F460424

General Info

Members Datasets Scaffolds Average Seq Length
533 306 1066 156

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10981337|Ga0307410_109813372
Length 178
Sequence VTEPPVPAATDTAHAGVDPLEPWPDAVTWRPVSAKLITVELIGRAVWVVVLLAGLLVGLLVDGHWLWRAGMVAVVVLAIWRSIITVRAVKAWGYAERDQDLLVRHGLLIRRLSIVPYARMQYVDVTAGPLERAFRLATVQLHTAAAASDARVPGLPPAEASRLRDRLTALGEDRAEGL

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
97 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
205 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
206 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
209 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
212 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
298 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
302 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
303 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
304 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
305 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
306 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.19
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 6.94
Rhizosphere 89.12
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10981337 3300031852 Bacteria 728
2 JGI25406J46586_10071056 3300003203 Bacteria 1092
3 Ga0070658_10632935 3300005327 Bacteria 928
4 Ga0070676_10507742 3300005328 Bacteria 857
5 Ga0070683_100114414 3300005329 Bacteria 2546
6 Ga0070670_100161420 3300005331 Bacteria 1942
7 Ga0070680_101353584 3300005336 Bacteria 616
8 Ga0068868_100010236 3300005338 Bacteria 6779
9 Ga0068868_100054199 3300005338 Bacteria 3159
10 Ga0068868_100554772 3300005338 Bacteria 1013
11 Ga0070660_100016946 3300005339 Bacteria 5303
12 Ga0070689_100483085 3300005340 Bacteria 1059
13 Ga0070661_100001428 3300005344 Bacteria 16611
14 Ga0070661_100099723 3300005344 Bacteria 2159
15 Ga0070692_10139430 3300005345 Bacteria 1371
16 Ga0070668_100455789 3300005347 Bacteria 1100
17 Ga0070669_100074877 3300005353 Bacteria 2510
18 Ga0070675_100000461 3300005354 Bacteria 27782
19 Ga0070675_100115126 3300005354 Bacteria 2279
20 Ga0070671_101109351 3300005355 Bacteria 695
21 Ga0070659_100050842 3300005366 Bacteria 3258
22 Ga0070659_100150110 3300005366 Bacteria 1901
23 Ga0070667_100502283 3300005367 Bacteria 1112
24 Ga0070709_10166141 3300005434 Bacteria 1538
25 Ga0070709_10225915 3300005434 Bacteria 1337
26 Ga0070714_100004346 3300005435 Bacteria 10681
27 Ga0070714_100008953 3300005435 Bacteria 7834
28 Ga0070714_100447545 3300005435 Bacteria 1226
29 Ga0070714_101332402 3300005435 Bacteria 701
30 Ga0070714_101908641 3300005435 Bacteria 579
31 Ga0070713_100045695 3300005436 Bacteria 3590
32 Ga0070713_100055427 3300005436 Bacteria 3294
33 Ga0070713_100065458 3300005436 Bacteria 3053
34 Ga0070710_10129761 3300005437 Bacteria 1535
35 Ga0070710_10153098 3300005437 Bacteria 1424
36 Ga0070711_100327896 3300005439 Bacteria 1225
37 Ga0070700_100032648 3300005441 Bacteria 3130
38 Ga0070700_100267685 3300005441 Bacteria 1233
39 Ga0070694_100120076 3300005444 Bacteria 1885
40 Ga0070663_100024556 3300005455 Bacteria 4059
41 Ga0070678_100020096 3300005456 Bacteria 4375
42 Ga0070678_100073584 3300005456 Bacteria 2565
43 Ga0070662_100055027 3300005457 Bacteria 2886
44 Ga0070662_100412433 3300005457 Bacteria 1116
45 Ga0070681_10241013 3300005458 Bacteria 1722
46 Ga0068867_100645997 3300005459 Bacteria 928
47 Ga0068867_101528407 3300005459 Bacteria 622
48 Ga0070706_100003381 3300005467 Bacteria 15732
49 Ga0070706_100157851 3300005467 Bacteria 2117
50 Ga0070707_100000441 3300005468 Bacteria 41190
51 Ga0070698_100004600 3300005471 Bacteria 15153
52 Ga0070698_100025458 3300005471 Bacteria 6168
53 Ga0070679_100098489 3300005530 Bacteria 2911
54 Ga0070679_100175465 3300005530 Bacteria 2115
55 Ga0068853_100312599 3300005539 Bacteria 1455
56 Ga0068853_100507296 3300005539 Bacteria 1139
57 Ga0068853_100559389 3300005539 Bacteria 1084
58 Ga0070672_100156940 3300005543 Bacteria 1885
59 Ga0070672_100978911 3300005543 Bacteria 749
60 Ga0070686_100190392 3300005544 Bacteria 1464
61 Ga0070693_100305869 3300005547 Bacteria 1073
62 Ga0070693_100728753 3300005547 Bacteria 728
63 Ga0070665_100068554 3300005548 Bacteria 3557
64 Ga0070704_100355691 3300005549 Bacteria 1238
65 Ga0068855_100072870 3300005563 Bacteria 3991
66 Ga0068855_100734881 3300005563 Bacteria 1054
67 Ga0070664_100002472 3300005564 Bacteria 14886
68 Ga0070664_100210710 3300005564 Bacteria 1736
69 Ga0068857_100934160 3300005577 Bacteria 833
70 Ga0068857_101247191 3300005577 Bacteria 721
71 Ga0068856_100015572 3300005614 Bacteria 7351
72 Ga0068856_100145121 3300005614 Bacteria 2381
73 Ga0070702_100017397 3300005615 Bacteria 3708
74 Ga0068852_100086991 3300005616 Bacteria 2787
75 Ga0068852_100273046 3300005616 Bacteria 1627
76 Ga0068859_100047282 3300005617 Bacteria 4323
77 Ga0068859_100337570 3300005617 Bacteria 1601
78 Ga0068864_100116059 3300005618 Bacteria 2388
79 Ga0068864_100122274 3300005618 Bacteria 2329
80 Ga0068866_10054638 3300005718 Bacteria 2047
81 Ga0068861_101205045 3300005719 Bacteria 732
