F460327

General Info

Members Datasets Scaffolds Average Seq Length
532 256 1064 367

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0000829|Ga0496112_0000829_15827_17035
Length 382
Sequence MANADSDKSDGIDRSLQTDDRTEPDRPDDGADKRRLRSRLHELSELGQSVWIDYLSRHLLQSGELARMMEEDAVVGVTSNPTIFQKAIAEGDAYDEQMREVLAEEQDAKEVFLRLAVEDVKNACDLLRPVWDGGQGQDGYVSIEVDPNLAYDTQKTIDEAQRLHELVDKPNCFVKIPATKEGLPAIEEMIARGRSINVTLIFSLQRYVEVVEAYLRGLERLVENGGDPGPVASVASFFVSRVDTEADRRLDEAGAPDDLKGKLAVANAKLAYERYQELFSGERWAALEAKGARSQRCLWASTSTKNPAYRDVIYVEELIGPETVNTMPEETIEAFQDHGEVALTLERDVDEAKRVFGVDKFADSFKELLDGVQAKRGELVSA

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
88 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
154 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
155 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
156 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
157 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 11.65
Rhizosphere 87.22
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0000829 3300048915 Bacteria 21968
2 Ga0070683_100007597 3300005329 Bacteria 9167
3 Ga0070683_100083916 3300005329 Bacteria 2984
4 Ga0070690_100013603 3300005330 Bacteria 4813
5 Ga0070680_100010198 3300005336 Bacteria 7245
6 Ga0070680_100016677 3300005336 Bacteria 5783
7 Ga0070682_100006325 3300005337 Bacteria 6647
8 Ga0068868_100048294 3300005338 Bacteria 3338
9 Ga0068868_100307975 3300005338 Bacteria 1347
10 Ga0070660_100048026 3300005339 Bacteria 3277
11 Ga0070692_10055300 3300005345 Bacteria 2075
12 Ga0070668_100094382 3300005347 Bacteria 2361
13 Ga0070669_100125871 3300005353 Bacteria 1961
14 Ga0070674_100059538 3300005356 Bacteria 2659
15 Ga0070674_100143492 3300005356 Bacteria 1795
16 Ga0070673_100116601 3300005364 Bacteria 2222
17 Ga0070659_100049858 3300005366 Bacteria 3292
18 Ga0070709_10031789 3300005434 Bacteria 3178
19 Ga0070709_10038943 3300005434 Bacteria 2914
20 Ga0070714_100005831 3300005435 Bacteria 9447
21 Ga0070714_100013013 3300005435 Bacteria 6656
22 Ga0070714_100046392 3300005435 Bacteria 3686
23 Ga0070714_100128280 3300005435 Bacteria 2264
24 Ga0070713_100008343 3300005436 Bacteria 7347
25 Ga0070710_10018932 3300005437 Bacteria 3550
26 Ga0070701_10018539 3300005438 Bacteria 3273
27 Ga0070711_100002195 3300005439 Bacteria 11079
28 Ga0070711_100091259 3300005439 Bacteria 2195
29 Ga0070711_100174852 3300005439 Bacteria 1639
30 Ga0070711_100241797 3300005439 Bacteria 1412
31 Ga0070705_100011889 3300005440 Bacteria 4407
32 Ga0070705_100012468 3300005440 Bacteria 4322
33 Ga0070705_100046882 3300005440 Bacteria 2494
34 Ga0070705_100107154 3300005440 Bacteria 1778
35 Ga0070705_100201251 3300005440 Bacteria 1365
36 Ga0070694_100011333 3300005444 Bacteria 5521
37 Ga0070694_100124584 3300005444 Bacteria 1853
38 Ga0070708_100059071 3300005445 Bacteria 3418
39 Ga0070708_100124425 3300005445 Bacteria 2382
40 Ga0070663_100033327 3300005455 Bacteria 3557
41 Ga0070678_100008410 3300005456 Bacteria 6180
42 Ga0070678_100009379 3300005456 Bacteria 5926
43 Ga0070678_100047148 3300005456 Bacteria 3095
44 Ga0070678_100082493 3300005456 Bacteria 2441
45 Ga0070662_100095710 3300005457 Bacteria 2239
46 Ga0070662_100153000 3300005457 Bacteria 1798
47 Ga0070681_10001644 3300005458 Bacteria 19947
48 Ga0070681_10246262 3300005458 Bacteria 1700
49 Ga0070706_100009458 3300005467 Bacteria 9068
50 Ga0070706_100058452 3300005467 Bacteria 3559
51 Ga0070706_100085348 3300005467 Bacteria 2925
52 Ga0070706_100091663 3300005467 Bacteria 2819
53 Ga0070707_100003044 3300005468 Bacteria 15887
54 Ga0070707_100008184 3300005468 Bacteria 9701
55 Ga0070698_100008649 3300005471 Bacteria 10972
56 Ga0070698_100012430 3300005471 Bacteria 9011
57 Ga0070698_100137572 3300005471 Bacteria 2396
58 Ga0070699_100050915 3300005518 Bacteria 3586
59 Ga0070699_100101314 3300005518 Bacteria 2525
60 Ga0070699_100123221 3300005518 Bacteria 2280
61 Ga0070679_100365733 3300005530 Bacteria 1390
62 Ga0070684_100000327 3300005535 Bacteria 32866
63 Ga0070684_100000415 3300005535 Bacteria 29189
64 Ga0070684_100074596 3300005535 Bacteria 2990
65 Ga0070684_100256917 3300005535 Bacteria 1598
66 Ga0070697_100156987 3300005536 Bacteria 1921
67 Ga0070686_100022587 3300005544 Bacteria 3748
68 Ga0070686_100082236 3300005544 Bacteria 2135
69 Ga0070695_100090052 3300005545 Bacteria 2047
70 Ga0070696_100003893 3300005546 Bacteria 9972
71 Ga0070696_100016897 3300005546 Bacteria 4922
72 Ga0070696_100067187 3300005546 Bacteria 2516
73 Ga0070696_100139060 3300005546 Bacteria 1773
74 Ga0070693_100018460 3300005547 Bacteria 3644
75 Ga0070693_100053368 3300005547 Bacteria 2321
76 Ga0070704_100028184 3300005549 Bacteria 3733
77 Ga0068855_100025493 3300005563 Bacteria 7074
78 Ga0068855_100107963 3300005563 Bacteria 3197
79 Ga0070664_100061853 3300005564 Bacteria 3191
80 Ga0068857_100177232 3300005577 Bacteria 1939
81 Ga0068854_100077758 3300005578 Bacteria 2443
82 Ga0068856_100051894 3300005614 Bacteria 4043
83 Ga0068856_100068487 3300005614 Bacteria 3508
84 Ga0068856_100096855 3300005614 Bacteria 2939
