F460436
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 533 | 295 | 1066 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0043698|Ga0395900_0043698_3187_3882 |
| Length | 231 |
| Sequence | MEPSALTHVATHVDEHRLREQIVAFGKSLFDRGLTAGSSGNLSARLDDGWLVTPTNASLGSLDPARLSKLDWQGRVLSGDAPSKEAVLHRAVYEERAAAAAIVHLHATHSAAVSCMSGLDADDCIPPLTAYFVMKIGMLPLVPYFRPGDPALANAIRGLAAKHTAVLLANHGPVVSGRSLEAAVHAIEELEETAKLFLLLRGSPTRPLNEAQVAEIRSVFEADARMPGPSI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 32 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 33 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 34 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 58 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 59 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 60 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 61 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 62 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 97 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 99 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 100 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 102 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 103 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 104 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 105 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 106 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 107 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 114 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 115 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 116 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 117 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 118 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 119 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 120 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 121 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 122 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 123 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 124 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 125 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 126 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 127 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 128 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 129 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 130 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 131 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 132 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 133 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 134 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 135 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 136 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 141 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 142 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 143 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 144 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 145 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 146 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 147 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 148 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 197 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 206 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 209 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 210 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 213 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 214 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 215 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 241 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 242 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 256 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 257 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 258 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 259 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 262 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 263 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 264 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 265 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 266 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 267 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 268 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 269 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 270 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 271 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 272 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 273 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 274 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 275 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 276 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 277 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 278 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 279 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 280 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 281 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 282 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 283 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 284 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 285 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 286 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 287 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 288 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 289 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 290 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 291 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 292 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 293 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 294 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 295 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.43 |
| Metatranscriptomes | 0 |
| Isolates | 6.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.06 |
| Nodule | 3 |
| Rhizoplane | 4.69 |
| Rhizosphere | 83.86 |
| Stem | 0 |
| Stem Tuber | 0.19 |
| Unclassified | 0.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0043698 | 3300037418 | Bacteria | 4619 |
| 2 | RicEn_C444 | 2010549000 | Bacteria | 1326 |
| 3 | JGI24751J29686_10004051 | 3300002459 | Bacteria | 2966 |
| 4 | JGI25151J46595_10001469 | 3300003187 | Bacteria | 15924 |
| 5 | rootL2_10059569 | 3300003322 | Bacteria | 6557 |
| 6 | Ga0065165_1048364 | 3300005262 | Bacteria | 1222 |
| 7 | Ga0070658_10003510 | 3300005327 | Bacteria | 12884 |
| 8 | Ga0070658_10032167 | 3300005327 | Bacteria | 4218 |
| 9 | Ga0070658_10120021 | 3300005327 | Bacteria | 2184 |
| 10 | Ga0070683_100293566 | 3300005329 | Bacteria | 1546 |
| 11 | Ga0070670_100036907 | 3300005331 | Bacteria | 4205 |
| 12 | Ga0070670_100206974 | 3300005331 | Bacteria | 1705 |
| 13 | Ga0068869_100352458 | 3300005334 | Bacteria | 1200 |
| 14 | Ga0070680_100292636 | 3300005336 | Bacteria | 1380 |