82 Ga0068851_10145915 3300005834 Bacteria 1290
83 Ga0068863_100472612 3300005841 Bacteria 1232
84 Ga0068863_100517534 3300005841 Bacteria 1176
85 Ga0068858_100057494 3300005842 Bacteria 3595
86 Ga0068858_100155989 3300005842 Bacteria 2148
87 Ga0068858_100228941 3300005842 Bacteria 1762
88 Ga0068860_100051486 3300005843 Bacteria 3919
89 Ga0068862_100203202 3300005844 Bacteria 1787
90 Ga0068862_100224676 3300005844 Bacteria 1701
91 Ga0068862_101187107 3300005844 Bacteria 761
92 Ga0081539_10000348 3300005985 Bacteria 101459
93 Ga0081539_10000981 3300005985 Bacteria 53166
94 Ga0070717_10003490 3300006028 Bacteria 11255
95 Ga0070717_10009949 3300006028 Bacteria 7156
96 Ga0070717_10017901 3300006028 Bacteria 5525
97 Ga0070717_10043197 3300006028 Bacteria 3678
98 Ga0070717_10066415 3300006028 Bacteria 3000
99 Ga0070715_10359526 3300006163 Bacteria 798
100 Ga0070716_100349259 3300006173 Bacteria 1046
101 Ga0070712_100013857 3300006175 Bacteria 5161
102 Ga0070712_100289227 3300006175 Bacteria 1322
103 Ga0070712_100724677 3300006175 Bacteria 849
104 Ga0068871_100254306 3300006358 Bacteria 1531
105 Ga0075428_100271245 3300006844 Bacteria 1825
106 Ga0075428_100639616 3300006844 Bacteria 1135
107 Ga0075428_101163321 3300006844 Bacteria 814
108 Ga0075430_100110143 3300006846 Bacteria 2296
109 Ga0075430_100450407 3300006846 Bacteria 1062
110 Ga0075431_100006775 3300006847 Bacteria 11374
111 Ga0075431_100176255 3300006847 Bacteria 2196
112 Ga0075433_10482330 3300006852 Bacteria 1092
113 Ga0075434_100022241 3300006871 Bacteria 6176
114 Ga0075429_100003480 3300006880 Bacteria 13431
115 Ga0075429_100017849 3300006880 Bacteria 6136
116 Ga0075436_100005120 3300006914 Bacteria 9023
117 Ga0097620_100047282 3300006931 Bacteria 4323
118 Ga0097620_100337552 3300006931 Bacteria 1601
119 Ga0097620_100685194 3300006931 Bacteria 1116
120 Ga0075435_100002239 3300007076 Bacteria 12763
121 Ga0105251_10356919 3300009011 Bacteria 668
122 Ga0105240_11379563 3300009093 Bacteria 741
123 Ga0111539_10005172 3300009094 Bacteria 16906
124 Ga0105245_10002660 3300009098 Bacteria 16088
125 Ga0105245_11611603 3300009098 Bacteria 701
126 Ga0105247_10027794 3300009101 Bacteria 3421
127 Ga0114129_10007471 3300009147 Bacteria 15570
128 Ga0114129_10727019 3300009147 Bacteria 1273
129 Ga0114129_12441369 3300009147 Bacteria 626
130 Ga0105243_10073132 3300009148 Bacteria 2777
131 Ga0105243_10145865 3300009148 Bacteria 2025
132 Ga0105243_10383488 3300009148 Bacteria 1301
133 Ga0105243_10611423 3300009148 Bacteria 1051
134 Ga0105241_10084214 3300009174 Bacteria 2496
135 Ga0105242_10048426 3300009176 Bacteria 3454
136 Ga0105237_10127028 3300009545 Bacteria 2544
137 Ga0105237_10532263 3300009545 Bacteria 1182
138 Ga0105238_10179744 3300009551 Bacteria 2093
139 Ga0105238_10498937 3300009551 Bacteria 1218
140 Ga0105249_11808429 3300009553 Bacteria 684
141 Ga0105239_10074315 3300010375 Bacteria 3737
142 Ga0105239_10254139 3300010375 Bacteria 1974
143 Ga0105239_10569949 3300010375 Bacteria 1290
144 Ga0105246_10035663 3300011119 Bacteria 3326
145 Ga0157369_10006189 3300013105 Bacteria 13887
146 Ga0157374_10146899 3300013296 Bacteria 2290
147 Ga0157374_10230508 3300013296 Bacteria 1819
148 Ga0163162_10051942 3300013306 Bacteria 4115
149 Ga0163162_10426500 3300013306 Bacteria 1458
150 Ga0157372_10253175 3300013307 Bacteria 2044
151 Ga0163163_10176113 3300014325 Bacteria 2186
152 Ga0157377_10006102 3300014745 Bacteria 5722
153 Ga0157379_10192249 3300014968 Bacteria 1844
154 Ga0157376_10237133 3300014969 Bacteria 1698
155 Ga0157376_10601664 3300014969 Bacteria 1094
156 Ga0213873_10000432 3300021358 Bacteria 6771
157 Ga0213876_10002647 3300021384 Bacteria 10462
158 Ga0213875_10000423 3300021388 Bacteria 37021
159 Ga0224572_1000182 3300024225 Bacteria 5831
160 Ga0228598_1060255 3300024227 Bacteria 756
161 Ga0207656_10323975 3300025321 Bacteria 766
162 Ga0207692_10072953 3300025898 Bacteria 1815
163 Ga0207692_10170023 3300025898 Bacteria 1262
164 Ga0207692_10829454 3300025898 Bacteria 606
165 Ga0207710_10108587 3300025900 Bacteria 1316
166 Ga0207645_10219767 3300025907 Bacteria 1252
167 Ga0207705_10748044 3300025909 Bacteria 759
168 Ga0207684_10058262 3300025910 Bacteria 3277
169 Ga0207684_10112874 3300025910 Bacteria 2326
170 Ga0207654_10303148 3300025911 Bacteria 1087
171 Ga0207707_10037454 3300025912 Bacteria 4239
172 Ga0207707_10053410 3300025912 Bacteria 3518
173 Ga0207707_10094870 3300025912 Bacteria 2607
174 Ga0207695_10178257 3300025913 Bacteria 2047
175 Ga0207671_10064738 3300025914 Bacteria 2718
176 Ga0207693_10022520 3300025915 Bacteria 5006
177 Ga0207693_10165093 3300025915 Bacteria 1743
178 Ga0207693_10889179 3300025915 Bacteria 684
179 Ga0207663_10077128 3300025916 Bacteria 2168
180 Ga0207663_10217346 3300025916 Bacteria 1389
181 Ga0207663_10778368 3300025916 Bacteria 761
182 Ga0207660_10077091 3300025917 Bacteria 2439
183 Ga0207662_10019367 3300025918 Bacteria 3871
184 Ga0207657_10023715 3300025919 Bacteria 5706
185 Ga0207657_10029443 3300025919 Bacteria 4998