85 Ga0070702_100012846 3300005615 Bacteria 4214
86 Ga0068866_10059958 3300005718 Bacteria 1971
87 Ga0068861_100018933 3300005719 Bacteria 4910
88 Ga0068861_100065621 3300005719 Bacteria 2796
89 Ga0068870_10016153 3300005840 Bacteria 3561
90 Ga0068863_100067702 3300005841 Bacteria 3378
91 Ga0068858_100115362 3300005842 Bacteria 2509
92 Ga0068858_100218966 3300005842 Bacteria 1802
93 Ga0081455_10010590 3300005937 Bacteria 9332
94 Ga0081538_10016471 3300005981 Bacteria 5664
95 Ga0081540_1004451 3300005983 Bacteria 10681
96 Ga0081540_1015979 3300005983 Bacteria 4727
97 Ga0081540_1019701 3300005983 Bacteria 4087
98 Ga0070717_10011803 3300006028 Bacteria 6646
99 Ga0070717_10026636 3300006028 Bacteria 4614
100 Ga0070717_10092891 3300006028 Bacteria 2550
101 Ga0075432_10043606 3300006058 Bacteria 1572
102 Ga0070715_10087788 3300006163 Bacteria 1424
103 Ga0070716_100018892 3300006173 Bacteria 3596
104 Ga0070712_100084111 3300006175 Bacteria 2312
105 Ga0070712_100106132 3300006175 Bacteria 2087
106 Ga0070712_100158185 3300006175 Bacteria 1747
107 Ga0097621_100230582 3300006237 Bacteria 1616
108 Ga0068871_100040021 3300006358 Bacteria 3753
109 Ga0068871_100310783 3300006358 Bacteria 1385
110 Ga0075428_100011870 3300006844 Bacteria 9689
111 Ga0075428_100013316 3300006844 Bacteria 9149
112 Ga0075428_100386904 3300006844 Bacteria 1499
113 Ga0075433_10002024 3300006852 Bacteria 15289
114 Ga0075433_10044991 3300006852 Bacteria 3836
115 Ga0075434_100000501 3300006871 Bacteria 29643
116 Ga0075434_100023927 3300006871 Bacteria 5962
117 Ga0068865_100152485 3300006881 Bacteria 1754
118 Ga0075436_100020939 3300006914 Bacteria 4485
119 Ga0075435_100058463 3300007076 Bacteria 3123
120 Ga0105240_10028264 3300009093 Bacteria 7326
121 Ga0111539_10007304 3300009094 Bacteria 14148
122 Ga0111539_10448508 3300009094 Bacteria 1502
123 Ga0105245_10010000 3300009098 Bacteria 8260
124 Ga0105245_10012706 3300009098 Bacteria 7332
125 Ga0105245_10025355 3300009098 Bacteria 5215
126 Ga0105245_10045048 3300009098 Bacteria 3938
127 Ga0105245_10256758 3300009098 Bacteria 1700
128 Ga0105245_10457719 3300009098 Bacteria 1286
129 Ga0114129_10026797 3300009147 Bacteria 8161
130 Ga0114129_10072755 3300009147 Bacteria 4791
131 Ga0105243_10047718 3300009148 Bacteria 3373
132 Ga0105243_10074044 3300009148 Bacteria 2761
133 Ga0105243_10430203 3300009148 Bacteria 1233
134 Ga0105241_10174717 3300009174 Bacteria 1777
135 Ga0105248_10197356 3300009177 Bacteria 2268
136 Ga0105237_10019551 3300009545 Bacteria 6996
137 Ga0105238_10142608 3300009551 Bacteria 2372
138 Ga0105239_10145863 3300010375 Bacteria 2639
139 Ga0105239_10241419 3300010375 Bacteria 2028
140 Ga0105239_10342506 3300010375 Bacteria 1687
141 Ga0157340_1000995 3300012473 Bacteria 1217
142 Ga0157371_10054060 3300013102 Bacteria 2852
143 Ga0157369_10227454 3300013105 Bacteria 1951
144 Ga0157374_10363938 3300013296 Bacteria 1439
145 Ga0157378_10127668 3300013297 Bacteria 2351
146 Ga0163162_10070283 3300013306 Bacteria 3552
147 Ga0163162_10114864 3300013306 Bacteria 2792
148 Ga0163162_10378956 3300013306 Bacteria 1548
149 Ga0157372_10125722 3300013307 Bacteria 2948
150 Ga0163163_10048342 3300014325 Bacteria 4183
151 Ga0182008_10030140 3300014497 Bacteria 2736
152 Ga0157377_10089483 3300014745 Bacteria 1815
153 Ga0206349_1982512 3300020075 Bacteria 2884
154 Ga0206355_1028465 3300020076 Bacteria 1326
155 Ga0206351_10297263 3300020077 Bacteria 5593
156 Ga0206352_10406562 3300020078 Bacteria 1480
157 Ga0206350_11158220 3300020080 Bacteria 6745
158 Ga0224712_10001805 3300022467 Bacteria 5105
159 Ga0224712_10004599 3300022467 Bacteria 3740
160 Ga0207653_10012651 3300025885 Bacteria 2635
161 Ga0207653_10018506 3300025885 Bacteria 2193
162 Ga0207692_10030239 3300025898 Bacteria 2581
163 Ga0207692_10050661 3300025898 Bacteria 2101
164 Ga0207642_10042090 3300025899 Bacteria 2005
165 Ga0207699_10012750 3300025906 Bacteria 4281
166 Ga0207643_10020701 3300025908 Bacteria 3612
167 Ga0207684_10035677 3300025910 Bacteria 4222
168 Ga0207684_10108338 3300025910 Bacteria 2377
169 Ga0207654_10044139 3300025911 Bacteria 2530
170 Ga0207707_10006032 3300025912 Bacteria 10601
171 Ga0207707_10024363 3300025912 Bacteria 5296
172 Ga0207707_10049406 3300025912 Bacteria 3664
173 Ga0207695_10047510 3300025913 Bacteria 4542
174 Ga0207671_10094365 3300025914 Bacteria 2258
175 Ga0207693_10000745 3300025915 Bacteria 29290
176 Ga0207693_10003818 3300025915 Bacteria 12830
177 Ga0207693_10005759 3300025915 Bacteria 10280
178 Ga0207663_10007357 3300025916 Bacteria 5705
179 Ga0207663_10032783 3300025916 Bacteria 3087
180 Ga0207663_10051158 3300025916 Bacteria 2571
181 Ga0207663_10052957 3300025916 Bacteria 2533
182 Ga0207660_10020666 3300025917 Bacteria 4423
183 Ga0207662_10045191 3300025918 Bacteria 2603
184 Ga0207652_10010391 3300025921 Bacteria 7495
185 Ga0207652_10059482 3300025921 Bacteria 3294
186 Ga0207652_10203003 3300025921 Bacteria 1784
187 Ga0207652_10381664 3300025921 Bacteria 1272
188 Ga0207646_10002668 3300025922 Bacteria 20905
189 Ga0207646_10012089 3300025922 Bacteria 8310