| 15 | Ga0070660_100010200 | 3300005339 | Bacteria | 6633 |
| 16 | Ga0070660_100011394 | 3300005339 | Bacteria | 6315 |
| 17 | Ga0070661_100140526 | 3300005344 | Bacteria | 1819 |
| 18 | Ga0070661_100248692 | 3300005344 | Bacteria | 1371 |
| 19 | Ga0070659_100181481 | 3300005366 | Bacteria | 1727 |
| 20 | Ga0070667_100000851 | 3300005367 | Bacteria | 28385 |
| 21 | Ga0070663_100000180 | 3300005455 | Bacteria | 32121 |
| 22 | Ga0070662_100190010 | 3300005457 | Bacteria | 1623 |
| 23 | Ga0070662_100411368 | 3300005457 | Bacteria | 1117 |
| 24 | Ga0070679_100012972 | 3300005530 | Bacteria | 7982 |
| 25 | Ga0068853_100010135 | 3300005539 | Bacteria | 7616 |
| 26 | Ga0068853_100084593 | 3300005539 | Bacteria | 2780 |
| 27 | Ga0068855_100004604 | 3300005563 | Bacteria | 16834 |
| 28 | Ga0068855_100016254 | 3300005563 | Bacteria | 8949 |
| 29 | Ga0068855_100096742 | 3300005563 | Bacteria | 3400 |
| 30 | Ga0070664_100595025 | 3300005564 | Bacteria | 1025 |
| 31 | Ga0068857_100000339 | 3300005577 | Bacteria | 32219 |
| 32 | Ga0068857_100234794 | 3300005577 | Bacteria | 1678 |
| 33 | Ga0068852_100108324 | 3300005616 | Bacteria | 2521 |
| 34 | Ga0068859_100005767 | 3300005617 | Bacteria | 12590 |
| 35 | Ga0068861_100000333 | 3300005719 | Bacteria | 26666 |
| 36 | Ga0068863_100004683 | 3300005841 | Bacteria | 13479 |
| 37 | Ga0068858_100466182 | 3300005842 | Bacteria | 1218 |
| 38 | Ga0068860_100012224 | 3300005843 | Bacteria | 8459 |
| 39 | Ga0068862_100001937 | 3300005844 | Bacteria | 18793 |
| 40 | Ga0081539_10087317 | 3300005985 | Bacteria | 1621 |
| 41 | Ga0075430_100095644 | 3300006846 | Bacteria | 2482 |
| 42 | Ga0075431_100020612 | 3300006847 | Bacteria | 6737 |
| 43 | Ga0075431_100164306 | 3300006847 | Bacteria | 2282 |
| 44 | Ga0075429_100282907 | 3300006880 | Bacteria | 1452 |
| 45 | Ga0097620_100005767 | 3300006931 | Bacteria | 12590 |
| 46 | Ga0075435_100406083 | 3300007076 | Bacteria | 1172 |
| 47 | Ga0105240_10025479 | 3300009093 | Bacteria | 7771 |
| 48 | Ga0105247_10406646 | 3300009101 | Unclassified | 971 |
| 49 | Ga0114129_10101187 | 3300009147 | Bacteria | 3988 |
| 50 | Ga0114129_10615938 | 3300009147 | Bacteria | 1405 |
| 51 | Ga0105243_10081577 | 3300009148 | Bacteria | 2641 |
| 52 | Ga0105241_10036138 | 3300009174 | Bacteria | 3717 |
| 53 | Ga0105242_10023709 | 3300009176 | Bacteria | 4838 |
| 54 | Ga0105248_10000157 | 3300009177 | Bacteria | 79064 |
| 55 | Ga0105238_10335831 | 3300009551 | Unclassified | 1499 |
| 56 | Ga0105249_10003342 | 3300009553 | Bacteria | 13886 |
| 57 | Ga0105239_10777130 | 3300010375 | Bacteria | 1097 |
| 58 | Ga0105239_10841366 | 3300010375 | Bacteria | 1052 |
| 59 | Ga0157371_10440402 | 3300013102 | Bacteria | 957 |
| 60 | Ga0157370_10000427 | 3300013104 | Bacteria | 52545 |
| 61 | Ga0157369_10001398 | 3300013105 | Bacteria | 29621 |
| 62 | Ga0157374_10382670 | 3300013296 | Bacteria | 1402 |
| 63 | Ga0157372_10102626 | 3300013307 | Bacteria | 3267 |
| 64 | Ga0163163_10030208 | 3300014325 | Bacteria | 5218 |
| 65 | Ga0157380_10050766 | 3300014326 | Bacteria | 3277 |
| 66 | Ga0182008_10000481 | 3300014497 | Bacteria | 30439 |
| 67 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 68 | Ga0182007_10000045 | 3300015262 | Bacteria | 106028 |
| 69 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 70 | Ga0214544_1000097 | 3300021320 | Bacteria | 116548 |
| 71 | Ga0214542_1023744 | 3300021321 | Bacteria | 3586 |
| 72 | Ga0214543_1012294 | 3300021327 | Bacteria | 11473 |
| 73 | Ga0214543_1019848 | 3300021327 | Bacteria | 5634 |
| 74 | Ga0214543_1020933 | 3300021327 | Bacteria | 5108 |
| 75 | Ga0213876_10000476 | 3300021384 | Bacteria | 31958 |
| 76 | Ga0213876_10125898 | 3300021384 | Bacteria | 1361 |
| 77 | Ga0213871_10020536 | 3300021441 | Bacteria | 1638 |
| 78 | Ga0209129_1000016 | 3300025258 | Bacteria | 485491 |
| 79 | Ga0209233_1013610 | 3300025261 | Bacteria | 2319 |
| 80 | Ga0209025_1000126 | 3300025294 | Bacteria | 200866 |
| 81 | Ga0209051_1006374 | 3300025303 | Bacteria | 6670 |
| 82 | Ga0207705_10000252 | 3300025909 | Bacteria | 52384 |
| 83 | Ga0207705_10001741 | 3300025909 | Bacteria | 17244 |
| 84 | Ga0207705_10061897 | 3300025909 | Bacteria | 2703 |
| 85 | Ga0207705_10148781 | 3300025909 | Bacteria | 1753 |
| 86 | Ga0207654_10010235 | 3300025911 | Bacteria | 4773 |
| 87 | Ga0207695_10163479 | 3300025913 | Bacteria | 2155 |
| 88 | Ga0207660_10240536 | 3300025917 | Bacteria | 1426 |
| 89 | Ga0207657_10009070 | 3300025919 | Bacteria | 10043 |
| 90 | Ga0207657_10076548 | 3300025919 | Bacteria | 2822 |
| 91 | Ga0207657_10081782 | 3300025919 | Bacteria | 2712 |
| 92 | Ga0207649_10213246 | 3300025920 | Bacteria | 1371 |
| 93 | Ga0207652_10005747 | 3300025921 | Bacteria | 10067 |
| 94 | Ga0207650_10010241 | 3300025925 | Bacteria | 6426 |
| 95 | Ga0207690_10261855 | 3300025932 | Bacteria | 1340 |
| 96 | Ga0207706_10124831 | 3300025933 | Bacteria | 2264 |
| 97 | Ga0207686_10011341 | 3300025934 | Bacteria | 4878 |
| 98 | Ga0207709_10055364 | 3300025935 | Bacteria | 2450 |
| 99 | Ga0207711_10004750 | 3300025941 | Bacteria | 11535 |
| 100 | Ga0207661_10241980 | 3300025944 | Bacteria | 1601 |
| 101 | Ga0207679_10091651 | 3300025945 | Bacteria | 2352 |
| 102 | Ga0207679_10411095 | 3300025945 | Bacteria | 1192 |
| 103 | Ga0207679_10521403 | 3300025945 | Bacteria | 1063 |
| 104 | Ga0207667_10001409 | 3300025949 | Bacteria | 30094 |
| 105 | Ga0207712_10000454 | 3300025961 | Bacteria | 34905 |
| 106 | Ga0207640_10060682 | 3300025981 | Bacteria | 2501 |
| 107 | Ga0207658_10005952 | 3300025986 | Bacteria | 8329 |
| 108 | Ga0207639_10082821 | 3300026041 | Bacteria | 2544 |
| 109 | Ga0207639_10102020 | 3300026041 | Bacteria | 2321 |
| 110 | Ga0207678_10000763 | 3300026067 | Bacteria | 29365 |
| 111 | Ga0207678_10302395 | 3300026067 | Bacteria | 1375 |
| 112 | Ga0207678_10320577 | 3300026067 | Bacteria | 1333 |
| 113 | Ga0207641_10003687 | 3300026088 | Bacteria | 13496 |
| 114 | Ga0207674_10001295 | 3300026116 | Bacteria | 32659 |
| 115 | Ga0207674_10261066 | 3300026116 | Bacteria | 1679 |
| 116 | Ga0207675_100001097 | 3300026118 | Bacteria | 26813 |
| 117 | Ga0209981_1004301 | 3300027378 | Bacteria | 1865 |
| 118 | Ga0209996_1008302 | 3300027395 | Bacteria | 1360 |
| 119 | Ga0210000_1004124 | 3300027462 | Bacteria | 2100 |
| 120 | Ga0210000_1009700 | 3300027462 | Bacteria | 1419 |
| 121 | Ga0209971_1011867 | 3300027682 | Bacteria | 2062 |
| 122 | Ga0268265_10000535 | 3300028380 | Bacteria | 38794 |
| 123 | Ga0268264_10003100 | 3300028381 | Bacteria | 14391 |
| 124 | Ga0307408_100001181 | 3300031548 | Bacteria | 19768 |
| 125 | Ga0307408_100086373 | 3300031548 | Bacteria | 2358 |
| 126 | Ga0307408_100195737 | 3300031548 | Bacteria | 1632 |
| 127 | Ga0307408_100332068 | 3300031548 | Bacteria | 1284 |
| 128 | Ga0307408_100366871 | 3300031548 | Bacteria | 1227 |
| 129 | Ga0307405_10285846 | 3300031731 | Bacteria | 1244 |
| 130 | Ga0307406_10441986 | 3300031901 | Bacteria | 1041 |
| 131 | Ga0307407_10244609 | 3300031903 | Bacteria | 1226 |
| 132 | Ga0307412_10144704 | 3300031911 | Bacteria | 1746 |
| 133 | Ga0307412_10555253 | 3300031911 | Bacteria | 965 |