186 Ga0207649_10378000 3300025920 Bacteria 1055
187 Ga0207652_10053448 3300025921 Bacteria 3469
188 Ga0207652_10069686 3300025921 Bacteria 3053
189 Ga0207646_10001597 3300025922 Bacteria 27663
190 Ga0207681_10106605 3300025923 Bacteria 2031
191 Ga0207694_10063650 3300025924 Bacteria 2873
192 Ga0207694_10101474 3300025924 Bacteria 2280
193 Ga0207650_10120511 3300025925 Bacteria 2042
194 Ga0207659_10020270 3300025926 Bacteria 4393
195 Ga0207659_10408074 3300025926 Bacteria 1137
196 Ga0207687_10006817 3300025927 Bacteria 7526
197 Ga0207687_10036515 3300025927 Bacteria 3348
198 Ga0207700_11601408 3300025928 Bacteria 576
199 Ga0207664_10015316 3300025929 Bacteria 5560
200 Ga0207664_10142493 3300025929 Bacteria 2029
201 Ga0207644_10290017 3300025931 Bacteria 1316
202 Ga0207690_10016255 3300025932 Bacteria 4523
203 Ga0207690_10091389 3300025932 Bacteria 2151
204 Ga0207690_10265545 3300025932 Bacteria 1331
205 Ga0207706_10051737 3300025933 Bacteria 3627
206 Ga0207706_10097137 3300025933 Bacteria 2590
207 Ga0207686_10022881 3300025934 Bacteria 3602
208 Ga0207709_10093736 3300025935 Bacteria 1969
209 Ga0207670_10175070 3300025936 Bacteria 1612
210 Ga0207704_10108861 3300025938 Bacteria 1867
211 Ga0207665_10017872 3300025939 Bacteria 4661
212 Ga0207665_10265439 3300025939 Bacteria 1273
213 Ga0207665_10633658 3300025939 Bacteria 837
214 Ga0207711_10024461 3300025941 Bacteria 5061
215 Ga0207661_10108198 3300025944 Bacteria 2346
216 Ga0207661_10479177 3300025944 Bacteria 1136
217 Ga0207679_10122381 3300025945 Bacteria 2073
218 Ga0207679_10812311 3300025945 Bacteria 853
219 Ga0207667_10019533 3300025949 Bacteria 7561
220 Ga0207667_10170980 3300025949 Bacteria 2233
221 Ga0207668_10004948 3300025972 Bacteria 7839
222 Ga0207668_10031208 3300025972 Bacteria 3508
223 Ga0207668_10518869 3300025972 Bacteria 1028
224 Ga0207640_10370292 3300025981 Bacteria 1157
225 Ga0207677_10033463 3300026023 Bacteria 3318
226 Ga0207677_10166568 3300026023 Bacteria 1718
227 Ga0207677_11367609 3300026023 Bacteria 651
228 Ga0207703_10507158 3300026035 Bacteria 1133
229 Ga0207639_10681626 3300026041 Bacteria 953
230 Ga0207639_11667244 3300026041 Unclassified 598
231 Ga0207678_10041134 3300026067 Bacteria 4007
232 Ga0207708_10030466 3300026075 Bacteria 4090
233 Ga0207702_10004647 3300026078 Bacteria 12138
234 Ga0207702_10041631 3300026078 Bacteria 3852
235 Ga0207641_10169189 3300026088 Bacteria 1993
236 Ga0207641_10427464 3300026088 Bacteria 1276
237 Ga0207641_11205515 3300026088 Bacteria 757
238 Ga0207648_10083336 3300026089 Bacteria 2789
239 Ga0207676_10212853 3300026095 Bacteria 1716
240 Ga0207675_100219155 3300026118 Bacteria 1833
241 Ga0207683_10013837 3300026121 Bacteria 6881
242 Ga0207683_10094058 3300026121 Bacteria 2671
243 Ga0207683_11307161 3300026121 Unclassified 671
244 Ga0207698_10145821 3300026142 Bacteria 2047
245 Ga0207698_10240274 3300026142 Bacteria 1650
246 Ga0268266_10050003 3300028379 Bacteria 3586
247 Ga0265319_1002271 3300028563 Bacteria 10607
248 Ga0265334_10006418 3300028573 Bacteria 5069
249 Ga0265334_10042085 3300028573 Bacteria 1782
250 Ga0265318_10001350 3300028577 Bacteria 14618
251 Ga0265336_10082462 3300028666 Bacteria 959
252 Ga0307517_10241049 3300028786 Bacteria 1073
253 Ga0265338_10123108 3300028800 Bacteria 2063
254 Ga0307511_10066889 3300030521 Bacteria 2673
255 Ga0265760_10155045 3300031090 Bacteria 753
256 Ga0265328_10017216 3300031239 Bacteria 2800
257 Ga0265320_10160665 3300031240 Bacteria 1011
258 Ga0265325_10006975 3300031241 Bacteria 6809
259 Ga0265329_10152278 3300031242 Bacteria 749
260 Ga0265340_10017677 3300031247 Bacteria 3688
261 Ga0265340_10080218 3300031247 Bacteria 1537
262 Ga0265331_10016853 3300031250 Bacteria 3824
263 Ga0265316_10009693 3300031344 Bacteria 8839
264 Ga0307513_10042508 3300031456 Bacteria 5003
265 Ga0265313_10003228 3300031595 Bacteria 13405
266 Ga0265313_10214832 3300031595 Bacteria 795
267 Ga0307516_10038326 3300031730 Bacteria 4784
268 Ga0307516_10052139 3300031730 Bacteria 4007
269 Ga0307405_10033837 3300031731 Bacteria 3036
270 Ga0307405_10775966 3300031731 Bacteria 801
271 Ga0307413_10588853 3300031824 Bacteria 908
272 Ga0307406_10071296 3300031901 Bacteria 2277
273 Ga0307406_10073986 3300031901 Bacteria 2242
274 Ga0307406_10383834 3300031901 Bacteria 1108
275 Ga0307406_10404727 3300031901 Bacteria 1083
276 Ga0307409_100009684 3300031995 Bacteria 5939
277 Ga0307409_100517772 3300031995 Bacteria 1165
278 Ga0307409_101113957 3300031995 Bacteria 811
279 Ga0307409_101344698 3300031995 Bacteria 740
280 Ga0307416_100007442 3300032002 Bacteria 6965
281 Ga0307416_100421539 3300032002 Bacteria 1379
282 Ga0307416_100482616 3300032002 Bacteria 1300
283 Ga0307414_10073645 3300032004 Bacteria 2472
284 Ga0307411_10417596 3300032005 Bacteria 1113
285 Ga0307411_11311530 3300032005 Bacteria 660
286 Ga0307415_100091719 3300032126 Bacteria 2201
287 Ga0307507_10224983 3300033179 Bacteria 1254
288 Ga0307507_10333203 3300033179 Bacteria 905
289 Ga0373934_0040348 3300035086 Bacteria 1841
290 Ga0373944_0009384 3300035089 Bacteria 2652