190 Ga0207687_10036393 3300025927 Bacteria 3353
191 Ga0207687_10101736 3300025927 Bacteria 2116
192 Ga0207687_10113206 3300025927 Bacteria 2018
193 Ga0207664_10016040 3300025929 Bacteria 5457
194 Ga0207664_10018452 3300025929 Bacteria 5137
195 Ga0207664_10056607 3300025929 Bacteria 3114
196 Ga0207664_10187464 3300025929 Bacteria 1779
197 Ga0207664_10198985 3300025929 Bacteria 1728
198 Ga0207664_10279179 3300025929 Bacteria 1465
199 Ga0207706_10004664 3300025933 Bacteria 12847
200 Ga0207706_10012536 3300025933 Bacteria 7721
201 Ga0207686_10038832 3300025934 Bacteria 2884
202 Ga0207709_10056328 3300025935 Bacteria 2433
203 Ga0207709_10108824 3300025935 Bacteria 1849
204 Ga0207709_10139159 3300025935 Bacteria 1666
205 Ga0207669_10093050 3300025937 Bacteria 1969
206 Ga0207669_10135289 3300025937 Bacteria 1701
207 Ga0207704_10025092 3300025938 Bacteria 3247
208 Ga0207665_10019937 3300025939 Bacteria 4406
209 Ga0207665_10023111 3300025939 Bacteria 4096
210 Ga0207665_10047486 3300025939 Bacteria 2879
211 Ga0207691_10038494 3300025940 Bacteria 4426
212 Ga0207691_10153161 3300025940 Bacteria 2026
213 Ga0207689_10102738 3300025942 Bacteria 2348
214 Ga0207661_10058356 3300025944 Bacteria 3105
215 Ga0207661_10067179 3300025944 Bacteria 2915
216 Ga0207667_10085059 3300025949 Bacteria 3274
217 Ga0207667_10288828 3300025949 Bacteria 1676
218 Ga0207651_10147136 3300025960 Bacteria 1829
219 Ga0207651_10168280 3300025960 Bacteria 1726
220 Ga0207712_10015788 3300025961 Bacteria 4878
221 Ga0207677_10051582 3300026023 Bacteria 2790
222 Ga0207703_10261742 3300026035 Bacteria 1564
223 Ga0207678_10023343 3300026067 Bacteria 5409
224 Ga0207702_10031390 3300026078 Bacteria 4427
225 Ga0207702_10182302 3300026078 Bacteria 1934
226 Ga0207641_10107503 3300026088 Bacteria 2468
227 Ga0207641_10109679 3300026088 Bacteria 2445
228 Ga0207648_10013371 3300026089 Bacteria 7639
229 Ga0207676_10063148 3300026095 Bacteria 2941
230 Ga0207674_10000754 3300026116 Bacteria 42273
231 Ga0207674_10062662 3300026116 Bacteria 3755
232 Ga0207675_100004693 3300026118 Bacteria 13155
233 Ga0207675_100009539 3300026118 Bacteria 9078
234 Ga0207675_100013832 3300026118 Bacteria 7525
235 Ga0207683_10002683 3300026121 Bacteria 15543
236 Ga0207683_10002733 3300026121 Bacteria 15408
237 Ga0207683_10004065 3300026121 Bacteria 12645
238 Ga0207683_10071497 3300026121 Bacteria 3067
239 Ga0207683_10077965 3300026121 Bacteria 2935
240 Ga0207683_10305074 3300026121 Bacteria 1457
241 Ga0207428_10006641 3300027907 Bacteria 10626
242 Ga0268266_10259839 3300028379 Bacteria 1609
243 Ga0268264_10041344 3300028381 Bacteria 3813
244 Ga0307410_10292236 3300031852 Bacteria 1283
245 Ga0307409_100035902 3300031995 Bacteria 3637
246 Ga0307409_100119404 3300031995 Bacteria 2229
247 Ga0307416_100159249 3300032002 Bacteria 2084
248 Ga0307415_100076573 3300032126 Bacteria 2372
249 Ga0373958_0001586 3300034819 Bacteria 3079
250 Ga0373952_0021942 3300035092 Bacteria 1352
251 Ga0373932_0033634 3300035112 Bacteria 1441
252 Ga0373945_0005897 3300035116 Bacteria 3933
253 Ga0373960_0008430 3300035121 Bacteria 2470
254 Ga0373943_0011494 3300035170 Bacteria 3984
255 Ga0373947_0006595 3300035725 Bacteria 6737
256 Ga0373937_0020059 3300036401 Bacteria 5988
257 Ga0373937_0212364 3300036401 Bacteria 1821
258 Ga0373925_0051910 3300037068 Bacteria 3062
259 Ga0395899_0004015 3300037312 Bacteria 11598
260 Ga0395899_0004589 3300037312 Bacteria 10766
261 Ga0395899_0005698 3300037312 Bacteria 9668
262 Ga0395899_0012768 3300037312 Bacteria 6436
263 Ga0395899_0018228 3300037312 Bacteria 5340
264 Ga0395899_0020887 3300037312 Bacteria 4965
265 Ga0395899_0102127 3300037312 Bacteria 2069
266 Ga0395900_0004098 3300037418 Bacteria 15535
267 Ga0395900_0005105 3300037418 Bacteria 13785
268 Ga0395900_0020216 3300037418 Bacteria 6794
269 Ga0395900_0023487 3300037418 Bacteria 6310
270 Ga0395900_0045097 3300037418 Bacteria 4541
271 Ga0395900_0093014 3300037418 Bacteria 3097
272 Ga0395900_0156243 3300037418 Bacteria 2329
273 Ga0395900_0202029 3300037418 Bacteria 2010
274 Ga0395900_0332131 3300037418 Bacteria 1498
275 Ga0395898_0001901 3300037466 Bacteria 26597
276 Ga0395898_0013016 3300037466 Bacteria 8574
277 Ga0395898_0023311 3300037466 Bacteria 6256
278 Ga0395898_0032359 3300037466 Bacteria 5220
279 Ga0395898_0036360 3300037466 Bacteria 4889
280 Ga0395898_0058227 3300037466 Bacteria 3762
281 Ga0395898_0065430 3300037466 Bacteria 3524
282 Ga0395898_0114135 3300037466 Bacteria 2588
283 Ga0395898_0193359 3300037466 Bacteria 1944
284 Ga0395898_0232452 3300037466 Bacteria 1758
285 Ga0395898_0477483 3300037466 Bacteria 1186
286 Ga0395905_0002351 3300037471 Bacteria 21071
287 Ga0395905_0010470 3300037471 Bacteria 9021
288 Ga0395905_0019832 3300037471 Bacteria 6371
289 Ga0395905_0028577 3300037471 Bacteria 5256
290 Ga0395905_0050504 3300037471 Bacteria 3896
291 Ga0395905_0109502 3300037471 Bacteria 2593
292 Ga0395905_0264190 3300037471 Bacteria 1606
293 Ga0395901_0007549 3300038443 Bacteria 10983
294 Ga0395901_0009286 3300038443 Bacteria 9968