| 134 | Ga0307412_10767053 | 3300031911 | Bacteria | 834 |
| 135 | Ga0307409_100352411 | 3300031995 | Bacteria | 1389 |
| 136 | Ga0307416_100065516 | 3300032002 | Bacteria | 2986 |
| 137 | Ga0307416_100267355 | 3300032002 | Bacteria | 1676 |
| 138 | Ga0307416_100985828 | 3300032002 | Bacteria | 945 |
| 139 | Ga0307414_10624450 | 3300032004 | Bacteria | 969 |
| 140 | Ga0307411_10064261 | 3300032005 | Bacteria | 2457 |
| 141 | Ga0307411_10285911 | 3300032005 | Bacteria | 1315 |
| 142 | Ga0307415_100010090 | 3300032126 | Bacteria | 5330 |
| 143 | Ga0316582_0011908 | 3300036647 | Bacteria | 4832 |
| 144 | Ga0316584_0363934 | 3300036712 | Bacteria | 1036 |
| 145 | Ga0395899_0002075 | 3300037312 | Bacteria | 16464 |
| 146 | Ga0395899_0002873 | 3300037312 | Bacteria | 13843 |
| 147 | Ga0395899_0008200 | 3300037312 | Bacteria | 8049 |
| 148 | Ga0395899_0016039 | 3300037312 | Bacteria | 5712 |
| 149 | Ga0395899_0016354 | 3300037312 | Bacteria | 5654 |
| 150 | Ga0395899_0118617 | 3300037312 | Bacteria | 1897 |
| 151 | Ga0395899_0331402 | 3300037312 | Bacteria | 1023 |
| 152 | Ga0395900_0000569 | 3300037418 | Bacteria | 51069 |
| 153 | Ga0395900_0009601 | 3300037418 | Bacteria | 9920 |
| 154 | Ga0395900_0013459 | 3300037418 | Bacteria | 8359 |
| 155 | Ga0395900_0026670 | 3300037418 | Bacteria | 5915 |
| 156 | Ga0395900_0030998 | 3300037418 | Bacteria | 5492 |
| 157 | Ga0395900_0098654 | 3300037418 | Bacteria | 3001 |
| 158 | Ga0395900_0176705 | 3300037418 | Bacteria | 2171 |
| 159 | Ga0395900_0228873 | 3300037418 | Bacteria | 1870 |
| 160 | Ga0395898_0012134 | 3300037466 | Bacteria | 8916 |
| 161 | Ga0395898_0027211 | 3300037466 | Bacteria | 5743 |
| 162 | Ga0395898_0029282 | 3300037466 | Bacteria | 5517 |
| 163 | Ga0395898_0057592 | 3300037466 | Bacteria | 3786 |
| 164 | Ga0395898_0141739 | 3300037466 | Bacteria | 2301 |
| 165 | Ga0395898_0208894 | 3300037466 | Bacteria | 1862 |
| 166 | Ga0395898_0457682 | 3300037466 | Bacteria | 1215 |
| 167 | Ga0395905_0005689 | 3300037471 | Bacteria | 12668 |
| 168 | Ga0395905_0012499 | 3300037471 | Bacteria | 8171 |
| 169 | Ga0395905_0027702 | 3300037471 | Bacteria | 5343 |
| 170 | Ga0395905_0054836 | 3300037471 | Bacteria | 3730 |
| 171 | Ga0395905_0083920 | 3300037471 | Bacteria | 2984 |
| 172 | Ga0395905_0115454 | 3300037471 | Bacteria | 2523 |
| 173 | Ga0395905_1003571 | 3300037471 | Bacteria | 738 |
| 174 | Ga0436364_1038359 | 3300037853 | Bacteria | 3204 |
| 175 | Ga0395901_0000378 | 3300038443 | Bacteria | 53368 |
| 176 | Ga0395901_0020945 | 3300038443 | Bacteria | 6699 |
| 177 | Ga0395901_0043729 | 3300038443 | Bacteria | 4645 |
| 178 | Ga0395901_0121840 | 3300038443 | Bacteria | 2741 |
| 179 | Ga0395901_0129032 | 3300038443 | Bacteria | 2657 |
| 180 | Ga0395901_0244345 | 3300038443 | Bacteria | 1871 |
| 181 | Ga0395901_0271935 | 3300038443 | Bacteria | 1762 |
| 182 | Ga0395901_0301521 | 3300038443 | Bacteria | 1661 |
| 183 | Ga0395901_0355954 | 3300038443 | Bacteria | 1510 |
| 184 | Ga0395901_0527522 | 3300038443 | Bacteria | 1199 |
| 185 | Ga0400483_051407 | 3300039062 | Unclassified | 1649 |
| 186 | Ga0400483_289189 | 3300039062 | Unclassified | 1786 |
| 187 | Ga0436365_0090629 | 3300039437 | Bacteria | 57501 |
| 188 | Ga0436365_0715113 | 3300039437 | Bacteria | 6807 |
| 189 | Ga0436365_1933157 | 3300039437 | Bacteria | 2330 |
| 190 | Ga0436360_0174938 | 3300039438 | Bacteria | 688 |
| 191 | Ga0436360_0214974 | 3300039438 | Bacteria | 2552 |
| 192 | Ga0436362_0159667 | 3300039453 | Bacteria | 889 |
| 193 | Ga0439438_000008 | 3300041405 | Bacteria | 178072 |
| 194 | Ga0439453_0034815 | 3300041408 | Bacteria | 968 |
| 195 | Ga0439466_0017581 | 3300041411 | Bacteria | 2576 |
| 196 | Ga0439466_0025382 | 3300041411 | Bacteria | 2068 |
| 197 | Ga0439466_0031328 | 3300041411 | Bacteria | 1819 |
| 198 | Ga0439466_0071812 | 3300041411 | Bacteria | 1101 |
| 199 | Ga0439465_0004054 | 3300041413 | Bacteria | 4775 |
| 200 | Ga0439431_0000002 | 3300041997 | Bacteria | 63493 |
| 201 | Ga0439443_011861 | 3300042003 | Bacteria | 1283 |
| 202 | Ga0439448_0001414 | 3300042005 | Bacteria | 6194 |
| 203 | Ga0439432_010853 | 3300042006 | Bacteria | 3146 |
| 204 | Ga0439432_036004 | 3300042006 | Bacteria | 1585 |
| 205 | Ga0439449_0017368 | 3300042007 | Bacteria | 2702 |
| 206 | Ga0439449_0033351 | 3300042007 | Bacteria | 1918 |
| 207 | Ga0439455_0002920 | 3300042012 | Bacteria | 3195 |
| 208 | Ga0439456_009770 | 3300042013 | Bacteria | 1979 |
| 209 | Ga0450902_024144 | 3300042137 | Bacteria | 1011 |
| 210 | Ga0450910_000042 | 3300042147 | Bacteria | 13527 |
| 211 | Ga0439446_0000152 | 3300042156 | Bacteria | 12085 |
| 212 | Ga0439435_0003559 | 3300042436 | Bacteria | 3254 |
| 213 | Ga0439444_0012362 | 3300042437 | Bacteria | 1398 |
| 214 | Ga0450893_0048874 | 3300042532 | Bacteria | 789 |
| 215 | Ga0451577_0106038 | 3300042876 | Bacteria | 2512 |
| 216 | Ga0451577_0195958 | 3300042876 | Bacteria | 1823 |
| 217 | Ga0451577_0452846 | 3300042876 | Bacteria | 1165 |
| 218 | Ga0451577_0831085 | 3300042876 | Bacteria | 834 |
| 219 | Ga0466972_0004009 | 3300044658 | Bacteria | 7338 |
| 220 | Ga0466972_0035510 | 3300044658 | Bacteria | 2439 |
| 221 | Ga0453683_0080462 | 3300044673 | Bacteria | 2041 |
| 222 | Ga0466965_0016618 | 3300044683 | Bacteria | 3505 |
| 223 | Ga0466965_0044371 | 3300044683 | Bacteria | 2197 |
| 224 | Ga0466965_0046083 | 3300044683 | Bacteria | 2157 |
| 225 | Ga0466965_0070189 | 3300044683 | Bacteria | 1760 |
| 226 | Ga0466966_0006853 | 3300044684 | Bacteria | 7545 |
| 227 | Ga0466966_0060776 | 3300044684 | Bacteria | 2384 |
| 228 | Ga0466964_0000165 | 3300044706 | Bacteria | 18344 |
| 229 | Ga0466964_0013068 | 3300044706 | Bacteria | 3146 |
| 230 | Ga0466964_0023135 | 3300044706 | Bacteria | 2414 |
| 231 | Ga0466964_0083251 | 3300044706 | Bacteria | 1377 |
| 232 | Ga0453684_0005063 | 3300044712 | Bacteria | 26699 |
| 233 | Ga0453684_0018189 | 3300044712 | Bacteria | 10812 |
| 234 | Ga0453684_0018355 | 3300044712 | Bacteria | 10741 |
| 235 | Ga0453684_0045911 | 3300044712 | Bacteria | 5820 |
| 236 | Ga0453684_0095208 | 3300044712 | Bacteria | 3660 |
| 237 | Ga0453684_0414727 | 3300044712 | Bacteria | 1505 |
| 238 | Ga0466968_0000780 | 3300044735 | Bacteria | 11085 |
| 239 | Ga0466968_0033640 | 3300044735 | Bacteria | 2136 |
| 240 | Ga0466970_0219065 | 3300044765 | Bacteria | 1062 |
| 241 | Ga0466957_0000050 | 3300044842 | Bacteria | 43926 |
| 242 | Ga0466957_0203082 | 3300044842 | Bacteria | 1302 |
| 243 | Ga0466960_0037986 | 3300044901 | Bacteria | 2262 |
| 244 | Ga0466959_0522628 | 3300045049 | Bacteria | 801 |
| 245 | Ga0451576_0073373 | 3300045051 | Bacteria | 3561 |
| 246 | Ga0451576_0162592 | 3300045051 | Bacteria | 2330 |
| 247 | Ga0451576_0184815 | 3300045051 | Bacteria | 2176 |
| 248 | Ga0451576_0784635 | 3300045051 | Bacteria | 1000 |
| 249 | Ga0451576_0952408 | 3300045051 | Bacteria | 900 |
| 250 | Ga0466958_0058681 | 3300045836 | Bacteria | 2340 |
| 251 | Ga0466958_0081765 | 3300045836 | Bacteria | 1988 |
| 252 | Ga0495617_001319 | 3300046452 | Bacteria | 11034 |
| 253 | Ga0495617_005883 | 3300046452 | Bacteria | 4326 |