291 Ga0373951_0000070 3300035091 Bacteria 40770
292 Ga0373923_0030337 3300035111 Bacteria 2174
293 Ga0373945_0019822 3300035116 Bacteria 2297
294 Ga0373953_0120114 3300035117 Bacteria 1116
295 Ga0373953_0123972 3300035117 Bacteria 1099
296 Ga0373954_0092873 3300035118 Bacteria 1451
297 Ga0373954_0322048 3300035118 Bacteria 763
298 Ga0373956_0055204 3300035119 Bacteria 1791
299 Ga0373957_0085692 3300035120 Bacteria 1247
300 Ga0373946_0009714 3300035171 Bacteria 3552
301 Ga0373955_0023362 3300035172 Bacteria 3148
302 Ga0373955_0099425 3300035172 Bacteria 1668
303 Ga0373942_0283908 3300035207 Bacteria 571
304 Ga0373924_0076597 3300035410 Bacteria 1417
305 Ga0373935_0022897 3300035692 Bacteria 3835
306 Ga0373935_0038264 3300035692 Bacteria 3003
307 Ga0373927_0051245 3300035695 Bacteria 2669
308 Ga0373927_0080737 3300035695 Bacteria 2107
309 Ga0373933_0029689 3300035724 Bacteria 3163
310 Ga0373933_0068781 3300035724 Bacteria 2151
311 Ga0373947_0012295 3300035725 Bacteria 4904
312 Ga0373937_0007597 3300036401 Bacteria 9390
313 Ga0373937_0046276 3300036401 Bacteria 3978
314 Ga0373925_0014548 3300037068 Bacteria 5686
315 Ga0395899_0009607 3300037312 Bacteria 7423
316 Ga0395899_0297205 3300037312 Bacteria 1094
317 Ga0395900_0534042 3300037418 Bacteria 1119
318 Ga0395898_0653979 3300037466 Bacteria 993
319 Ga0436364_0365927 3300037853 Bacteria 914
320 Ga0436364_0735608 3300037853 Bacteria 41179
321 Ga0395901_0251128 3300038443 Bacteria 1842
322 Ga0436365_0489084 3300039437 Bacteria 20008
323 Ga0436362_0163755 3300039453 Bacteria 2648
324 Ga0436362_1194969 3300039453 Bacteria 25362
325 Ga0439436_0009448 3300041404 Bacteria 2991
326 Ga0439438_013099 3300041405 Bacteria 2515
327 Ga0439438_024247 3300041405 Bacteria 1662
328 Ga0439439_0014986 3300041406 Bacteria 1890
329 Ga0439466_0007303 3300041411 Bacteria 4185
330 Ga0451802_0114249 3300041460 Bacteria 670
331 Ga0451849_1079178 3300041505 Bacteria 731
332 Ga0451851_0544715 3300041507 Unclassified 1102
333 Ga0451853_3095680 3300041512 Bacteria 3240
334 Ga0451853_3176881 3300041512 Bacteria 609
335 Ga0439454_086129 3300042011 Bacteria 575
336 Ga0439457_002075 3300042014 Bacteria 5863
337 Ga0466961_0093732 3300044693 Bacteria 1895
338 Ga0466961_0352986 3300044693 Bacteria 895
339 Ga0466963_0006097 3300044694 Bacteria 7108
340 Ga0466963_0019919 3300044694 Bacteria 4215
341 Ga0466971_0006978 3300044719 Bacteria 4913
342 Ga0466971_0011211 3300044719 Bacteria 3927
343 Ga0466968_0062401 3300044735 Bacteria 1609
344 Ga0466957_0015159 3300044842 Bacteria 4499
345 Ga0466957_0870294 3300044842 Bacteria 643
346 Ga0466958_0055005 3300045836 Bacteria 2414
347 Ga0466967_0252660 3300045976 Bacteria 1684
348 Ga0466967_0276049 3300045976 Bacteria 1612
349 Ga0466967_0615712 3300045976 Bacteria 1072
350 Ga0466967_0671539 3300045976 Bacteria 1025
351 Ga0495592_0000082 3300046454 Bacteria 83312
352 Ga0495592_0075090 3300046454 Bacteria 2455
353 Ga0495629_0020420 3300046459 Bacteria 4730
354 Ga0495629_0150851 3300046459 Bacteria 1615
355 Ga0495629_0202192 3300046459 Bacteria 1373
356 Ga0495641_0018642 3300046461 Bacteria 3576
357 Ga0495641_0039486 3300046461 Bacteria 2201
358 Ga0495651_0000080 3300046462 Bacteria 70453
359 Ga0495653_0010618 3300046463 Bacteria 7538
360 Ga0495653_0024492 3300046463 Bacteria 4863
361 Ga0495653_0039803 3300046463 Bacteria 3679
362 Ga0495580_0132114 3300046472 Bacteria 1731
363 Ga0495582_0023566 3300046473 Bacteria 3366
364 Ga0495639_0005832 3300046475 Bacteria 5297
365 Ga0495639_0359160 3300046475 Bacteria 732
366 Ga0495662_0006747 3300046476 Bacteria 5717
367 Ga0495662_0013628 3300046476 Bacteria 3958
368 Ga0495608_0003987 3300046511 Bacteria 10598
369 Ga0495608_0014206 3300046511 Bacteria 5525
370 Ga0495608_0029897 3300046511 Bacteria 3691
371 Ga0495608_0030857 3300046511 Bacteria 3626
372 Ga0495618_0001062 3300046514 Bacteria 18742
373 Ga0495618_0040586 3300046514 Bacteria 2929
374 Ga0495618_0080966 3300046514 Bacteria 2073
375 Ga0495618_0403623 3300046514 Bacteria 835
376 Ga0495628_0000292 3300046516 Bacteria 45065
377 Ga0495628_0036307 3300046516 Bacteria 3956
378 Ga0495628_0284550 3300046516 Bacteria 1227
379 Ga0495630_0025415 3300046517 Bacteria 4379
380 Ga0495630_0167450 3300046517 Bacteria 1673
381 Ga0495630_0363507 3300046517 Bacteria 1108
382 Ga0495630_0428775 3300046517 Bacteria 1013
383 Ga0495666_0007180 3300046526 Bacteria 5593
384 Ga0495666_0148855 3300046526 Bacteria 1089
385 Ga0495652_0000847 3300046529 Bacteria 35270
386 Ga0495652_0019158 3300046529 Bacteria 6096
387 Ga0495652_0087389 3300046529 Bacteria 2557
388 Ga0495652_0481781 3300046529 Bacteria 863
389 Ga0495665_0009776 3300046531 Bacteria 5193
390 Ga0495640_0001765 3300046533 Bacteria 17143
391 Ga0495640_0019878 3300046533 Bacteria 4953
392 Ga0495640_0127249 3300046533 Bacteria 1651
393 Ga0495640_0580060 3300046533 Bacteria 678
394 Ga0495586_0045783 3300046535 Bacteria 2358
395 Ga0495586_0053213 3300046535 Bacteria 2193
396 Ga0495586_0155146 3300046535 Bacteria 1289
397 Ga0495587_0000060 3300046536 Bacteria 93780
