga0495687_059229
911 Ga0495677_0000189
912 Ga0495677_0000352
913 Ga0495677_0003132
914 Ga0495677_0026208
915 Ga0495679_004538
916 Ga0495679_019583
917 Ga0495685_000125
918 Ga0495685_028832
919 Ga0495673_0005278
920 Ga0495681_0003645
921 Ga0495681_0021304
922 Ga0495615_0009653
923 Ga0495626_0002377
924 Ga0496101_0096229
925 Ga0496102_0020087
926 Ga0496102_0048471
927 Ga0496102_0101812
928 Ga0496103_0004772
929 Ga0496103_0082690
930 Ga0496103_0102732
931 Ga0496104_0138220
932 Ga0496104_0792148
933 Ga0496105_0085383
934 Ga0496106_0010233
935 Ga0496106_0077636
936 Ga0496107_0046923
937 Ga0496107_0094607
938 Ga0496107_0159193
939 Ga0496108_0227322
940 Ga0496109_0175913
941 Ga0496110_0118093
942 Ga0496110_0676186
943 Ga0496111_0001230
944 Ga0496112_0432296
945 Ga0496113_0457175
946 Ga0496117_0000001
947 Ga0496118_0000078
948 Ga0496120_0029617
949 Ga0496121_0004875
950 Ga0496121_0005928
951 Ga0496122_0005070
952 Ga0496123_0005445
953 Ga0496124_0061850
954 Ga0496124_0102283
955 Ga0495678_003499
956 Ga0495682_0000216
957 Ga0495682_0001577
958 Ga0495682_0007567
959 Ga0501031_0063460
960 Ga0501032_0058089
961 Ga0501032_0272510
962 Ga0501033_0001387
963 Ga0501033_0012028
964 Ga0501034_0105544
965 Ga0501036_0013017
966 Ga0501037_0003605
967 Ga0501037_0024368
968 Ga0501037_0274402
969 Ga0501038_0051184
970 Ga0501039_0060263
971 Ga0501039_0568366
972 Ga0501040_0233799
973 Ga0501042_0184724
974 Ga0501042_0409294
975 Ga0501043_0057602
976 Ga0501046_0016244
977 Ga0501047_0044503
978 Ga0501047_0085957
979 Ga0501047_0170540
980 Ga0501047_0267825
981 Ga0501048_0004184
982 Ga0501048_0017935
983 Ga0501048_0571992
984 Ga0501067_0017640
985 Ga0501067_0024972
986 Ga0501067_0262435
987 Ga0501068_0024454
988 Ga0501068_0035268
989 Ga0501068_0235622
990 Ga0501069_0017731
991 Ga0501070_0003195
992 Ga0501071_0002972
993 Ga0501071_0058235
994 Ga0501072_0249406
995 Ga0501073_0049230
996 Ga0501074_0023766
997 Ga0501074_0035557
998 Ga0501076_0397592
999 Ga0501216_057717
1000 Ga0501230_041489
1001 Ga0501235_059783
1002 Ga0501079_0018785
1003 Ga0501079_0126109
1004 Ga0501079_0293235
1005 Ga0501080_0002713
1006 Ga0501080_0909007
1007 Ga0501081_0532807
1008 Ga0501083_0010555
1009 Ga0501280_023205
1010 Ga0501035_0001776
1011 Ga0501035_0005816
1012 Ga0501035_0010765
1013 Ga0501035_0034886
1014 Ga0501044_0031713
1015 Ga0501044_0032570
1016 Ga0501044_0105714
1017 Ga0501044_0212469
1018 Ga0501045_0104004
1019 nmdc:mga05p37_182560_c1
1020 nmdc:mga09592_37979_c1
1021 nmdc:mga0qj67_132180_c1
1022 nmdc:mga0qj67_19321_c1
1023 nmdc:mga06r32_108372_c1
1024 nmdc:mga06r32_12823_c1
1025 Ga0500562_008906
1026 Ga0500607_048122
1027 Ga0500622_0008862
1028 Ga0500634_0000507
1029 Ga0501084_0013177
1030 Ga0501082_0023892
1031 Ga0501082_0088157
1032 2513910859
1033 2513927222
1034 2558862617
1035 2599415337
1036 2599501623
1037 2599931455
1038 2601667423
1039 2644031420
1040 2738740513
1041 2738843234
1042 2739272129
1043 2739341173
1044 2794597979
1045 2812478081
1046 2838038938
1047 2838664472
1048 2855022095
1049 2855872831
1050 2857551855
1051 2874123955
1052 2885080711
1053 2887376676
1054 2896385500
1055 2908813856
1056 2909042694
1057 2919707876
1058 2929203918
1059 2932411035
1060 2932419398
1061 2933022957
1062 3005413793
1063 3007256448
1064 643824818
1065 8054565569
1066 8055912936

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

20

198

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vop-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from escherichia coli 0.9742 4 207
6voq-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae 0.9701 4 207
6vop-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from escherichia coli 0.9558 4 207
6voq-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae 0.9518 4 207
6btg-assembly1.cif.gz_A crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis 0.9011 5 210
ID Description Score Start End Superfamily
af_Q46890_7_212_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9716 4 207 3.40.225.10
af_Q46890_7_212_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9578 4 207 3.40.225.10
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9254 8 191 3.40.225.10
6btgA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9011 5 210 3.40.225.10
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.896 8 191 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A6S6T1U4-F1-model_v4 Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases 0.9995 4 95 GO:0005829
GO:0016832
GO:0019323
AF-A0A1G9E7D9-F1-model_v4 3-oxo-tetronate 4-phosphate decarboxylase (EC 2.7.1.217) (EC 4.1.1.104) (3-dehydrotetronate 4-kinase) (3-oxo-tetronate kinase) 0.988 4 210 GO:0005524
GO:0005829
GO:0016301
GO:0016832
GO:0019323
GO:0046872
AF-A0A3D4KR78-F1-model_v4 3-oxo-tetronate 4-phosphate decarboxylase (EC 4.1.1.104) 0.9876 2 210 GO:0005829
GO:0016832
GO:0019323
GO:0046872
AF-A0A3B9EKB3-F1-model_v4 Aldolase 0.987 89 210 GO:0005829
GO:0009086
GO:0016832
GO:0019323
AF-A0A528GYK9-F1-model_v4 Aldolase 0.9852 1 83 GO:0005829
GO:0016832
GO:0019323

Map