| 254 | Ga0495617_074824 | 3300046452 | Bacteria | 1111 |
| 255 | Ga0495590_0005255 | 3300046457 | Bacteria | 5137 |
| 256 | Ga0495590_0110122 | 3300046457 | Bacteria | 983 |
| 257 | Ga0495638_0001049 | 3300046460 | Bacteria | 27280 |
| 258 | Ga0495638_0040005 | 3300046460 | Bacteria | 2973 |
| 259 | Ga0495638_0156221 | 3300046460 | Bacteria | 1319 |
| 260 | Ga0495605_0000667 | 3300046474 | Bacteria | 26082 |
| 261 | Ga0495605_0061485 | 3300046474 | Bacteria | 1797 |
| 262 | Ga0495639_0294235 | 3300046475 | Bacteria | 809 |
| 263 | Ga0495584_0000887 | 3300046491 | Bacteria | 19216 |
| 264 | Ga0495584_0001572 | 3300046491 | Bacteria | 13498 |
| 265 | Ga0495584_0032936 | 3300046491 | Bacteria | 2621 |
| 266 | Ga0495585_0000032 | 3300046492 | Bacteria | 143439 |
| 267 | Ga0495585_0001004 | 3300046492 | Bacteria | 23546 |
| 268 | Ga0495585_0005054 | 3300046492 | Bacteria | 8411 |
| 269 | Ga0495585_0005316 | 3300046492 | Bacteria | 8131 |
| 270 | Ga0495585_0018054 | 3300046492 | Bacteria | 4070 |
| 271 | Ga0495585_0026492 | 3300046492 | Bacteria | 3311 |
| 272 | Ga0495585_0034110 | 3300046492 | Bacteria | 2877 |
| 273 | Ga0495585_0036092 | 3300046492 | Bacteria | 2791 |
| 274 | Ga0495596_0001900 | 3300046500 | Bacteria | 11593 |
| 275 | Ga0495607_0030391 | 3300046501 | Bacteria | 3317 |
| 276 | Ga0495607_0038140 | 3300046501 | Bacteria | 2880 |
| 277 | Ga0495607_0040162 | 3300046501 | Bacteria | 2788 |
| 278 | Ga0495607_0063897 | 3300046501 | Bacteria | 2080 |
| 279 | Ga0495607_0078070 | 3300046501 | Bacteria | 1827 |
| 280 | Ga0495607_0094971 | 3300046501 | Bacteria | 1607 |
| 281 | Ga0495583_0000040 | 3300046506 | Bacteria | 236558 |
| 282 | Ga0495583_0000317 | 3300046506 | Bacteria | 76193 |
| 283 | Ga0495583_0003229 | 3300046506 | Bacteria | 12751 |
| 284 | Ga0495583_0007839 | 3300046506 | Bacteria | 6632 |
| 285 | Ga0495583_0012039 | 3300046506 | Bacteria | 4926 |
| 286 | Ga0495583_0056678 | 3300046506 | Bacteria | 1765 |
| 287 | Ga0495606_0002586 | 3300046507 | Bacteria | 20710 |
| 288 | Ga0495606_0048857 | 3300046507 | Bacteria | 2779 |
| 289 | Ga0495606_0053096 | 3300046507 | Bacteria | 2631 |
| 290 | Ga0495616_0000235 | 3300046513 | Bacteria | 44974 |
| 291 | Ga0495616_0003225 | 3300046513 | Bacteria | 10504 |
| 292 | Ga0495616_0011752 | 3300046513 | Bacteria | 5002 |
| 293 | Ga0495616_0040417 | 3300046513 | Bacteria | 2383 |
| 294 | Ga0495620_0002480 | 3300046515 | Bacteria | 10695 |
| 295 | Ga0495631_0003779 | 3300046518 | Bacteria | 8238 |
| 296 | Ga0495631_0027068 | 3300046518 | Bacteria | 2627 |
| 297 | Ga0495637_0035958 | 3300046520 | Bacteria | 2161 |
| 298 | Ga0495643_0000929 | 3300046522 | Bacteria | 30608 |
| 299 | Ga0495643_0007806 | 3300046522 | Bacteria | 6845 |
| 300 | Ga0495643_0009548 | 3300046522 | Bacteria | 6023 |
| 301 | Ga0495644_0000073 | 3300046523 | Bacteria | 49382 |
| 302 | Ga0495644_0001674 | 3300046523 | Bacteria | 8994 |
| 303 | Ga0495644_0054679 | 3300046523 | Bacteria | 1499 |
| 304 | Ga0495648_0021612 | 3300046524 | Bacteria | 4452 |
| 305 | Ga0495648_0129881 | 3300046524 | Bacteria | 1341 |
| 306 | Ga0495648_0216140 | 3300046524 | Bacteria | 949 |
| 307 | Ga0495663_0013835 | 3300046525 | Bacteria | 2256 |
| 308 | Ga0495642_0016293 | 3300046528 | Bacteria | 2895 |
| 309 | Ga0495642_0037400 | 3300046528 | Bacteria | 1964 |
| 310 | Ga0495642_0114299 | 3300046528 | Bacteria | 1156 |
| 311 | Ga0495654_0005238 | 3300046530 | Bacteria | 7567 |
| 312 | Ga0495654_0012540 | 3300046530 | Bacteria | 4549 |
| 313 | Ga0495609_0000131 | 3300046538 | Bacteria | 80952 |
| 314 | Ga0495609_0000588 | 3300046538 | Bacteria | 28544 |
| 315 | Ga0495609_0001265 | 3300046538 | Bacteria | 17299 |
| 316 | Ga0495609_0001762 | 3300046538 | Bacteria | 13898 |
| 317 | Ga0495621_0052527 | 3300046539 | Bacteria | 1461 |
| 318 | Ga0495597_0007273 | 3300046542 | Bacteria | 5640 |
| 319 | Ga0495597_0011490 | 3300046542 | Bacteria | 4292 |
| 320 | Ga0495622_0005542 | 3300046557 | Bacteria | 5851 |
| 321 | Ga0495622_0006089 | 3300046557 | Bacteria | 5604 |
| 322 | Ga0495622_0048675 | 3300046557 | Bacteria | 1969 |
| 323 | Ga0495622_0072070 | 3300046557 | Bacteria | 1594 |
| 324 | Ga0495633_0000779 | 3300046558 | Bacteria | 28510 |
| 325 | Ga0495633_0000801 | 3300046558 | Bacteria | 28059 |
| 326 | Ga0495633_0002197 | 3300046558 | Bacteria | 13967 |
| 327 | Ga0495633_0006450 | 3300046558 | Bacteria | 6953 |
| 328 | Ga0495633_0011022 | 3300046558 | Bacteria | 4904 |
| 329 | Ga0495633_0157352 | 3300046558 | Bacteria | 1048 |
| 330 | Ga0495656_0004181 | 3300046615 | Bacteria | 4928 |
| 331 | Ga0495656_0014135 | 3300046615 | Bacteria | 2986 |
| 332 | Ga0495656_0284605 | 3300046615 | Bacteria | 843 |
| 333 | Ga0495656_0333005 | 3300046615 | Bacteria | 784 |
| 334 | Ga0495668_0019224 | 3300046616 | Bacteria | 3941 |
| 335 | Ga0495668_0028423 | 3300046616 | Bacteria | 3162 |
| 336 | Ga0495668_0034391 | 3300046616 | Bacteria | 2843 |
| 337 | Ga0495611_0000240 | 3300046648 | Bacteria | 37890 |
| 338 | Ga0495611_0001965 | 3300046648 | Bacteria | 9756 |
| 339 | Ga0495611_0008112 | 3300046648 | Bacteria | 4454 |
| 340 | Ga0495625_0005695 | 3300046660 | Bacteria | 11284 |
| 341 | Ga0495625_0024472 | 3300046660 | Bacteria | 4594 |
| 342 | Ga0495625_0114376 | 3300046660 | Bacteria | 1842 |
| 343 | Ga0495625_0125924 | 3300046660 | Bacteria | 1739 |
| 344 | Ga0495625_0255990 | 3300046660 | Bacteria | 1134 |
| 345 | Ga0495659_0000068 | 3300046664 | Bacteria | 46175 |
| 346 | Ga0495659_0006414 | 3300046664 | Bacteria | 3713 |
| 347 | Ga0495661_0000525 | 3300046665 | Bacteria | 39654 |
| 348 | Ga0495661_0005826 | 3300046665 | Bacteria | 8713 |
| 349 | Ga0495661_0011728 | 3300046665 | Bacteria | 5937 |
| 350 | Ga0495661_0064672 | 3300046665 | Bacteria | 2157 |
| 351 | Ga0495661_0165509 | 3300046665 | Bacteria | 1183 |
| 352 | Ga0495669_0000608 | 3300046684 | Bacteria | 15651 |
| 353 | Ga0495670_0000316 | 3300046691 | Bacteria | 22961 |
| 354 | Ga0495670_0000560 | 3300046691 | Bacteria | 17705 |
| 355 | Ga0495670_0006509 | 3300046691 | Bacteria | 5741 |
| 356 | Ga0495671_0000533 | 3300046692 | Bacteria | 28745 |
| 357 | Ga0495671_0002761 | 3300046692 | Bacteria | 10997 |
| 358 | Ga0495671_0046919 | 3300046692 | Bacteria | 2159 |
| 359 | Ga0495660_0007456 | 3300046810 | Bacteria | 6421 |
| 360 | Ga0495660_0014655 | 3300046810 | Bacteria | 4534 |
| 361 | Ga0495660_0265875 | 3300046810 | Bacteria | 790 |
| 362 | Ga0495636_0000671 | 3300047318 | Bacteria | 12512 |
| 363 | Ga0495636_0008179 | 3300047318 | Bacteria | 4125 |
| 364 | Ga0495636_0021154 | 3300047318 | Bacteria | 2625 |
| 365 | Ga0495636_0073943 | 3300047318 | Bacteria | 1459 |
| 366 | Ga0495636_0262598 | 3300047318 | Bacteria | 801 |
| 367 | Ga0495672_0003809 | 3300047320 | Bacteria | 12695 |
| 368 | Ga0495672_0004462 | 3300047320 | Bacteria | 11443 |
| 369 | Ga0495672_0028514 | 3300047320 | Bacteria | 3531 |
| 370 | Ga0495683_0017210 | 3300047323 | Bacteria | 3748 |
| 371 | Ga0495683_0022870 | 3300047323 | Bacteria | 3214 |
| 372 | Ga0495683_0064101 | 3300047323 | Bacteria | 1815 |