398 Ga0495587_0018892 3300046536 Bacteria 4273
399 Ga0495587_0808355 3300046536 Bacteria 512
400 Ga0495645_0000038 3300046543 Bacteria 96124
401 Ga0495645_0003765 3300046543 Bacteria 10301
402 Ga0495667_0023436 3300046559 Bacteria 4159
403 Ga0495667_0215515 3300046559 Bacteria 1226
404 Ga0495634_0170335 3300046642 Bacteria 1368
405 Ga0495635_0036499 3300046663 Bacteria 3406
406 Ga0495588_0027767 3300046674 Bacteria 2830
407 Ga0495657_0008364 3300046675 Bacteria 7923
408 Ga0495657_0009237 3300046675 Bacteria 7481
409 Ga0495599_0000142 3300046678 Bacteria 46621
410 Ga0495599_0009584 3300046678 Bacteria 5923
411 Ga0495599_0260378 3300046678 Bacteria 1054
412 Ga0495599_0340347 3300046678 Unclassified 901
413 Ga0495623_0000210 3300046679 Bacteria 37384
414 Ga0495623_0036652 3300046679 Bacteria 3140
415 Ga0495623_0048829 3300046679 Bacteria 2683
416 Ga0495646_0000729 3300046680 Bacteria 18267
417 Ga0495646_0020110 3300046680 Bacteria 4221
418 Ga0495646_0202624 3300046680 Bacteria 1080
419 Ga0495647_0008057 3300046681 Bacteria 3541
420 Ga0495647_0035604 3300046681 Bacteria 1870
421 Ga0495658_0004748 3300046683 Bacteria 6671
422 Ga0495658_0019295 3300046683 Bacteria 3556
423 Ga0495613_0052883 3300046689 Bacteria 2990
424 Ga0495613_0093200 3300046689 Bacteria 2180
425 Ga0495624_0028234 3300046690 Bacteria 3669
426 Ga0495624_0083140 3300046690 Bacteria 1980
427 Ga0495600_0060582 3300046809 Bacteria 2471
428 Ga0495600_0153775 3300046809 Bacteria 1488
429 Ga0495581_0095682 3300047315 Bacteria 1724
430 Ga0495604_0000043 3300047317 Bacteria 116335
431 Ga0495604_0043570 3300047317 Bacteria 3512
432 Ga0495604_0050645 3300047317 Bacteria 3224
433 Ga0495604_0115330 3300047317 Bacteria 1952
434 Ga0495674_0029993 3300047319 Bacteria 4948
435 Ga0495674_0068138 3300047319 Bacteria 3080
436 Ga0495674_0107149 3300047319 Bacteria 2372
437 Ga0495676_0039223 3300047321 Bacteria 3925
438 Ga0495676_0215938 3300047321 Bacteria 1324
439 Ga0495680_0050059 3300047322 Bacteria 3268
440 Ga0495680_0104646 3300047322 Bacteria 2105
441 Ga0495680_0141556 3300047322 Bacteria 1759
442 Ga0495675_0000821 3300047444 Bacteria 19062
443 Ga0495675_0023170 3300047444 Bacteria 3957
444 Ga0495675_0053704 3300047444 Bacteria 2558
445 Ga0495675_0248810 3300047444 Bacteria 1068
446 Ga0495684_0032350 3300047471 Bacteria 4015
447 Ga0495593_0006320 3300047673 Bacteria 6950
448 Ga0495602_0007946 3300048088 Bacteria 11086
449 Ga0495602_0022033 3300048088 Bacteria 6248
450 Ga0495602_0043593 3300048088 Bacteria 4077
451 Ga0495614_0015235 3300048089 Bacteria 3353
452 Ga0495614_0209119 3300048089 Bacteria 884
453 Ga0496100_0129756 3300048903 Bacteria 1774
454 Ga0496100_0165633 3300048903 Bacteria 1588
455 Ga0496100_0254305 3300048903 Bacteria 1300
456 Ga0496101_0110329 3300048904 Bacteria 2070
457 Ga0496102_0065413 3300048905 Bacteria 3332
458 Ga0496102_0187830 3300048905 Bacteria 1947
459 Ga0496102_0564243 3300048905 Bacteria 1061
460 Ga0496103_0224662 3300048906 Bacteria 1207
461 Ga0496104_0082319 3300048907 Bacteria 3069
462 Ga0496104_0088941 3300048907 Bacteria 2950
463 Ga0496105_0051751 3300048908 Bacteria 3392
464 Ga0496105_0108886 3300048908 Bacteria 2287
465 Ga0496105_0272856 3300048908 Bacteria 1365
466 Ga0496105_0470772 3300048908 Bacteria 990
467 Ga0496106_0047908 3300048909 Bacteria 3218
468 Ga0496107_0010166 3300048910 Bacteria 6526
469 Ga0496108_0068524 3300048911 Bacteria 2993
470 Ga0496108_0077367 3300048911 Bacteria 2814
471 Ga0496109_0029866 3300048912 Bacteria 4884
472 Ga0496109_0201202 3300048912 Bacteria 1872
473 Ga0496110_0220517 3300048913 Bacteria 1724
474 Ga0496110_0693245 3300048913 Bacteria 920
475 Ga0496111_0005441 3300048914 Bacteria 8160
476 Ga0496111_0046477 3300048914 Bacteria 3126
477 Ga0496112_0014196 3300048915 Bacteria 7383
478 Ga0496112_0115929 3300048915 Bacteria 2649
479 Ga0496112_0117619 3300048915 Bacteria 2628
480 Ga0496113_0029198 3300048916 Bacteria 3978
481 Ga0496113_0065119 3300048916 Bacteria 2757
482 Ga0496114_0127666 3300048917 Bacteria 2193
483 Ga0496114_0193323 3300048917 Unclassified 1781
484 Ga0496114_0286117 3300048917 Bacteria 1454
485 Ga0496115_0006989 3300048918 Bacteria 8291
486 Ga0496115_0047451 3300048918 Bacteria 3435
487 Ga0496115_0121165 3300048918 Bacteria 2152
488 Ga0496115_0218963 3300048918 Bacteria 1571
489 Ga0496126_0047401 3300048929 Bacteria 3934
490 Ga0501040_0133732 3300049576 Bacteria 1745
491 Ga0501046_0507017 3300049580 Bacteria 864
492 Ga0501075_0683276 3300049591 Bacteria 782
493 Ga0501080_0176955 3300049742 Bacteria 1965
494 nmdc:mga05p37_1153013_c1 3300050507 Bacteria 806
495 nmdc:mga05p37_66388_c1 3300050507 Bacteria 4438
496 nmdc:mga09592_10844_c1 3300050508 Bacteria 7415
497 nmdc:mga09592_183036_c1 3300050508 Bacteria 1813
498 nmdc:mga0qj67_29301_c1 3300050509 Bacteria 4276
499 nmdc:mga06r32_140881_c1 3300050510 Bacteria 2388
500 nmdc:mga06r32_159011_c1 3300050510 Bacteria 2241
501 nmdc:mga08y16_13353_c1 3300050511 Bacteria 8640
502 nmdc:mga0n895_1676_c1 3300050512 Bacteria 16730
503 nmdc:mga0n895_41763_c1 3300050512 Bacteria 4460