295 Ga0395901_0016152 3300038443 Bacteria 7603
296 Ga0395901_0031199 3300038443 Bacteria 5494
297 Ga0395901_0032360 3300038443 Bacteria 5396
298 Ga0395901_0045466 3300038443 Bacteria 4556
299 Ga0395901_0120936 3300038443 Bacteria 2752
300 Ga0242420_010877 3300038996 Bacteria 1518
301 Ga0451797_0211954 3300041453 Bacteria 1287
302 Ga0451839_0768405 3300041496 Bacteria 3604
303 Ga0451845_0879632 3300041501 Bacteria 1734
304 Ga0451851_0051219 3300041507 Bacteria 1644
305 Ga0451853_0830679 3300041512 Bacteria 2734
306 Ga0439448_0005422 3300042005 Bacteria 3638
307 Ga0439448_0047493 3300042005 Bacteria 1400
308 Ga0439458_0001281 3300042157 Bacteria 6341
309 Ga0466969_0001344 3300044656 Bacteria 13262
310 Ga0453683_0104556 3300044673 Bacteria 1778
311 Ga0466965_0007238 3300044683 Bacteria 5086
312 Ga0466965_0011451 3300044683 Bacteria 4158
313 Ga0466965_0022529 3300044683 Bacteria 3037
314 Ga0466966_0002635 3300044684 Bacteria 11745
315 Ga0466966_0085008 3300044684 Bacteria 1967
316 Ga0466961_0001489 3300044693 Bacteria 14537
317 Ga0466963_0000049 3300044694 Bacteria 39571
318 Ga0466963_0002757 3300044694 Bacteria 9910
319 Ga0466963_0006001 3300044694 Bacteria 7159
320 Ga0466963_0007473 3300044694 Bacteria 6519
321 Ga0466963_0009362 3300044694 Bacteria 5897
322 Ga0466963_0018623 3300044694 Bacteria 4344
323 Ga0466963_0019385 3300044694 Bacteria 4265
324 Ga0466963_0044160 3300044694 Bacteria 2933
325 Ga0466964_0000135 3300044706 Bacteria 19322
326 Ga0466964_0001648 3300044706 Bacteria 7713
327 Ga0466964_0009659 3300044706 Bacteria 3635
328 Ga0466964_0030279 3300044706 Bacteria 2141
329 Ga0466971_0019799 3300044719 Bacteria 2989
330 Ga0466971_0020791 3300044719 Bacteria 2917
331 Ga0466968_0001014 3300044735 Bacteria 9899
332 Ga0466968_0017615 3300044735 Bacteria 2858
333 Ga0466968_0027783 3300044735 Bacteria 2329
334 Ga0466968_0060049 3300044735 Bacteria 1638
335 Ga0466970_0028153 3300044765 Bacteria 2951
336 Ga0466970_0044290 3300044765 Bacteria 2369
337 Ga0466957_0007860 3300044842 Bacteria 6046
338 Ga0466957_0011295 3300044842 Bacteria 5148
339 Ga0466957_0014160 3300044842 Bacteria 4640
340 Ga0466957_0022183 3300044842 Bacteria 3743
341 Ga0466957_0033369 3300044842 Bacteria 3088
342 Ga0466957_0047201 3300044842 Bacteria 2616
343 Ga0466957_0075745 3300044842 Bacteria 2088
344 Ga0466957_0095490 3300044842 Bacteria 1867
345 Ga0466957_0118895 3300044842 Bacteria 1683
346 Ga0466957_0138795 3300044842 Bacteria 1564
347 Ga0466960_0003700 3300044901 Bacteria 5908
348 Ga0466959_0006057 3300045049 Bacteria 8345
349 Ga0466959_0018084 3300045049 Bacteria 5172
350 Ga0451576_0009519 3300045051 Bacteria 11260
351 Ga0466958_0000746 3300045836 Bacteria 14259
352 Ga0466958_0001602 3300045836 Bacteria 10876
353 Ga0466958_0002292 3300045836 Bacteria 9545
354 Ga0466958_0010456 3300045836 Bacteria 5198
355 Ga0466958_0016644 3300045836 Bacteria 4237
356 Ga0466958_0026200 3300045836 Bacteria 3444
357 Ga0466958_0043171 3300045836 Bacteria 2715
358 Ga0466958_0044704 3300045836 Bacteria 2670
359 Ga0466967_0000751 3300045976 Bacteria 16702
360 Ga0466967_0002790 3300045976 Bacteria 11065
361 Ga0466967_0007103 3300045976 Bacteria 8033
362 Ga0466967_0039799 3300045976 Bacteria 4044
363 Ga0466967_0052432 3300045976 Bacteria 3580
364 Ga0466967_0054180 3300045976 Bacteria 3528
365 Ga0466967_0084597 3300045976 Bacteria 2870
366 Ga0466967_0110876 3300045976 Bacteria 2520
367 Ga0466967_0176905 3300045976 Bacteria 2010
368 Ga0466967_0236403 3300045976 Bacteria 1741
369 Ga0466967_0267058 3300045976 Bacteria 1638
370 Ga0495592_0001046 3300046454 Bacteria 19192
371 Ga0495592_0015721 3300046454 Bacteria 5740
372 Ga0495603_0000295 3300046455 Bacteria 26481
373 Ga0495603_0010782 3300046455 Bacteria 5543
374 Ga0495641_0002110 3300046461 Bacteria 16054
375 Ga0495651_0000004 3300046462 Bacteria 177080
376 Ga0495651_0113624 3300046462 Bacteria 1999
377 Ga0495651_0146530 3300046462 Bacteria 1706
378 Ga0495653_0012045 3300046463 Bacteria 7056
379 Ga0495653_0071623 3300046463 Bacteria 2590
380 Ga0495594_0009429 3300046499 Bacteria 5041
381 Ga0495594_0165170 3300046499 Bacteria 1259
382 Ga0495608_0043456 3300046511 Bacteria 3002
383 Ga0495618_0000108 3300046514 Bacteria 60531
384 Ga0495618_0003214 3300046514 Bacteria 10239
385 Ga0495620_0061191 3300046515 Bacteria 1567
386 Ga0495628_0001177 3300046516 Bacteria 23864
387 Ga0495628_0026811 3300046516 Bacteria 4691
388 Ga0495630_0080282 3300046517 Bacteria 2460
389 Ga0495644_0026183 3300046523 Bacteria 2214
390 Ga0495663_0003525 3300046525 Bacteria 4506
391 Ga0495666_0007094 3300046526 Bacteria 5631
392 Ga0495652_0000047 3300046529 Bacteria 121525
393 Ga0495652_0024242 3300046529 Bacteria 5372
394 Ga0495654_0141259 3300046530 Bacteria 1073
395 Ga0495665_0077268 3300046531 Bacteria 1752
396 Ga0495640_0043563 3300046533 Bacteria 3124
397 Ga0495587_0000103 3300046536 Bacteria 64471
398 Ga0495587_0109384 3300046536 Bacteria 1588
399 Ga0495645_0000018 3300046543 Bacteria 155263
400 Ga0495645_0000028 3300046543 Bacteria 113461
401 Ga0495645_0038843 3300046543 Bacteria 3471