| 373 | Ga0495683_0068382 | 3300047323 | Bacteria | 1747 |
| 374 | Ga0495683_0109910 | 3300047323 | Bacteria | 1317 |
| 375 | Ga0495687_002138 | 3300047443 | Bacteria | 16504 |
| 376 | Ga0495687_045436 | 3300047443 | Bacteria | 1901 |
| 377 | Ga0495687_059229 | 3300047443 | Bacteria | 1585 |
| 378 | Ga0495677_0000189 | 3300047445 | Bacteria | 28413 |
| 379 | Ga0495677_0000352 | 3300047445 | Bacteria | 19895 |
| 380 | Ga0495677_0003132 | 3300047445 | Bacteria | 6451 |
| 381 | Ga0495677_0026208 | 3300047445 | Bacteria | 2115 |
| 382 | Ga0495679_004538 | 3300047446 | Bacteria | 6366 |
| 383 | Ga0495679_019583 | 3300047446 | Bacteria | 2374 |
| 384 | Ga0495685_000125 | 3300047447 | Bacteria | 26465 |
| 385 | Ga0495685_028832 | 3300047447 | Bacteria | 1909 |
| 386 | Ga0495673_0005278 | 3300047469 | Bacteria | 7850 |
| 387 | Ga0495681_0003645 | 3300047470 | Bacteria | 10695 |
| 388 | Ga0495681_0021304 | 3300047470 | Bacteria | 3496 |
| 389 | Ga0495615_0009653 | 3300048090 | Bacteria | 1906 |
| 390 | Ga0495626_0002377 | 3300048091 | Bacteria | 13144 |
| 391 | Ga0496101_0096229 | 3300048904 | Bacteria | 2210 |
| 392 | Ga0496102_0020087 | 3300048905 | Bacteria | 5897 |
| 393 | Ga0496102_0048471 | 3300048905 | Bacteria | 3862 |
| 394 | Ga0496102_0101812 | 3300048905 | Bacteria | 2669 |
| 395 | Ga0496103_0004772 | 3300048906 | Bacteria | 8193 |
| 396 | Ga0496103_0082690 | 3300048906 | Bacteria | 2021 |
| 397 | Ga0496103_0102732 | 3300048906 | Bacteria | 1810 |
| 398 | Ga0496104_0138220 | 3300048907 | Bacteria | 2341 |
| 399 | Ga0496104_0792148 | 3300048907 | Bacteria | 854 |
| 400 | Ga0496105_0085383 | 3300048908 | Bacteria | 2608 |
| 401 | Ga0496106_0010233 | 3300048909 | Bacteria | 6933 |
| 402 | Ga0496106_0077636 | 3300048909 | Bacteria | 2547 |
| 403 | Ga0496107_0046923 | 3300048910 | Bacteria | 3110 |
| 404 | Ga0496107_0094607 | 3300048910 | Bacteria | 2186 |
| 405 | Ga0496107_0159193 | 3300048910 | Bacteria | 1673 |
| 406 | Ga0496108_0227322 | 3300048911 | Bacteria | 1622 |
| 407 | Ga0496109_0175913 | 3300048912 | Bacteria | 2009 |
| 408 | Ga0496110_0118093 | 3300048913 | Bacteria | 2388 |
| 409 | Ga0496110_0676186 | 3300048913 | Bacteria | 933 |
| 410 | Ga0496111_0001230 | 3300048914 | Bacteria | 14311 |
| 411 | Ga0496112_0432296 | 3300048915 | Bacteria | 1255 |
| 412 | Ga0496113_0457175 | 3300048916 | Bacteria | 1026 |
| 413 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 414 | Ga0496118_0000078 | 3300048921 | Bacteria | 190946 |
| 415 | Ga0496120_0029617 | 3300048923 | Bacteria | 3341 |
| 416 | Ga0496121_0004875 | 3300048924 | Bacteria | 17620 |
| 417 | Ga0496121_0005928 | 3300048924 | Bacteria | 15460 |
| 418 | Ga0496122_0005070 | 3300048925 | Bacteria | 15911 |
| 419 | Ga0496123_0005445 | 3300048926 | Bacteria | 12818 |
| 420 | Ga0496124_0061850 | 3300048927 | Bacteria | 3136 |
| 421 | Ga0496124_0102283 | 3300048927 | Bacteria | 2319 |
| 422 | Ga0495678_003499 | 3300049459 | Bacteria | 9661 |
| 423 | Ga0495682_0000216 | 3300049460 | Bacteria | 45881 |
| 424 | Ga0495682_0001577 | 3300049460 | Bacteria | 11879 |
| 425 | Ga0495682_0007567 | 3300049460 | Bacteria | 4313 |
| 426 | Ga0501031_0063460 | 3300049568 | Bacteria | 2406 |
| 427 | Ga0501032_0058089 | 3300049569 | Bacteria | 2597 |
| 428 | Ga0501032_0272510 | 3300049569 | Bacteria | 1096 |
| 429 | Ga0501033_0001387 | 3300049570 | Bacteria | 21551 |
| 430 | Ga0501033_0012028 | 3300049570 | Bacteria | 6608 |
| 431 | Ga0501034_0105544 | 3300049571 | Bacteria | 2810 |
| 432 | Ga0501036_0013017 | 3300049572 | Bacteria | 6906 |
| 433 | Ga0501037_0003605 | 3300049573 | Bacteria | 11225 |
| 434 | Ga0501037_0024368 | 3300049573 | Bacteria | 4475 |
| 435 | Ga0501037_0274402 | 3300049573 | Bacteria | 1176 |
| 436 | Ga0501038_0051184 | 3300049574 | Bacteria | 3566 |
| 437 | Ga0501039_0060263 | 3300049575 | Bacteria | 2939 |
| 438 | Ga0501039_0568366 | 3300049575 | Bacteria | 889 |
| 439 | Ga0501040_0233799 | 3300049576 | Bacteria | 1309 |
| 440 | Ga0501042_0184724 | 3300049578 | Bacteria | 1504 |
| 441 | Ga0501042_0409294 | 3300049578 | Bacteria | 983 |
| 442 | Ga0501043_0057602 | 3300049579 | Bacteria | 3051 |
| 443 | Ga0501046_0016244 | 3300049580 | Bacteria | 6241 |
| 444 | Ga0501047_0044503 | 3300049581 | Bacteria | 4289 |
| 445 | Ga0501047_0085957 | 3300049581 | Bacteria | 3021 |
| 446 | Ga0501047_0170540 | 3300049581 | Bacteria | 2045 |
| 447 | Ga0501047_0267825 | 3300049581 | Bacteria | 1555 |
| 448 | Ga0501048_0004184 | 3300049582 | Bacteria | 11002 |
| 449 | Ga0501048_0017935 | 3300049582 | Bacteria | 5208 |
| 450 | Ga0501048_0571992 | 3300049582 | Unclassified | 811 |
| 451 | Ga0501067_0017640 | 3300049583 | Bacteria | 3951 |
| 452 | Ga0501067_0024972 | 3300049583 | Bacteria | 3314 |
| 453 | Ga0501067_0262435 | 3300049583 | Bacteria | 962 |
| 454 | Ga0501068_0024454 | 3300049584 | Bacteria | 3547 |
| 455 | Ga0501068_0035268 | 3300049584 | Bacteria | 2985 |
| 456 | Ga0501068_0235622 | 3300049584 | Bacteria | 1164 |
| 457 | Ga0501069_0017731 | 3300049585 | Bacteria | 3837 |
| 458 | Ga0501070_0003195 | 3300049586 | Bacteria | 14252 |
| 459 | Ga0501071_0002972 | 3300049587 | Bacteria | 10479 |
| 460 | Ga0501071_0058235 | 3300049587 | Bacteria | 2793 |
| 461 | Ga0501072_0249406 | 3300049588 | Bacteria | 1414 |
| 462 | Ga0501073_0049230 | 3300049589 | Bacteria | 2956 |
| 463 | Ga0501074_0023766 | 3300049590 | Bacteria | 4455 |
| 464 | Ga0501074_0035557 | 3300049590 | Bacteria | 3609 |
| 465 | Ga0501076_0397592 | 3300049592 | Bacteria | 1133 |
| 466 | Ga0501216_057717 | 3300049660 | Bacteria | 776 |
| 467 | Ga0501230_041489 | 3300049667 | Bacteria | 892 |
| 468 | Ga0501235_059783 | 3300049669 | Bacteria | 892 |
| 469 | Ga0501079_0018785 | 3300049741 | Bacteria | 5281 |
| 470 | Ga0501079_0126109 | 3300049741 | Bacteria | 1991 |
| 471 | Ga0501079_0293235 | 3300049741 | Bacteria | 1272 |
| 472 | Ga0501080_0002713 | 3300049742 | Bacteria | 15518 |
| 473 | Ga0501080_0909007 | 3300049742 | Bacteria | 767 |
| 474 | Ga0501081_0532807 | 3300049743 | Bacteria | 876 |
| 475 | Ga0501083_0010555 | 3300049744 | Bacteria | 6501 |
| 476 | Ga0501280_023205 | 3300049776 | Bacteria | 935 |
| 477 | Ga0501035_0001776 | 3300049822 | Bacteria | 21781 |
| 478 | Ga0501035_0005816 | 3300049822 | Bacteria | 11625 |
| 479 | Ga0501035_0010765 | 3300049822 | Bacteria | 8469 |
| 480 | Ga0501035_0034886 | 3300049822 | Bacteria | 4569 |
| 481 | Ga0501044_0031713 | 3300049823 | Bacteria | 5559 |
| 482 | Ga0501044_0032570 | 3300049823 | Bacteria | 5478 |
| 483 | Ga0501044_0105714 | 3300049823 | Bacteria | 2827 |
| 484 | Ga0501044_0212469 | 3300049823 | Bacteria | 1888 |
| 485 | Ga0501045_0104004 | 3300049824 | Bacteria | 2103 |
| 486 | nmdc:mga05p37_182560_c1 | 3300050507 | Bacteria | 2552 |
| 487 | nmdc:mga09592_37979_c1 | 3300050508 | Bacteria | 4041 |
| 488 | nmdc:mga0qj67_132180_c1 | 3300050509 | Bacteria | 2021 |
| 489 | nmdc:mga0qj67_19321_c1 | 3300050509 | Bacteria | 5204 |
| 490 | nmdc:mga06r32_108372_c1 | 3300050510 | Bacteria | 2731 |
| 491 | nmdc:mga06r32_12823_c1 | 3300050510 | Bacteria | 7576 |
| 492 | Ga0500562_008906 | 3300053108 | Bacteria | 2535 |