504 nmdc:mga0rr50_15773_c1 3300050513 Bacteria 4997
505 nmdc:mga08x19_6812_c1 3300050514 Bacteria 6787
506 nmdc:mga0a205_456847_c1 3300050515 Bacteria 1137
507 nmdc:mga0a205_86691_c1 3300050515 Bacteria 3024
508 Ga0495601_0000178 3300053077 Bacteria 33686
509 Ga0495601_0107463 3300053077 Bacteria 1805
510 Ga0495601_0237688 3300053077 Bacteria 1189
511 Ga0495601_0249446 3300053077 Bacteria 1159
512 Ga0495601_0502339 3300053077 Bacteria 782
513 Ga0495601_0547652 3300053077 Bacteria 744
514 Ga0495612_0050865 3300053078 Bacteria 1702
515 Ga0495612_0052069 3300053078 Bacteria 1684
516 Ga0495595_0147497 3300053084 Bacteria 1156
517 Ga0495595_0236452 3300053084 Bacteria 913
518 Ga0495619_0005264 3300053085 Bacteria 8201
519 Ga0495619_0038867 3300053085 Bacteria 3105
520 Ga0495619_0044837 3300053085 Bacteria 2904
521 Ga0495619_0058218 3300053085 Bacteria 2564
522 Ga0495619_0504040 3300053085 Bacteria 832
523 Ga0495619_1088640 3300053085 Bacteria 532
524 Ga0500644_0008393 3300053088 Bacteria 2728
525 Ga0500646_0000207 3300053090 Bacteria 17598
526 Ga0500641_0021346 3300053096 Bacteria 2467
527 Ga0466962_0005246 3300061719 Bacteria 6224
528 Ga0530510_1359998 3300061734 Bacteria 545
529 2515852514 2515154155 Bacteria 7985436
530 2676474514 2675903058 Bacteria 6822861
531 2827633012 2827628540 Bacteria 6858585
532 2857712048 2857710386 Bacteria 3186771
533 8056059329 8056054917 Bacteria 5736694
534 Ga0307410_10981337
535 JGI25406J46586_10071056
536 Ga0070658_10632935
537 Ga0070676_10507742
538 Ga0070683_100114414
539 Ga0070670_100161420
540 Ga0070680_101353584
541 Ga0068868_100010236
542 Ga0068868_100054199
543 Ga0068868_100554772
544 Ga0070660_100016946
545 Ga0070689_100483085
546 Ga0070661_100001428
547 Ga0070661_100099723
548 Ga0070692_10139430
549 Ga0070668_100455789
550 Ga0070669_100074877
551 Ga0070675_100000461
552 Ga0070675_100115126
553 Ga0070671_101109351
554 Ga0070659_100050842
555 Ga0070659_100150110
556 Ga0070667_100502283
557 Ga0070709_10166141
558 Ga0070709_10225915
559 Ga0070714_100004346
560 Ga0070714_100008953
561 Ga0070714_100447545
562 Ga0070714_101332402
563 Ga0070714_101908641
564 Ga0070713_100045695
565 Ga0070713_100055427
566 Ga0070713_100065458
567 Ga0070710_10129761
568 Ga0070710_10153098
569 Ga0070711_100327896
570 Ga0070700_100032648
571 Ga0070700_100267685
572 Ga0070694_100120076
573 Ga0070663_100024556
574 Ga0070678_100020096
575 Ga0070678_100073584
576 Ga0070662_100055027
577 Ga0070662_100412433
578 Ga0070681_10241013
579 Ga0068867_100645997
580 Ga0068867_101528407
581 Ga0070706_100003381
582 Ga0070706_100157851
583 Ga0070707_100000441
584 Ga0070698_100004600
585 Ga0070698_100025458
586 Ga0070679_100098489
587 Ga0070679_100175465
588 Ga0068853_100312599
589 Ga0068853_100507296
590 Ga0068853_100559389
591 Ga0070672_100156940
592 Ga0070672_100978911
593 Ga0070686_100190392
594 Ga0070693_100305869
595 Ga0070693_100728753
596 Ga0070665_100068554
597 Ga0070704_100355691
598 Ga0068855_100072870
599 Ga0068855_100734881
600 Ga0070664_100002472
601 Ga0070664_100210710
602 Ga0068857_100934160
603 Ga0068857_101247191
604 Ga0068856_100015572
605 Ga0068856_100145121
606 Ga0070702_100017397
607 Ga0068852_100086991
608 Ga0068852_100273046
609 Ga0068859_100047282
610 Ga0068859_100337570
611 Ga0068864_100116059
612 Ga0068864_100122274
613 Ga0068866_10054638
614 Ga0068861_101205045
615 Ga0068851_10145915
616 Ga0068863_100472612
617 Ga0068863_100517534
618 Ga0068858_100057494
619 Ga0068858_100155989
620 Ga0068858_100228941
621 Ga0068860_100051486
622 Ga0068862_100203202
623 Ga0068862_100224676
624 Ga0068862_101187107
625 Ga0081539_10000348
626 Ga0081539_10000981
627 Ga0070717_10003490
628 Ga0070717_10009949
629 Ga0070717_10017901
630 Ga0070717_10043197
631 Ga0070717_10066415
632 Ga0070715_10359526
633 Ga0070716_100349259
634 Ga0070712_100013857
635 Ga0070712_100289227
636 Ga0070712_100724677
637 Ga0068871_100254306
638 Ga0075428_100271245
639 Ga0075428_100639616
640 Ga0075428_101163321
641 Ga0075430_100110143
642 Ga0075430_100450407
643 Ga0075431_100006775
644 Ga0075431_100176255
645 Ga0075433_10482330
646 Ga0075434_100022241
647 Ga0075429_100003480
648 Ga0075429_100017849
649 Ga0075436_100005120
650 Ga0097620_100047282
651 Ga0097620_100337552
652 Ga0097620_100685194
653 Ga0075435_100002239
654 Ga0105251_10356919
655 Ga0105240_11379563
656 Ga0111539_10005172
657 Ga0105245_10002660
658 Ga0105245_11611603
659 Ga0105247_10027794
660 Ga0114129_10007471
661 Ga0114129_10727019
662 Ga0114129_12441369
663 Ga0105243_10073132
664 Ga0105243_10145865
665 Ga0105243_10383488
666 Ga0105243_10611423
667 Ga0105241_10084214
668 Ga0105242_10048426
669 Ga0105237_10127028
670 Ga0105237_10532263
671 Ga0105238_10179744
672 Ga0105238_10498937
673 Ga0105249_11808429
674 Ga0105239_10074315
675 Ga0105239_10254139
676 Ga0105239_10569949
677 Ga0105246_10035663
678 Ga0157369_10006189
679 Ga0157374_10146899
680 Ga0157374_10230508
681 Ga0163162_10051942
682 Ga0163162_10426500
683 Ga0157372_10253175
684 Ga0163163_10176113
685 Ga0157377_10006102