402 Ga0495667_0011453 3300046559 Bacteria 6002
403 Ga0495656_0007442 3300046615 Bacteria 3867
404 Ga0495656_0020319 3300046615 Bacteria 2574
405 Ga0495668_0099288 3300046616 Bacteria 1593
406 Ga0495634_0028662 3300046642 Bacteria 3863
407 Ga0495634_0259359 3300046642 Bacteria 1061
408 Ga0495657_0002632 3300046675 Bacteria 15029
409 Ga0495657_0070189 3300046675 Bacteria 2290
410 Ga0495599_0000073 3300046678 Bacteria 70685
411 Ga0495599_0052793 3300046678 Bacteria 2546
412 Ga0495623_0000105 3300046679 Bacteria 51809
413 Ga0495623_0019910 3300046679 Bacteria 4338
414 Ga0495646_0001581 3300046680 Bacteria 13581
415 Ga0495646_0022631 3300046680 Bacteria 3963
416 Ga0495647_0112751 3300046681 Bacteria 1136
417 Ga0495669_0051220 3300046684 Bacteria 1853
418 Ga0495613_0029539 3300046689 Bacteria 4075
419 Ga0495624_0073389 3300046690 Bacteria 2127
420 Ga0495604_0000027 3300047317 Bacteria 143025
421 Ga0495674_0025664 3300047319 Bacteria 5398
422 Ga0495676_0093835 3300047321 Bacteria 2237
423 Ga0495676_0103172 3300047321 Bacteria 2106
424 Ga0495676_0170285 3300047321 Bacteria 1533
425 Ga0495680_0001582 3300047322 Bacteria 24358
426 Ga0495680_0044887 3300047322 Bacteria 3492
427 Ga0495680_0212418 3300047322 Bacteria 1384
428 Ga0495675_0000273 3300047444 Bacteria 37403
429 Ga0495677_0034993 3300047445 Bacteria 1833
430 Ga0495677_0054275 3300047445 Bacteria 1478
431 Ga0495602_0000096 3300048088 Bacteria 82587
432 Ga0495602_0089334 3300048088 Bacteria 2562
433 Ga0496100_0035370 3300048903 Bacteria 3141
434 Ga0496100_0094621 3300048903 Bacteria 2046
435 Ga0496101_0003723 3300048904 Bacteria 9511
436 Ga0496101_0015282 3300048904 Bacteria 5169
437 Ga0496101_0117932 3300048904 Bacteria 2004
438 Ga0496102_0038952 3300048905 Bacteria 4293
439 Ga0496102_0134382 3300048905 Bacteria 2317
440 Ga0496102_0340467 3300048905 Bacteria 1412
441 Ga0496103_0013827 3300048906 Bacteria 4791
442 Ga0496103_0100546 3300048906 Bacteria 1830
443 Ga0496104_0003518 3300048907 Bacteria 13506
444 Ga0496104_0017689 3300048907 Bacteria 6497
445 Ga0496104_0024222 3300048907 Bacteria 5582
446 Ga0496104_0042947 3300048907 Bacteria 4245
447 Ga0496104_0053886 3300048907 Bacteria 3801
448 Ga0496104_0066975 3300048907 Bacteria 3410
449 Ga0496104_0094055 3300048907 Bacteria 2867
450 Ga0496105_0000090 3300048908 Bacteria 63276
451 Ga0496105_0001813 3300048908 Bacteria 15288
452 Ga0496105_0026452 3300048908 Bacteria 4732
453 Ga0496105_0029798 3300048908 Bacteria 4467
454 Ga0496105_0183127 3300048908 Unclassified 1715
455 Ga0496105_0318349 3300048908 Bacteria 1247
456 Ga0496106_0016832 3300048909 Bacteria 5409
457 Ga0496106_0105401 3300048909 Bacteria 2190
458 Ga0496106_0148559 3300048909 Bacteria 1847
459 Ga0496108_0013211 3300048911 Bacteria 6729
460 Ga0496108_0019932 3300048911 Bacteria 5508
461 Ga0496108_0124238 3300048911 Bacteria 2215
462 Ga0496108_0147909 3300048911 Bacteria 2026
463 Ga0496108_0326570 3300048911 Bacteria 1338
464 Ga0496109_0000787 3300048912 Bacteria 26394
465 Ga0496109_0012945 3300048912 Bacteria 7213
466 Ga0496109_0016923 3300048912 Bacteria 6381
467 Ga0496109_0021998 3300048912 Bacteria 5645
468 Ga0496109_0027663 3300048912 Bacteria 5066
469 Ga0496110_0002074 3300048913 Bacteria 14941
470 Ga0496110_0004223 3300048913 Bacteria 11117
471 Ga0496110_0153492 3300048913 Bacteria 2085
472 Ga0496111_0002063 3300048914 Bacteria 11971
473 Ga0496111_0003155 3300048914 Bacteria 10146
474 Ga0496111_0005442 3300048914 Bacteria 8158
475 Ga0496111_0016781 3300048914 Bacteria 5052
476 Ga0496111_0086207 3300048914 Bacteria 2297
477 Ga0496111_0145982 3300048914 Bacteria 1754
478 Ga0496111_0269591 3300048914 Bacteria 1263
479 Ga0496112_0012970 3300048915 Bacteria 7680
480 Ga0496112_0268372 3300048915 Bacteria 1655
481 Ga0496113_0013398 3300048916 Bacteria 5553
482 Ga0496113_0055097 3300048916 Bacteria 2980
483 Ga0496113_0077338 3300048916 Bacteria 2544
484 Ga0496113_0113384 3300048916 Bacteria 2113
485 Ga0496113_0232407 3300048916 Bacteria 1470
486 Ga0496114_0008291 3300048917 Bacteria 8233
487 Ga0496114_0008396 3300048917 Bacteria 8182
488 Ga0496114_0014802 3300048917 Bacteria 6269
489 Ga0496114_0039252 3300048917 Bacteria 3917
490 Ga0496115_0018111 3300048918 Bacteria 5399
491 Ga0496115_0053781 3300048918 Bacteria 3232
492 Ga0496115_0295532 3300048918 Bacteria 1328
493 Ga0501036_0155024 3300049572 Bacteria 1932
494 Ga0501038_0157848 3300049574 Bacteria 1846
495 Ga0501040_0094285 3300049576 Bacteria 2082
496 Ga0501040_0124780 3300049576 Bacteria 1808
497 Ga0501042_0114458 3300049578 Bacteria 1942
498 Ga0501046_0119733 3300049580 Bacteria 2004
499 Ga0501067_0002844 3300049583 Bacteria 9524
500 Ga0501069_0008029 3300049585 Bacteria 5544
501 Ga0501070_0062106 3300049586 Bacteria 3095
502 Ga0501070_0133994 3300049586 Bacteria 2046
503 Ga0501071_0118056 3300049587 Bacteria 1965
504 Ga0501075_0320604 3300049591 Bacteria 1181
505 Ga0501076_0119791 3300049592 Bacteria 2131
506 Ga0501077_0092715 3300049593 Bacteria 1914
507 Ga0501079_0041483 3300049741 Bacteria 3553