| 493 | Ga0500607_048122 | 3300053121 | Bacteria | 2281 |
| 494 | Ga0500622_0008862 | 3300053156 | Bacteria | 5599 |
| 495 | Ga0500634_0000507 | 3300053161 | Bacteria | 12661 |
| 496 | Ga0501084_0013177 | 3300054114 | Bacteria | 6840 |
| 497 | Ga0501082_0023892 | 3300060353 | Bacteria | 5270 |
| 498 | Ga0501082_0088157 | 3300060353 | Bacteria | 2677 |
| 499 | 2513910859 | 2513237144 | Bacteria | 7530820 |
| 500 | 2513927222 | 2513237146 | Bacteria | 7166346 |
| 501 | 2558862617 | 2558860100 | Bacteria | 8458965 |
| 502 | 2599415337 | 2599185170 | Bacteria | 7295545 |
| 503 | 2599501623 | 2599185188 | Bacteria | 6164180 |
| 504 | 2599931455 | 2599185300 | Bacteria | 6062622 |
| 505 | 2601667423 | 2600255292 | Bacteria | 6300551 |
| 506 | 2644031420 | 2643221603 | Bacteria | 6147767 |
| 507 | 2738740513 | 2738541280 | Bacteria | 6630198 |
| 508 | 2738843234 | 2738541300 | Bacteria | 6675882 |
| 509 | 2739272129 | 2738543018 | Bacteria | 6718814 |
| 510 | 2739341173 | 2738543030 | Bacteria | 6719714 |
| 511 | 2794597979 | 2791355520 | Bacteria | 5948615 |
| 512 | 2812478081 | 2811994917 | Bacteria | 7761064 |
| 513 | 2838038938 | 2838035591 | Bacteria | 7166484 |
| 514 | 2838664472 | 2838661181 | Bacteria | 7385261 |
| 515 | 2855022095 | 2855020534 | Bacteria | 3204685 |
| 516 | 2855872831 | 2855872281 | Bacteria | 6964271 |
| 517 | 2857551855 | 2857547612 | Bacteria | 6179999 |
| 518 | 2874123955 | 2874123672 | Bacteria | 7238285 |
| 519 | 2885080711 | 2885080285 | Bacteria | 6355622 |
| 520 | 2887376676 | 2887375801 | Bacteria | 5334027 |
| 521 | 2896385500 | 2896384573 | Bacteria | 7700774 |
| 522 | 2908813856 | 2908811453 | Bacteria | 5478616 |
| 523 | 2909042694 | 2909042592 | Bacteria | 6499737 |
| 524 | 2919707876 | 2919704043 | Bacteria | 5560311 |
| 525 | 2929203918 | 2929199973 | Bacteria | 7260745 |
| 526 | 2932411035 | 2932410948 | Bacteria | 6312192 |
| 527 | 2932419398 | 2932416698 | Bacteria | 6315112 |
| 528 | 2933022957 | 2933016740 | Bacteria | 6355406 |
| 529 | 3005413793 | 3005409236 | Bacteria | 7188837 |
| 530 | 3007256448 | 3007252601 | Bacteria | 4559114 |
| 531 | 643824818 | 643692032 | Bacteria | 6891900 |
| 532 | 8054565569 | 8054563764 | Bacteria | 5592885 |
| 533 | 8055912936 | 8055909800 | Bacteria | 7278581 |
| 534 | Ga0395900_0043698 | |||
| 535 | RicEn_C444 | |||
| 536 | JGI24751J29686_10004051 | |||
| 537 | JGI25151J46595_10001469 | |||
| 538 | rootL2_10059569 | |||
| 539 | Ga0065165_1048364 | |||
| 540 | Ga0070658_10003510 | |||
| 541 | Ga0070658_10032167 | |||
| 542 | Ga0070658_10120021 | |||
| 543 | Ga0070683_100293566 | |||
| 544 | Ga0070670_100036907 | |||
| 545 | Ga0070670_100206974 | |||
| 546 | Ga0068869_100352458 | |||
| 547 | Ga0070680_100292636 | |||
| 548 | Ga0070660_100010200 | |||
| 549 | Ga0070660_100011394 | |||
| 550 | Ga0070661_100140526 | |||
| 551 | Ga0070661_100248692 | |||
| 552 | Ga0070659_100181481 | |||
| 553 | Ga0070667_100000851 | |||
| 554 | Ga0070663_100000180 | |||
| 555 | Ga0070662_100190010 | |||
| 556 | Ga0070662_100411368 | |||
| 557 | Ga0070679_100012972 | |||
| 558 | Ga0068853_100010135 | |||
| 559 | Ga0068853_100084593 | |||
| 560 | Ga0068855_100004604 | |||
| 561 | Ga0068855_100016254 | |||
| 562 | Ga0068855_100096742 | |||
| 563 | Ga0070664_100595025 | |||
| 564 | Ga0068857_100000339 | |||
| 565 | Ga0068857_100234794 | |||
| 566 | Ga0068852_100108324 | |||
| 567 | Ga0068859_100005767 | |||
| 568 | Ga0068861_100000333 | |||
| 569 | Ga0068863_100004683 | |||
| 570 | Ga0068858_100466182 | |||
| 571 | Ga0068860_100012224 | |||
| 572 | Ga0068862_100001937 | |||
| 573 | Ga0081539_10087317 | |||
| 574 | Ga0075430_100095644 | |||
| 575 | Ga0075431_100020612 | |||
| 576 | Ga0075431_100164306 | |||
| 577 | Ga0075429_100282907 | |||
| 578 | Ga0097620_100005767 | |||
| 579 | Ga0075435_100406083 | |||
| 580 | Ga0105240_10025479 | |||
| 581 | Ga0105247_10406646 | |||
| 582 | Ga0114129_10101187 | |||
| 583 | Ga0114129_10615938 | |||
| 584 | Ga0105243_10081577 | |||
| 585 | Ga0105241_10036138 | |||
| 586 | Ga0105242_10023709 | |||
| 587 | Ga0105248_10000157 | |||
| 588 | Ga0105238_10335831 | |||
| 589 | Ga0105249_10003342 | |||
| 590 | Ga0105239_10777130 | |||
| 591 | Ga0105239_10841366 | |||
| 592 | Ga0157371_10440402 | |||
| 593 | Ga0157370_10000427 | |||
| 594 | Ga0157369_10001398 | |||
| 595 | Ga0157374_10382670 | |||
| 596 | Ga0157372_10102626 | |||
| 597 | Ga0163163_10030208 | |||
| 598 | Ga0157380_10050766 | |||
| 599 | Ga0182008_10000481 | |||
| 600 | Ga0182006_1000002 | |||
| 601 | Ga0182007_10000045 | |||
| 602 | Ga0182005_1000002 | |||
| 603 | Ga0214544_1000097 | |||
| 604 | Ga0214542_1023744 | |||
| 605 | Ga0214543_1012294 | |||
| 606 | Ga0214543_1019848 | |||
| 607 | Ga0214543_1020933 | |||
| 608 | Ga0213876_10000476 | |||
| 609 | Ga0213876_10125898 | |||
| 610 | Ga0213871_10020536 | |||
| 611 | Ga0209129_1000016 | |||
| 612 | Ga0209233_1013610 | |||
| 613 | Ga0209025_1000126 | |||
| 614 | Ga0209051_1006374 | |||
| 615 | Ga0207705_10000252 | |||
| 616 | Ga0207705_10001741 | |||
| 617 | Ga0207705_10061897 | |||
| 618 | Ga0207705_10148781 | |||
| 619 | Ga0207654_10010235 | |||
| 620 | Ga0207695_10163479 | |||
| 621 | Ga0207660_10240536 | |||
| 622 | Ga0207657_10009070 | |||
| 623 | Ga0207657_10076548 | |||
| 624 | Ga0207657_10081782 | |||
| 625 | Ga0207649_10213246 | |||
| 626 | Ga0207652_10005747 | |||
| 627 | Ga0207650_10010241 | |||
| 628 | Ga0207690_10261855 | |||
| 629 | Ga0207706_10124831 | |||
| 630 | Ga0207686_10011341 | |||
| 631 | Ga0207709_10055364 | |||
| 632 | Ga0207711_10004750 | |||
| 633 | Ga0207661_10241980 | |||
| 634 | Ga0207679_10091651 | |||
| 635 | Ga0207679_10411095 | |||
| 636 | Ga0207679_10521403 | |||
| 637 | Ga0207667_10001409 | |||
| 638 | Ga0207712_10000454 | |||
| 639 | Ga0207640_10060682 | |||
| 640 | Ga0207658_10005952 | |||
| 641 | Ga0207639_10082821 | |||
| 642 | Ga0207639_10102020 | |||
| 643 | Ga0207678_10000763 | |||
| 644 | Ga0207678_10302395 | |||
| 645 | Ga0207678_10320577 | |||
| 646 | Ga0207641_10003687 | |||
| 647 | Ga0207674_10001295 | |||
| 648 | Ga0207674_10261066 | |||
| 649 | Ga0207675_100001097 | |||
| 650 | Ga0209981_1004301 | |||
| 651 | Ga0209996_1008302 | |||
| 652 | Ga0210000_1004124 | |||
| 653 | Ga0210000_1009700 | |||
| 654 | Ga0209971_1011867 | |||
| 655 | Ga0268265_10000535 | |||
| 656 | Ga0268264_10003100 | |||
| 657 | Ga0307408_100001181 | |||
| 658 | Ga0307408_100086373 | |||
| 659 | Ga0307408_100195737 | |||
| 660 | Ga0307408_100332068 | |||
| 661 | Ga0307408_100366871 | |||
| 662 | Ga0307405_10285846 | |||
| 663 | Ga0307406_10441986 | |||
| 664 | Ga0307407_10244609 | |||
| 665 | Ga0307412_10144704 | |||
| 666 | Ga0307412_10555253 | |||
| 667 | Ga0307412_10767053 | |||
| 668 | Ga0307409_100352411 | |||
| 669 | Ga0307416_100065516 | |||
| 670 | Ga0307416_100267355 | |||
| 671 | Ga0307416_100985828 | |||
| 672 | Ga0307414_10624450 | |||
| 673 | Ga0307411_10064261 | |||
| 674 | Ga0307411_10285911 | |||
| 675 | Ga0307415_100010090 | |||
| 676 | Ga0316582_0011908 | |||
| 677 | Ga0316584_0363934 | |||
| 678 | Ga0395899_0002075 | |||