686 Ga0157379_10192249
687 Ga0157376_10237133
688 Ga0157376_10601664
689 Ga0213873_10000432
690 Ga0213876_10002647
691 Ga0213875_10000423
692 Ga0224572_1000182
693 Ga0228598_1060255
694 Ga0207656_10323975
695 Ga0207692_10072953
696 Ga0207692_10170023
697 Ga0207692_10829454
698 Ga0207710_10108587
699 Ga0207645_10219767
700 Ga0207705_10748044
701 Ga0207684_10058262
702 Ga0207684_10112874
703 Ga0207654_10303148
704 Ga0207707_10037454
705 Ga0207707_10053410
706 Ga0207707_10094870
707 Ga0207695_10178257
708 Ga0207671_10064738
709 Ga0207693_10022520
710 Ga0207693_10165093
711 Ga0207693_10889179
712 Ga0207663_10077128
713 Ga0207663_10217346
714 Ga0207663_10778368
715 Ga0207660_10077091
716 Ga0207662_10019367
717 Ga0207657_10023715
718 Ga0207657_10029443
719 Ga0207649_10378000
720 Ga0207652_10053448
721 Ga0207652_10069686
722 Ga0207646_10001597
723 Ga0207681_10106605
724 Ga0207694_10063650
725 Ga0207694_10101474
726 Ga0207650_10120511
727 Ga0207659_10020270
728 Ga0207659_10408074
729 Ga0207687_10006817
730 Ga0207687_10036515
731 Ga0207700_11601408
732 Ga0207664_10015316
733 Ga0207664_10142493
734 Ga0207644_10290017
735 Ga0207690_10016255
736 Ga0207690_10091389
737 Ga0207690_10265545
738 Ga0207706_10051737
739 Ga0207706_10097137
740 Ga0207686_10022881
741 Ga0207709_10093736
742 Ga0207670_10175070
743 Ga0207704_10108861
744 Ga0207665_10017872
745 Ga0207665_10265439
746 Ga0207665_10633658
747 Ga0207711_10024461
748 Ga0207661_10108198
749 Ga0207661_10479177
750 Ga0207679_10122381
751 Ga0207679_10812311
752 Ga0207667_10019533
753 Ga0207667_10170980
754 Ga0207668_10004948
755 Ga0207668_10031208
756 Ga0207668_10518869
757 Ga0207640_10370292
758 Ga0207677_10033463
759 Ga0207677_10166568
760 Ga0207677_11367609
761 Ga0207703_10507158
762 Ga0207639_10681626
763 Ga0207639_11667244
764 Ga0207678_10041134
765 Ga0207708_10030466
766 Ga0207702_10004647
767 Ga0207702_10041631
768 Ga0207641_10169189
769 Ga0207641_10427464
770 Ga0207641_11205515
771 Ga0207648_10083336
772 Ga0207676_10212853
773 Ga0207675_100219155
774 Ga0207683_10013837
775 Ga0207683_10094058
776 Ga0207683_11307161
777 Ga0207698_10145821
778 Ga0207698_10240274
779 Ga0268266_10050003
780 Ga0265319_1002271
781 Ga0265334_10006418
782 Ga0265334_10042085
783 Ga0265318_10001350
784 Ga0265336_10082462
785 Ga0307517_10241049
786 Ga0265338_10123108
787 Ga0307511_10066889
788 Ga0265760_10155045
789 Ga0265328_10017216
790 Ga0265320_10160665
791 Ga0265325_10006975
792 Ga0265329_10152278
793 Ga0265340_10017677
794 Ga0265340_10080218
795 Ga0265331_10016853
796 Ga0265316_10009693
797 Ga0307513_10042508
798 Ga0265313_10003228
799 Ga0265313_10214832
800 Ga0307516_10038326
801 Ga0307516_10052139
802 Ga0307405_10033837
803 Ga0307405_10775966
804 Ga0307413_10588853
805 Ga0307406_10071296
806 Ga0307406_10073986
807 Ga0307406_10383834
808 Ga0307406_10404727
809 Ga0307409_100009684
810 Ga0307409_100517772
811 Ga0307409_101113957
812 Ga0307409_101344698
813 Ga0307416_100007442
814 Ga0307416_100421539
815 Ga0307416_100482616
816 Ga0307414_10073645
817 Ga0307411_10417596
818 Ga0307411_11311530
819 Ga0307415_100091719
820 Ga0307507_10224983
821 Ga0307507_10333203
822 Ga0373934_0040348
823 Ga0373944_0009384
824 Ga0373951_0000070
825 Ga0373923_0030337
826 Ga0373945_0019822
827 Ga0373953_0120114
828 Ga0373953_0123972
829 Ga0373954_0092873
830 Ga0373954_0322048
831 Ga0373956_0055204
832 Ga0373957_0085692
833 Ga0373946_0009714
834 Ga0373955_0023362
835 Ga0373955_0099425
836 Ga0373942_0283908
837 Ga0373924_0076597
838 Ga0373935_0022897
839 Ga0373935_0038264
840 Ga0373927_0051245
841 Ga0373927_0080737
842 Ga0373933_0029689
843 Ga0373933_0068781
844 Ga0373947_0012295
845 Ga0373937_0007597
846 Ga0373937_0046276
847 Ga0373925_0014548
848 Ga0395899_0009607
849 Ga0395899_0297205
850 Ga0395900_0534042
851 Ga0395898_0653979
852 Ga0436364_0365927
853 Ga0436364_0735608
854 Ga0395901_0251128
855 Ga0436365_0489084
856 Ga0436362_0163755
857 Ga0436362_1194969
858 Ga0439436_0009448
859 Ga0439438_013099
860 Ga0439438_024247
861 Ga0439439_0014986
862 Ga0439466_0007303
863 Ga0451802_0114249
864 Ga0451849_1079178
865 Ga0451851_0544715
866 Ga0451853_3095680
867 Ga0451853_3176881
868 Ga0439454_086129
869 Ga0439457_002075
870 Ga0466961_0093732
871 Ga0466961_0352986
872 Ga0466963_0006097
873 Ga0466963_0019919
874 Ga0466971_0006978
875 Ga0466971_0011211
876 Ga0466968_0062401
877 Ga0466957_0015159
878 Ga0466957_0870294
879 Ga0466958_0055005
880 Ga0466967_0252660
881 Ga0466967_0276049
882 Ga0466967_0615712
883 Ga0466967_0671539
884 Ga0495592_0000082
885 Ga0495592_0075090
886 Ga0495629_0020420
887 Ga0495629_0150851
888 Ga0495629_0202192
889 Ga0495641_0018642
890 Ga0495641_0039486
891 Ga0495651_0000080
892 Ga0495653_0010618
893 Ga0495653_0024492
894 Ga0495653_0039803
895 Ga0495580_0132114
896 Ga0495582_0023566
897 Ga0495639_0005832
898 Ga0495639_0359160
899 Ga0495662_0006747
900 Ga0495662_0013628
901 Ga0495608_0003987
902 Ga0495608_0014206
903 Ga0495608_0029897
904 Ga0495608_0030857
905 Ga0495618_0001062
906 Ga0495618_0040586
907 Ga0495618_0080966