508 nmdc:mga0yw44_5817_c1 3300050492 Bacteria 5882
509 nmdc:mga0yw44_64832_c1 3300050492 Bacteria 2249
510 nmdc:mga09592_275197_c1 3300050508 Bacteria 1460
511 nmdc:mga08y16_13885_c1 3300050511 Bacteria 8474
512 nmdc:mga0n895_107976_c1 3300050512 Bacteria 2797
513 nmdc:mga0n895_198276_c1 3300050512 Bacteria 2039
514 nmdc:mga0n895_229532_c1 3300050512 Bacteria 1884
515 nmdc:mga0n895_2423_c1 3300050512 Bacteria 14546
516 nmdc:mga0rr50_5401_c1 3300050513 Bacteria 7618
517 nmdc:mga0rr50_80086_c1 3300050513 Bacteria 2517
518 nmdc:mga0a205_314629_c1 3300050515 Bacteria 1437
519 nmdc:mga0a205_48_c2 3300050515 Bacteria 21064
520 Ga0495601_0000185 3300053077 Bacteria 33092
521 Ga0495601_0003652 3300053077 Bacteria 8849
522 Ga0495601_0058846 3300053077 Bacteria 2436
523 Ga0495595_0015062 3300053084 Bacteria 3292
524 Ga0495595_0017230 3300053084 Bacteria 3107
525 Ga0495619_0001233 3300053085 Bacteria 16742
526 Ga0495619_0041808 3300053085 Bacteria 2999
527 Ga0495619_0150571 3300053085 Bacteria 1605
528 Ga0501084_0040824 3300054114 Bacteria 3882
529 Ga0587073_0006971 3300059492 Bacteria 1765
530 Ga0501082_0058875 3300060353 Bacteria 3310
531 Ga0466962_0040262 3300061719 Bacteria 2237
532 Ga0530510_0029881 3300061734 Bacteria 3912
533 Ga0496112_0000829
534 Ga0070683_100007597
535 Ga0070683_100083916
536 Ga0070690_100013603
537 Ga0070680_100010198
538 Ga0070680_100016677
539 Ga0070682_100006325
540 Ga0068868_100048294
541 Ga0068868_100307975
542 Ga0070660_100048026
543 Ga0070692_10055300
544 Ga0070668_100094382
545 Ga0070669_100125871
546 Ga0070674_100059538
547 Ga0070674_100143492
548 Ga0070673_100116601
549 Ga0070659_100049858
550 Ga0070709_10031789
551 Ga0070709_10038943
552 Ga0070714_100005831
553 Ga0070714_100013013
554 Ga0070714_100046392
555 Ga0070714_100128280
556 Ga0070713_100008343
557 Ga0070710_10018932
558 Ga0070701_10018539
559 Ga0070711_100002195
560 Ga0070711_100091259
561 Ga0070711_100174852
562 Ga0070711_100241797
563 Ga0070705_100011889
564 Ga0070705_100012468
565 Ga0070705_100046882
566 Ga0070705_100107154
567 Ga0070705_100201251
568 Ga0070694_100011333
569 Ga0070694_100124584
570 Ga0070708_100059071
571 Ga0070708_100124425
572 Ga0070663_100033327
573 Ga0070678_100008410
574 Ga0070678_100009379
575 Ga0070678_100047148
576 Ga0070678_100082493
577 Ga0070662_100095710
578 Ga0070662_100153000
579 Ga0070681_10001644
580 Ga0070681_10246262
581 Ga0070706_100009458
582 Ga0070706_100058452
583 Ga0070706_100085348
584 Ga0070706_100091663
585 Ga0070707_100003044
586 Ga0070707_100008184
587 Ga0070698_100008649
588 Ga0070698_100012430
589 Ga0070698_100137572
590 Ga0070699_100050915
591 Ga0070699_100101314
592 Ga0070699_100123221
593 Ga0070679_100365733
594 Ga0070684_100000327
595 Ga0070684_100000415
596 Ga0070684_100074596
597 Ga0070684_100256917
598 Ga0070697_100156987
599 Ga0070686_100022587
600 Ga0070686_100082236
601 Ga0070695_100090052
602 Ga0070696_100003893
603 Ga0070696_100016897
604 Ga0070696_100067187
605 Ga0070696_100139060
606 Ga0070693_100018460
607 Ga0070693_100053368
608 Ga0070704_100028184
609 Ga0068855_100025493
610 Ga0068855_100107963
611 Ga0070664_100061853
612 Ga0068857_100177232
613 Ga0068854_100077758
614 Ga0068856_100051894
615 Ga0068856_100068487
616 Ga0068856_100096855
617 Ga0070702_100012846
618 Ga0068866_10059958
619 Ga0068861_100018933
620 Ga0068861_100065621
621 Ga0068870_10016153
622 Ga0068863_100067702
623 Ga0068858_100115362
624 Ga0068858_100218966
625 Ga0081455_10010590
626 Ga0081538_10016471
627 Ga0081540_1004451
628 Ga0081540_1015979
629 Ga0081540_1019701
630 Ga0070717_10011803
631 Ga0070717_10026636
632 Ga0070717_10092891
633 Ga0075432_10043606
634 Ga0070715_10087788
635 Ga0070716_100018892
636 Ga0070712_100084111
637 Ga0070712_100106132
638 Ga0070712_100158185
639 Ga0097621_100230582
640 Ga0068871_100040021
641 Ga0068871_100310783
642 Ga0075428_100011870
643 Ga0075428_100013316
644 Ga0075428_100386904
645 Ga0075433_10002024
646 Ga0075433_10044991
647 Ga0075434_100000501
648 Ga0075434_100023927
649 Ga0068865_100152485
650 Ga0075436_100020939
651 Ga0075435_100058463
652 Ga0105240_10028264
653 Ga0111539_10007304
654 Ga0111539_10448508
655 Ga0105245_10010000
656 Ga0105245_10012706
657 Ga0105245_10025355
658 Ga0105245_10045048
659 Ga0105245_10256758
660 Ga0105245_10457719
661 Ga0114129_10026797
662 Ga0114129_10072755
663 Ga0105243_10047718
664 Ga0105243_10074044
665 Ga0105243_10430203
666 Ga0105241_10174717
667 Ga0105248_10197356
668 Ga0105237_10019551
669 Ga0105238_10142608
670 Ga0105239_10145863
671 Ga0105239_10241419
672 Ga0105239_10342506
673 Ga0157340_1000995
674 Ga0157371_10054060
675 Ga0157369_10227454
676 Ga0157374_10363938
677 Ga0157378_10127668
678 Ga0163162_10070283
679 Ga0163162_10114864
680 Ga0163162_10378956
681 Ga0157372_10125722
682 Ga0163163_10048342
683 Ga0182008_10030140
684 Ga0157377_10089483
685 Ga0206349_1982512
686 Ga0206355_1028465
687 Ga0206351_10297263
688 Ga0206352_10406562
689 Ga0206350_11158220
690 Ga0224712_10001805
691 Ga0224712_10004599
692 Ga0207653_10012651
693 Ga0207653_10018506