| 679 | Ga0395899_0002873 | |||
| 680 | Ga0395899_0008200 | |||
| 681 | Ga0395899_0016039 | |||
| 682 | Ga0395899_0016354 | |||
| 683 | Ga0395899_0118617 | |||
| 684 | Ga0395899_0331402 | |||
| 685 | Ga0395900_0000569 | |||
| 686 | Ga0395900_0009601 | |||
| 687 | Ga0395900_0013459 | |||
| 688 | Ga0395900_0026670 | |||
| 689 | Ga0395900_0030998 | |||
| 690 | Ga0395900_0098654 | |||
| 691 | Ga0395900_0176705 | |||
| 692 | Ga0395900_0228873 | |||
| 693 | Ga0395898_0012134 | |||
| 694 | Ga0395898_0027211 | |||
| 695 | Ga0395898_0029282 | |||
| 696 | Ga0395898_0057592 | |||
| 697 | Ga0395898_0141739 | |||
| 698 | Ga0395898_0208894 | |||
| 699 | Ga0395898_0457682 | |||
| 700 | Ga0395905_0005689 | |||
| 701 | Ga0395905_0012499 | |||
| 702 | Ga0395905_0027702 | |||
| 703 | Ga0395905_0054836 | |||
| 704 | Ga0395905_0083920 | |||
| 705 | Ga0395905_0115454 | |||
| 706 | Ga0395905_1003571 | |||
| 707 | Ga0436364_1038359 | |||
| 708 | Ga0395901_0000378 | |||
| 709 | Ga0395901_0020945 | |||
| 710 | Ga0395901_0043729 | |||
| 711 | Ga0395901_0121840 | |||
| 712 | Ga0395901_0129032 | |||
| 713 | Ga0395901_0244345 | |||
| 714 | Ga0395901_0271935 | |||
| 715 | Ga0395901_0301521 | |||
| 716 | Ga0395901_0355954 | |||
| 717 | Ga0395901_0527522 | |||
| 718 | Ga0400483_051407 | |||
| 719 | Ga0400483_289189 | |||
| 720 | Ga0436365_0090629 | |||
| 721 | Ga0436365_0715113 | |||
| 722 | Ga0436365_1933157 | |||
| 723 | Ga0436360_0174938 | |||
| 724 | Ga0436360_0214974 | |||
| 725 | Ga0436362_0159667 | |||
| 726 | Ga0439438_000008 | |||
| 727 | Ga0439453_0034815 | |||
| 728 | Ga0439466_0017581 | |||
| 729 | Ga0439466_0025382 | |||
| 730 | Ga0439466_0031328 | |||
| 731 | Ga0439466_0071812 | |||
| 732 | Ga0439465_0004054 | |||
| 733 | Ga0439431_0000002 | |||
| 734 | Ga0439443_011861 | |||
| 735 | Ga0439448_0001414 | |||
| 736 | Ga0439432_010853 | |||
| 737 | Ga0439432_036004 | |||
| 738 | Ga0439449_0017368 | |||
| 739 | Ga0439449_0033351 | |||
| 740 | Ga0439455_0002920 | |||
| 741 | Ga0439456_009770 | |||
| 742 | Ga0450902_024144 | |||
| 743 | Ga0450910_000042 | |||
| 744 | Ga0439446_0000152 | |||
| 745 | Ga0439435_0003559 | |||
| 746 | Ga0439444_0012362 | |||
| 747 | Ga0450893_0048874 | |||
| 748 | Ga0451577_0106038 | |||
| 749 | Ga0451577_0195958 | |||
| 750 | Ga0451577_0452846 | |||
| 751 | Ga0451577_0831085 | |||
| 752 | Ga0466972_0004009 | |||
| 753 | Ga0466972_0035510 | |||
| 754 | Ga0453683_0080462 | |||
| 755 | Ga0466965_0016618 | |||
| 756 | Ga0466965_0044371 | |||
| 757 | Ga0466965_0046083 | |||
| 758 | Ga0466965_0070189 | |||
| 759 | Ga0466966_0006853 | |||
| 760 | Ga0466966_0060776 | |||
| 761 | Ga0466964_0000165 | |||
| 762 | Ga0466964_0013068 | |||
| 763 | Ga0466964_0023135 | |||
| 764 | Ga0466964_0083251 | |||
| 765 | Ga0453684_0005063 | |||
| 766 | Ga0453684_0018189 | |||
| 767 | Ga0453684_0018355 | |||
| 768 | Ga0453684_0045911 | |||
| 769 | Ga0453684_0095208 | |||
| 770 | Ga0453684_0414727 | |||
| 771 | Ga0466968_0000780 | |||
| 772 | Ga0466968_0033640 | |||
| 773 | Ga0466970_0219065 | |||
| 774 | Ga0466957_0000050 | |||
| 775 | Ga0466957_0203082 | |||
| 776 | Ga0466960_0037986 | |||
| 777 | Ga0466959_0522628 | |||
| 778 | Ga0451576_0073373 | |||
| 779 | Ga0451576_0162592 | |||
| 780 | Ga0451576_0184815 | |||
| 781 | Ga0451576_0784635 | |||
| 782 | Ga0451576_0952408 | |||
| 783 | Ga0466958_0058681 | |||
| 784 | Ga0466958_0081765 | |||
| 785 | Ga0495617_001319 | |||
| 786 | Ga0495617_005883 | |||
| 787 | Ga0495617_074824 | |||
| 788 | Ga0495590_0005255 | |||
| 789 | Ga0495590_0110122 | |||
| 790 | Ga0495638_0001049 | |||
| 791 | Ga0495638_0040005 | |||
| 792 | Ga0495638_0156221 | |||
| 793 | Ga0495605_0000667 | |||
| 794 | Ga0495605_0061485 | |||
| 795 | Ga0495639_0294235 | |||
| 796 | Ga0495584_0000887 | |||
| 797 | Ga0495584_0001572 | |||
| 798 | Ga0495584_0032936 | |||
| 799 | Ga0495585_0000032 | |||
| 800 | Ga0495585_0001004 | |||
| 801 | Ga0495585_0005054 | |||
| 802 | Ga0495585_0005316 | |||
| 803 | Ga0495585_0018054 | |||
| 804 | Ga0495585_0026492 | |||
| 805 | Ga0495585_0034110 | |||
| 806 | Ga0495585_0036092 | |||
| 807 | Ga0495596_0001900 | |||
| 808 | Ga0495607_0030391 | |||
| 809 | Ga0495607_0038140 | |||
| 810 | Ga0495607_0040162 | |||
| 811 | Ga0495607_0063897 | |||
| 812 | Ga0495607_0078070 | |||
| 813 | Ga0495607_0094971 | |||
| 814 | Ga0495583_0000040 | |||
| 815 | Ga0495583_0000317 | |||
| 816 | Ga0495583_0003229 | |||
| 817 | Ga0495583_0007839 | |||
| 818 | Ga0495583_0012039 | |||
| 819 | Ga0495583_0056678 | |||
| 820 | Ga0495606_0002586 | |||
| 821 | Ga0495606_0048857 | |||
| 822 | Ga0495606_0053096 | |||
| 823 | Ga0495616_0000235 | |||
| 824 | Ga0495616_0003225 | |||
| 825 | Ga0495616_0011752 | |||
| 826 | Ga0495616_0040417 | |||
| 827 | Ga0495620_0002480 | |||
| 828 | Ga0495631_0003779 | |||
| 829 | Ga0495631_0027068 | |||
| 830 | Ga0495637_0035958 | |||
| 831 | Ga0495643_0000929 | |||
| 832 | Ga0495643_0007806 | |||
| 833 | Ga0495643_0009548 | |||
| 834 | Ga0495644_0000073 | |||
| 835 | Ga0495644_0001674 | |||
| 836 | Ga0495644_0054679 | |||
| 837 | Ga0495648_0021612 | |||
| 838 | Ga0495648_0129881 | |||
| 839 | Ga0495648_0216140 | |||
| 840 | Ga0495663_0013835 | |||
| 841 | Ga0495642_0016293 | |||
| 842 | Ga0495642_0037400 | |||
| 843 | Ga0495642_0114299 | |||
| 844 | Ga0495654_0005238 | |||
| 845 | Ga0495654_0012540 | |||
| 846 | Ga0495609_0000131 | |||
| 847 | Ga0495609_0000588 | |||
| 848 | Ga0495609_0001265 | |||
| 849 | Ga0495609_0001762 | |||
| 850 | Ga0495621_0052527 | |||
| 851 | Ga0495597_0007273 | |||
| 852 | Ga0495597_0011490 | |||
| 853 | Ga0495622_0005542 | |||
| 854 | Ga0495622_0006089 | |||
| 855 | Ga0495622_0048675 | |||
| 856 | Ga0495622_0072070 | |||
| 857 | Ga0495633_0000779 | |||
| 858 | Ga0495633_0000801 | |||
| 859 | Ga0495633_0002197 | |||
| 860 | Ga0495633_0006450 | |||
| 861 | Ga0495633_0011022 | |||
| 862 | Ga0495633_0157352 | |||
| 863 | Ga0495656_0004181 | |||
| 864 | Ga0495656_0014135 | |||
| 865 | Ga0495656_0284605 | |||
| 866 | Ga0495656_0333005 | |||
| 867 | Ga0495668_0019224 | |||
| 868 | Ga0495668_0028423 | |||
| 869 | Ga0495668_0034391 | |||
| 870 | Ga0495611_0000240 | |||
| 871 | Ga0495611_0001965 | |||
| 872 | Ga0495611_0008112 | |||
| 873 | Ga0495625_0005695 | |||
| 874 | Ga0495625_0024472 | |||
| 875 | Ga0495625_0114376 | |||
| 876 | Ga0495625_0125924 | |||
| 877 | Ga0495625_0255990 | |||
| 878 | Ga0495659_0000068 | |||
| 879 | Ga0495659_0006414 | |||
| 880 | Ga0495661_0000525 | |||
| 881 | Ga0495661_0005826 | |||
| 882 | Ga0495661_0011728 | |||
| 883 | Ga0495661_0064672 | |||
| 884 | Ga0495661_0165509 | |||
| 885 | Ga0495669_0000608 | |||
| 886 | Ga0495670_0000316 | |||
| 887 | Ga0495670_0000560 | |||
| 888 | Ga0495670_0006509 | |||
| 889 | Ga0495671_0000533 | |||
| 890 | Ga0495671_0002761 | |||
| 891 | Ga0495671_0046919 | |||
| 892 | Ga0495660_0007456 | |||
| 893 | Ga0495660_0014655 | |||
| 894 | Ga0495660_0265875 | |||
| 895 | Ga0495636_0000671 | |||
| 896 | Ga0495636_0008179 | |||
| 897 | Ga0495636_0021154 | |||
| 898 | Ga0495636_0073943 | |||
| 899 | Ga0495636_0262598 | |||
| 900 | Ga0495672_0003809 | |||