908 Ga0495618_0403623
909 Ga0495628_0000292
910 Ga0495628_0036307
911 Ga0495628_0284550
912 Ga0495630_0025415
913 Ga0495630_0167450
914 Ga0495630_0363507
915 Ga0495630_0428775
916 Ga0495666_0007180
917 Ga0495666_0148855
918 Ga0495652_0000847
919 Ga0495652_0019158
920 Ga0495652_0087389
921 Ga0495652_0481781
922 Ga0495665_0009776
923 Ga0495640_0001765
924 Ga0495640_0019878
925 Ga0495640_0127249
926 Ga0495640_0580060
927 Ga0495586_0045783
928 Ga0495586_0053213
929 Ga0495586_0155146
930 Ga0495587_0000060
931 Ga0495587_0018892
932 Ga0495587_0808355
933 Ga0495645_0000038
934 Ga0495645_0003765
935 Ga0495667_0023436
936 Ga0495667_0215515
937 Ga0495634_0170335
938 Ga0495635_0036499
939 Ga0495588_0027767
940 Ga0495657_0008364
941 Ga0495657_0009237
942 Ga0495599_0000142
943 Ga0495599_0009584
944 Ga0495599_0260378
945 Ga0495599_0340347
946 Ga0495623_0000210
947 Ga0495623_0036652
948 Ga0495623_0048829
949 Ga0495646_0000729
950 Ga0495646_0020110
951 Ga0495646_0202624
952 Ga0495647_0008057
953 Ga0495647_0035604
954 Ga0495658_0004748
955 Ga0495658_0019295
956 Ga0495613_0052883
957 Ga0495613_0093200
958 Ga0495624_0028234
959 Ga0495624_0083140
960 Ga0495600_0060582
961 Ga0495600_0153775
962 Ga0495581_0095682
963 Ga0495604_0000043
964 Ga0495604_0043570
965 Ga0495604_0050645
966 Ga0495604_0115330
967 Ga0495674_0029993
968 Ga0495674_0068138
969 Ga0495674_0107149
970 Ga0495676_0039223
971 Ga0495676_0215938
972 Ga0495680_0050059
973 Ga0495680_0104646
974 Ga0495680_0141556
975 Ga0495675_0000821
976 Ga0495675_0023170
977 Ga0495675_0053704
978 Ga0495675_0248810
979 Ga0495684_0032350
980 Ga0495593_0006320
981 Ga0495602_0007946
982 Ga0495602_0022033
983 Ga0495602_0043593
984 Ga0495614_0015235
985 Ga0495614_0209119
986 Ga0496100_0129756
987 Ga0496100_0165633
988 Ga0496100_0254305
989 Ga0496101_0110329
990 Ga0496102_0065413
991 Ga0496102_0187830
992 Ga0496102_0564243
993 Ga0496103_0224662
994 Ga0496104_0082319
995 Ga0496104_0088941
996 Ga0496105_0051751
997 Ga0496105_0108886
998 Ga0496105_0272856
999 Ga0496105_0470772
1000 Ga0496106_0047908
1001 Ga0496107_0010166
1002 Ga0496108_0068524
1003 Ga0496108_0077367
1004 Ga0496109_0029866
1005 Ga0496109_0201202
1006 Ga0496110_0220517
1007 Ga0496110_0693245
1008 Ga0496111_0005441
1009 Ga0496111_0046477
1010 Ga0496112_0014196
1011 Ga0496112_0115929
1012 Ga0496112_0117619
1013 Ga0496113_0029198
1014 Ga0496113_0065119
1015 Ga0496114_0127666
1016 Ga0496114_0193323
1017 Ga0496114_0286117
1018 Ga0496115_0006989
1019 Ga0496115_0047451
1020 Ga0496115_0121165
1021 Ga0496115_0218963
1022 Ga0496126_0047401
1023 Ga0501040_0133732
1024 Ga0501046_0507017
1025 Ga0501075_0683276
1026 Ga0501080_0176955
1027 nmdc:mga05p37_1153013_c1
1028 nmdc:mga05p37_66388_c1
1029 nmdc:mga09592_10844_c1
1030 nmdc:mga09592_183036_c1
1031 nmdc:mga0qj67_29301_c1
1032 nmdc:mga06r32_140881_c1
1033 nmdc:mga06r32_159011_c1
1034 nmdc:mga08y16_13353_c1
1035 nmdc:mga0n895_1676_c1
1036 nmdc:mga0n895_41763_c1
1037 nmdc:mga0rr50_15773_c1
1038 nmdc:mga08x19_6812_c1
1039 nmdc:mga0a205_456847_c1
1040 nmdc:mga0a205_86691_c1
1041 Ga0495601_0000178
1042 Ga0495601_0107463
1043 Ga0495601_0237688
1044 Ga0495601_0249446
1045 Ga0495601_0502339
1046 Ga0495601_0547652
1047 Ga0495612_0050865
1048 Ga0495612_0052069
1049 Ga0495595_0147497
1050 Ga0495595_0236452
1051 Ga0495619_0005264
1052 Ga0495619_0038867
1053 Ga0495619_0044837
1054 Ga0495619_0058218
1055 Ga0495619_0504040
1056 Ga0495619_1088640
1057 Ga0500644_0008393
1058 Ga0500646_0000207
1059 Ga0500641_0021346
1060 Ga0466962_0005246
1061 Ga0530510_1359998
1062 2515852514
1063 2676474514
1064 2827633012
1065 2857712048
1066 8056059329

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03703

bPH_2

Bacterial PH domain

89

167

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yf0-assembly1.cif.gz_A-2 human myotubularin related protein 6 (mtmr6) 0.792 78 157
3gyp-assembly1.cif.gz_A rtt106p 0.7841 73 156
3gyo-assembly1.cif.gz_A se-met rtt106p 0.7838 78 156
3tw1-assembly1.cif.gz_A structure of rtt106-ahn 0.7702 73 153
7xti-assembly1.cif.gz_k rna polymerase ii elongation complex transcribing a nucleosome (ec58hex) 0.7696 78 157
ID Description Score Start End Superfamily
af_Q2FWI4_74_150_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.944 80 151 2.30.29.30
af_O33222_62_143_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.9188 77 151 2.30.29.30
af_Q2FWI3_67_143_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.9109 77 152 2.30.29.30
af_O33222_395_466_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8751 75 145 2.30.29.30
af_Q2FWI3_67_143_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8679 77 152 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A2Z5QMN0-F1-model_v4 deleted 0.9273 74 163
AF-A0A0B2A507-F1-model_v4 Membrane protein 0.9269 25 164 GO:0016020
AF-A0A147E2K9-F1-model_v4 YdbS-like PH domain-containing protein 0.9237 29 164
AF-A0A255EBA8-F1-model_v4 YdbS-like PH domain-containing protein 0.9195 20 164 GO:0016020
AF-A0A7V2MCP4-F1-model_v4 YdbS-like PH domain-containing protein 0.9187 23 159 GO:0016020

Map