694 Ga0207692_10030239
695 Ga0207692_10050661
696 Ga0207642_10042090
697 Ga0207699_10012750
698 Ga0207643_10020701
699 Ga0207684_10035677
700 Ga0207684_10108338
701 Ga0207654_10044139
702 Ga0207707_10006032
703 Ga0207707_10024363
704 Ga0207707_10049406
705 Ga0207695_10047510
706 Ga0207671_10094365
707 Ga0207693_10000745
708 Ga0207693_10003818
709 Ga0207693_10005759
710 Ga0207663_10007357
711 Ga0207663_10032783
712 Ga0207663_10051158
713 Ga0207663_10052957
714 Ga0207660_10020666
715 Ga0207662_10045191
716 Ga0207652_10010391
717 Ga0207652_10059482
718 Ga0207652_10203003
719 Ga0207652_10381664
720 Ga0207646_10002668
721 Ga0207646_10012089
722 Ga0207687_10036393
723 Ga0207687_10101736
724 Ga0207687_10113206
725 Ga0207664_10016040
726 Ga0207664_10018452
727 Ga0207664_10056607
728 Ga0207664_10187464
729 Ga0207664_10198985
730 Ga0207664_10279179
731 Ga0207706_10004664
732 Ga0207706_10012536
733 Ga0207686_10038832
734 Ga0207709_10056328
735 Ga0207709_10108824
736 Ga0207709_10139159
737 Ga0207669_10093050
738 Ga0207669_10135289
739 Ga0207704_10025092
740 Ga0207665_10019937
741 Ga0207665_10023111
742 Ga0207665_10047486
743 Ga0207691_10038494
744 Ga0207691_10153161
745 Ga0207689_10102738
746 Ga0207661_10058356
747 Ga0207661_10067179
748 Ga0207667_10085059
749 Ga0207667_10288828
750 Ga0207651_10147136
751 Ga0207651_10168280
752 Ga0207712_10015788
753 Ga0207677_10051582
754 Ga0207703_10261742
755 Ga0207678_10023343
756 Ga0207702_10031390
757 Ga0207702_10182302
758 Ga0207641_10107503
759 Ga0207641_10109679
760 Ga0207648_10013371
761 Ga0207676_10063148
762 Ga0207674_10000754
763 Ga0207674_10062662
764 Ga0207675_100004693
765 Ga0207675_100009539
766 Ga0207675_100013832
767 Ga0207683_10002683
768 Ga0207683_10002733
769 Ga0207683_10004065
770 Ga0207683_10071497
771 Ga0207683_10077965
772 Ga0207683_10305074
773 Ga0207428_10006641
774 Ga0268266_10259839
775 Ga0268264_10041344
776 Ga0307410_10292236
777 Ga0307409_100035902
778 Ga0307409_100119404
779 Ga0307416_100159249
780 Ga0307415_100076573
781 Ga0373958_0001586
782 Ga0373952_0021942
783 Ga0373932_0033634
784 Ga0373945_0005897
785 Ga0373960_0008430
786 Ga0373943_0011494
787 Ga0373947_0006595
788 Ga0373937_0020059
789 Ga0373937_0212364
790 Ga0373925_0051910
791 Ga0395899_0004015
792 Ga0395899_0004589
793 Ga0395899_0005698
794 Ga0395899_0012768
795 Ga0395899_0018228
796 Ga0395899_0020887
797 Ga0395899_0102127
798 Ga0395900_0004098
799 Ga0395900_0005105
800 Ga0395900_0020216
801 Ga0395900_0023487
802 Ga0395900_0045097
803 Ga0395900_0093014
804 Ga0395900_0156243
805 Ga0395900_0202029
806 Ga0395900_0332131
807 Ga0395898_0001901
808 Ga0395898_0013016
809 Ga0395898_0023311
810 Ga0395898_0032359
811 Ga0395898_0036360
812 Ga0395898_0058227
813 Ga0395898_0065430
814 Ga0395898_0114135
815 Ga0395898_0193359
816 Ga0395898_0232452
817 Ga0395898_0477483
818 Ga0395905_0002351
819 Ga0395905_0010470
820 Ga0395905_0019832
821 Ga0395905_0028577
822 Ga0395905_0050504
823 Ga0395905_0109502
824 Ga0395905_0264190
825 Ga0395901_0007549
826 Ga0395901_0009286
827 Ga0395901_0016152
828 Ga0395901_0031199
829 Ga0395901_0032360
830 Ga0395901_0045466
831 Ga0395901_0120936
832 Ga0242420_010877
833 Ga0451797_0211954
834 Ga0451839_0768405
835 Ga0451845_0879632
836 Ga0451851_0051219
837 Ga0451853_0830679
838 Ga0439448_0005422
839 Ga0439448_0047493
840 Ga0439458_0001281
841 Ga0466969_0001344
842 Ga0453683_0104556
843 Ga0466965_0007238
844 Ga0466965_0011451
845 Ga0466965_0022529
846 Ga0466966_0002635
847 Ga0466966_0085008
848 Ga0466961_0001489
849 Ga0466963_0000049
850 Ga0466963_0002757
851 Ga0466963_0006001
852 Ga0466963_0007473
853 Ga0466963_0009362
854 Ga0466963_0018623
855 Ga0466963_0019385
856 Ga0466963_0044160
857 Ga0466964_0000135
858 Ga0466964_0001648
859 Ga0466964_0009659
860 Ga0466964_0030279
861 Ga0466971_0019799
862 Ga0466971_0020791
863 Ga0466968_0001014
864 Ga0466968_0017615
865 Ga0466968_0027783
866 Ga0466968_0060049
867 Ga0466970_0028153
868 Ga0466970_0044290
869 Ga0466957_0007860
870 Ga0466957_0011295
871 Ga0466957_0014160
872 Ga0466957_0022183
873 Ga0466957_0033369
874 Ga0466957_0047201
875 Ga0466957_0075745
876 Ga0466957_0095490
877 Ga0466957_0118895
878 Ga0466957_0138795
879 Ga0466960_0003700
880 Ga0466959_0006057
881 Ga0466959_0018084
882 Ga0451576_0009519
883 Ga0466958_0000746
884 Ga0466958_0001602
885 Ga0466958_0002292
886 Ga0466958_0010456
887 Ga0466958_0016644
888 Ga0466958_0026200
889 Ga0466958_0043171
890 Ga0466958_0044704
891 Ga0466967_0000751
892 Ga0466967_0002790
893 Ga0466967_0007103
894 Ga0466967_0039799
895 Ga0466967_0052432
896 Ga0466967_0054180
897 Ga0466967_0084597
898 Ga0466967_0110876
899 Ga0466967_0176905
900 Ga0466967_0236403
901 Ga0466967_0267058
902 Ga0495592_0001046
903 Ga0495592_0015721
904 Ga0495603_0000295
905 Ga0495603_0010782
906 Ga0495641_0002110
907 Ga0495651_0000004
908 Ga0495651_0113624
909 Ga0495651_0146530
910 Ga0495653_0012045
911 Ga0495653_0071623
912 Ga0495594_0009429
913 Ga0495594_0165170
914 Ga0495608_0043456
915 Ga0495618_0000108
916 Ga0495618_0003214
917 Ga0495620_0061191
918 Ga0495628_0001177