| 901 | Ga0495672_0004462 | |||
| 902 | Ga0495672_0028514 | |||
| 903 | Ga0495683_0017210 | |||
| 904 | Ga0495683_0022870 | |||
| 905 | Ga0495683_0064101 | |||
| 906 | Ga0495683_0068382 | |||
| 907 | Ga0495683_0109910 | |||
| 908 | Ga0495687_002138 | |||
| 909 | Ga0495687_045436 | |||
| 910 | Ga0495687_059229 | |||
| 911 | Ga0495677_0000189 | |||
| 912 | Ga0495677_0000352 | |||
| 913 | Ga0495677_0003132 | |||
| 914 | Ga0495677_0026208 | |||
| 915 | Ga0495679_004538 | |||
| 916 | Ga0495679_019583 | |||
| 917 | Ga0495685_000125 | |||
| 918 | Ga0495685_028832 | |||
| 919 | Ga0495673_0005278 | |||
| 920 | Ga0495681_0003645 | |||
| 921 | Ga0495681_0021304 | |||
| 922 | Ga0495615_0009653 | |||
| 923 | Ga0495626_0002377 | |||
| 924 | Ga0496101_0096229 | |||
| 925 | Ga0496102_0020087 | |||
| 926 | Ga0496102_0048471 | |||
| 927 | Ga0496102_0101812 | |||
| 928 | Ga0496103_0004772 | |||
| 929 | Ga0496103_0082690 | |||
| 930 | Ga0496103_0102732 | |||
| 931 | Ga0496104_0138220 | |||
| 932 | Ga0496104_0792148 | |||
| 933 | Ga0496105_0085383 | |||
| 934 | Ga0496106_0010233 | |||
| 935 | Ga0496106_0077636 | |||
| 936 | Ga0496107_0046923 | |||
| 937 | Ga0496107_0094607 | |||
| 938 | Ga0496107_0159193 | |||
| 939 | Ga0496108_0227322 | |||
| 940 | Ga0496109_0175913 | |||
| 941 | Ga0496110_0118093 | |||
| 942 | Ga0496110_0676186 | |||
| 943 | Ga0496111_0001230 | |||
| 944 | Ga0496112_0432296 | |||
| 945 | Ga0496113_0457175 | |||
| 946 | Ga0496117_0000001 | |||
| 947 | Ga0496118_0000078 | |||
| 948 | Ga0496120_0029617 | |||
| 949 | Ga0496121_0004875 | |||
| 950 | Ga0496121_0005928 | |||
| 951 | Ga0496122_0005070 | |||
| 952 | Ga0496123_0005445 | |||
| 953 | Ga0496124_0061850 | |||
| 954 | Ga0496124_0102283 | |||
| 955 | Ga0495678_003499 | |||
| 956 | Ga0495682_0000216 | |||
| 957 | Ga0495682_0001577 | |||
| 958 | Ga0495682_0007567 | |||
| 959 | Ga0501031_0063460 | |||
| 960 | Ga0501032_0058089 | |||
| 961 | Ga0501032_0272510 | |||
| 962 | Ga0501033_0001387 | |||
| 963 | Ga0501033_0012028 | |||
| 964 | Ga0501034_0105544 | |||
| 965 | Ga0501036_0013017 | |||
| 966 | Ga0501037_0003605 | |||
| 967 | Ga0501037_0024368 | |||
| 968 | Ga0501037_0274402 | |||
| 969 | Ga0501038_0051184 | |||
| 970 | Ga0501039_0060263 | |||
| 971 | Ga0501039_0568366 | |||
| 972 | Ga0501040_0233799 | |||
| 973 | Ga0501042_0184724 | |||
| 974 | Ga0501042_0409294 | |||
| 975 | Ga0501043_0057602 | |||
| 976 | Ga0501046_0016244 | |||
| 977 | Ga0501047_0044503 | |||
| 978 | Ga0501047_0085957 | |||
| 979 | Ga0501047_0170540 | |||
| 980 | Ga0501047_0267825 | |||
| 981 | Ga0501048_0004184 | |||
| 982 | Ga0501048_0017935 | |||
| 983 | Ga0501048_0571992 | |||
| 984 | Ga0501067_0017640 | |||
| 985 | Ga0501067_0024972 | |||
| 986 | Ga0501067_0262435 | |||
| 987 | Ga0501068_0024454 | |||
| 988 | Ga0501068_0035268 | |||
| 989 | Ga0501068_0235622 | |||
| 990 | Ga0501069_0017731 | |||
| 991 | Ga0501070_0003195 | |||
| 992 | Ga0501071_0002972 | |||
| 993 | Ga0501071_0058235 | |||
| 994 | Ga0501072_0249406 | |||
| 995 | Ga0501073_0049230 | |||
| 996 | Ga0501074_0023766 | |||
| 997 | Ga0501074_0035557 | |||
| 998 | Ga0501076_0397592 | |||
| 999 | Ga0501216_057717 | |||
| 1000 | Ga0501230_041489 | |||
| 1001 | Ga0501235_059783 | |||
| 1002 | Ga0501079_0018785 | |||
| 1003 | Ga0501079_0126109 | |||
| 1004 | Ga0501079_0293235 | |||
| 1005 | Ga0501080_0002713 | |||
| 1006 | Ga0501080_0909007 | |||
| 1007 | Ga0501081_0532807 | |||
| 1008 | Ga0501083_0010555 | |||
| 1009 | Ga0501280_023205 | |||
| 1010 | Ga0501035_0001776 | |||
| 1011 | Ga0501035_0005816 | |||
| 1012 | Ga0501035_0010765 | |||
| 1013 | Ga0501035_0034886 | |||
| 1014 | Ga0501044_0031713 | |||
| 1015 | Ga0501044_0032570 | |||
| 1016 | Ga0501044_0105714 | |||
| 1017 | Ga0501044_0212469 | |||
| 1018 | Ga0501045_0104004 | |||
| 1019 | nmdc:mga05p37_182560_c1 | |||
| 1020 | nmdc:mga09592_37979_c1 | |||
| 1021 | nmdc:mga0qj67_132180_c1 | |||
| 1022 | nmdc:mga0qj67_19321_c1 | |||
| 1023 | nmdc:mga06r32_108372_c1 | |||
| 1024 | nmdc:mga06r32_12823_c1 | |||
| 1025 | Ga0500562_008906 | |||
| 1026 | Ga0500607_048122 | |||
| 1027 | Ga0500622_0008862 | |||
| 1028 | Ga0500634_0000507 | |||
| 1029 | Ga0501084_0013177 | |||
| 1030 | Ga0501082_0023892 | |||
| 1031 | Ga0501082_0088157 | |||
| 1032 | 2513910859 | |||
| 1033 | 2513927222 | |||
| 1034 | 2558862617 | |||
| 1035 | 2599415337 | |||
| 1036 | 2599501623 | |||
| 1037 | 2599931455 | |||
| 1038 | 2601667423 | |||
| 1039 | 2644031420 | |||
| 1040 | 2738740513 | |||
| 1041 | 2738843234 | |||
| 1042 | 2739272129 | |||
| 1043 | 2739341173 | |||
| 1044 | 2794597979 | |||
| 1045 | 2812478081 | |||
| 1046 | 2838038938 | |||
| 1047 | 2838664472 | |||
| 1048 | 2855022095 | |||
| 1049 | 2855872831 | |||
| 1050 | 2857551855 | |||
| 1051 | 2874123955 | |||
| 1052 | 2885080711 | |||
| 1053 | 2887376676 | |||
| 1054 | 2896385500 | |||
| 1055 | 2908813856 | |||
| 1056 | 2909042694 | |||
| 1057 | 2919707876 | |||
| 1058 | 2929203918 | |||
| 1059 | 2932411035 | |||
| 1060 | 2932419398 | |||
| 1061 | 2933022957 | |||
| 1062 | 3005413793 | |||
| 1063 | 3007256448 | |||
| 1064 | 643824818 | |||
| 1065 | 8054565569 | |||
| 1066 | 8055912936 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vop-assembly1.cif.gz_A | crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from escherichia coli | 0.9742 | 4 | 207 |
| 6voq-assembly1.cif.gz_A | crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae | 0.9701 | 4 | 207 |
| 6vop-assembly1.cif.gz_A | crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from escherichia coli | 0.9558 | 4 | 207 |
| 6voq-assembly1.cif.gz_A | crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae | 0.9518 | 4 | 207 |
| 6btg-assembly1.cif.gz_A | crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis | 0.9011 | 5 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46890_7_212_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9716 | 4 | 207 | 3.40.225.10 |
| af_Q46890_7_212_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9578 | 4 | 207 | 3.40.225.10 |
| af_Q58813_1_180_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9254 | 8 | 191 | 3.40.225.10 |
| 6btgA00 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9011 | 5 | 210 | 3.40.225.10 |
| af_Q58813_1_180_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.896 | 8 | 191 | 3.40.225.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6S6T1U4-F1-model_v4 | Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases | 0.9995 | 4 | 95 |
GO:0005829
GO:0016832 GO:0019323 |
| AF-A0A1G9E7D9-F1-model_v4 | 3-oxo-tetronate 4-phosphate decarboxylase (EC 2.7.1.217) (EC 4.1.1.104) (3-dehydrotetronate 4-kinase) (3-oxo-tetronate kinase) | 0.988 | 4 | 210 |
GO:0005524
GO:0005829 GO:0016301 GO:0016832 GO:0019323 GO:0046872 |
| AF-A0A3D4KR78-F1-model_v4 | 3-oxo-tetronate 4-phosphate decarboxylase (EC 4.1.1.104) | 0.9876 | 2 | 210 |
GO:0005829
GO:0016832 GO:0019323 GO:0046872 |
| AF-A0A3B9EKB3-F1-model_v4 | Aldolase | 0.987 | 89 | 210 |
GO:0005829
GO:0009086 GO:0016832 GO:0019323 |
| AF-A0A528GYK9-F1-model_v4 | Aldolase | 0.9852 | 1 | 83 |
GO:0005829
GO:0016832 GO:0019323 |