919 Ga0495628_0026811
920 Ga0495630_0080282
921 Ga0495644_0026183
922 Ga0495663_0003525
923 Ga0495666_0007094
924 Ga0495652_0000047
925 Ga0495652_0024242
926 Ga0495654_0141259
927 Ga0495665_0077268
928 Ga0495640_0043563
929 Ga0495587_0000103
930 Ga0495587_0109384
931 Ga0495645_0000018
932 Ga0495645_0000028
933 Ga0495645_0038843
934 Ga0495667_0011453
935 Ga0495656_0007442
936 Ga0495656_0020319
937 Ga0495668_0099288
938 Ga0495634_0028662
939 Ga0495634_0259359
940 Ga0495657_0002632
941 Ga0495657_0070189
942 Ga0495599_0000073
943 Ga0495599_0052793
944 Ga0495623_0000105
945 Ga0495623_0019910
946 Ga0495646_0001581
947 Ga0495646_0022631
948 Ga0495647_0112751
949 Ga0495669_0051220
950 Ga0495613_0029539
951 Ga0495624_0073389
952 Ga0495604_0000027
953 Ga0495674_0025664
954 Ga0495676_0093835
955 Ga0495676_0103172
956 Ga0495676_0170285
957 Ga0495680_0001582
958 Ga0495680_0044887
959 Ga0495680_0212418
960 Ga0495675_0000273
961 Ga0495677_0034993
962 Ga0495677_0054275
963 Ga0495602_0000096
964 Ga0495602_0089334
965 Ga0496100_0035370
966 Ga0496100_0094621
967 Ga0496101_0003723
968 Ga0496101_0015282
969 Ga0496101_0117932
970 Ga0496102_0038952
971 Ga0496102_0134382
972 Ga0496102_0340467
973 Ga0496103_0013827
974 Ga0496103_0100546
975 Ga0496104_0003518
976 Ga0496104_0017689
977 Ga0496104_0024222
978 Ga0496104_0042947
979 Ga0496104_0053886
980 Ga0496104_0066975
981 Ga0496104_0094055
982 Ga0496105_0000090
983 Ga0496105_0001813
984 Ga0496105_0026452
985 Ga0496105_0029798
986 Ga0496105_0183127
987 Ga0496105_0318349
988 Ga0496106_0016832
989 Ga0496106_0105401
990 Ga0496106_0148559
991 Ga0496108_0013211
992 Ga0496108_0019932
993 Ga0496108_0124238
994 Ga0496108_0147909
995 Ga0496108_0326570
996 Ga0496109_0000787
997 Ga0496109_0012945
998 Ga0496109_0016923
999 Ga0496109_0021998
1000 Ga0496109_0027663
1001 Ga0496110_0002074
1002 Ga0496110_0004223
1003 Ga0496110_0153492
1004 Ga0496111_0002063
1005 Ga0496111_0003155
1006 Ga0496111_0005442
1007 Ga0496111_0016781
1008 Ga0496111_0086207
1009 Ga0496111_0145982
1010 Ga0496111_0269591
1011 Ga0496112_0012970
1012 Ga0496112_0268372
1013 Ga0496113_0013398
1014 Ga0496113_0055097
1015 Ga0496113_0077338
1016 Ga0496113_0113384
1017 Ga0496113_0232407
1018 Ga0496114_0008291
1019 Ga0496114_0008396
1020 Ga0496114_0014802
1021 Ga0496114_0039252
1022 Ga0496115_0018111
1023 Ga0496115_0053781
1024 Ga0496115_0295532
1025 Ga0501036_0155024
1026 Ga0501038_0157848
1027 Ga0501040_0094285
1028 Ga0501040_0124780
1029 Ga0501042_0114458
1030 Ga0501046_0119733
1031 Ga0501067_0002844
1032 Ga0501069_0008029
1033 Ga0501070_0062106
1034 Ga0501070_0133994
1035 Ga0501071_0118056
1036 Ga0501075_0320604
1037 Ga0501076_0119791
1038 Ga0501077_0092715
1039 Ga0501079_0041483
1040 nmdc:mga0yw44_5817_c1
1041 nmdc:mga0yw44_64832_c1
1042 nmdc:mga09592_275197_c1
1043 nmdc:mga08y16_13885_c1
1044 nmdc:mga0n895_107976_c1
1045 nmdc:mga0n895_198276_c1
1046 nmdc:mga0n895_229532_c1
1047 nmdc:mga0n895_2423_c1
1048 nmdc:mga0rr50_5401_c1
1049 nmdc:mga0rr50_80086_c1
1050 nmdc:mga0a205_314629_c1
1051 nmdc:mga0a205_48_c2
1052 Ga0495601_0000185
1053 Ga0495601_0003652
1054 Ga0495601_0058846
1055 Ga0495595_0015062
1056 Ga0495595_0017230
1057 Ga0495619_0001233
1058 Ga0495619_0041808
1059 Ga0495619_0150571
1060 Ga0501084_0040824
1061 Ga0587073_0006971
1062 Ga0501082_0058875
1063 Ga0466962_0040262
1064 Ga0530510_0029881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

50

374

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oey-assembly1.cif.gz_B neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution 0.9808 4 357
7bbx-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase, variant k8a 0.9806 5 357
7odq-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase at 5.4 mgy dose 0.9792 5 357
7bbw-assembly2.cif.gz_B neisseria gonorrhoeae transaldolase, variant c38s 0.9792 6 357
7oey-assembly1.cif.gz_B neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution 0.9753 4 357
ID Description Score Start End Superfamily
3clmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9761 5 357 3.20.20.70
af_I1JM01_1_306_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9721 65 360 3.20.20.70
af_B4FRC9_66_421_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9687 5 360 3.20.20.70
3clmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9651 5 357 3.20.20.70
af_K7L4A2_15_219_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9581 50 250 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6G3XGD8-F1-model_v4 transaldolase (EC 2.2.1.2) 0.9995 94 173 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A538GE18-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9983 1 333 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A6B3CHQ4-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9983 135 205 GO:0004801
GO:0005737
GO:0005975
AF-A0A7V9RX20-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9981 65 364 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A349B819-F1-model_v4 transaldolase (EC 2.2.1.2) 0.9966 106 285 GO:0004801
GO:0005737
GO:0005975
GO:0006098

Map