F460310
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 532 | 281 | 532 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0206586|Ga0451576_0206586_1215_1970 |
| Length | 251 |
| Sequence | MALREKSRPAVRSARKTNEGSTPVSKGRLIRLLLVDDHEVVRLGLRALFNRTGTIRVVGEADTMESAIAQAVRLKPDVILMDVRLPDGDGIEACREIRSECPDIRVLFLTSYSDEAAVVSTVFAGAAGFLLKEIGGSALVQAIETVAKGQSIFDPSAVQRMIAQMHPQSADEKPSPEDALSPRDERILALVAEGKTNKQIAVELNLSDKTIKNLLSVIFQKLQISRRSQAAAIFVKRAAAHYYPVIPKKDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 180 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 181 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 182 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 183 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 184 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 185 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 186 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 187 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 188 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 189 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 190 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 191 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 192 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 193 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 194 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 200 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 201 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 202 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 203 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 204 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 205 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 206 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 207 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 208 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 209 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 229 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 230 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 231 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 232 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 233 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 235 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 236 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 239 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 240 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 241 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 242 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 244 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 245 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 246 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 247 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 248 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 249 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 252 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 257 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 258 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 259 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 260 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 261 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 263 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 264 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 265 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 266 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 267 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 268 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 0.56 |
| Rhizosphere | 98.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10035592 | 3300001990 | Bacteria | 1540 |
| 2 | JGI25162J39368_1001285 | 3300002737 | Bacteria | 14229 |
| 3 | JGI25165J46597_1000649 | 3300003214 | Bacteria | 28510 |
| 4 | JGI26145J50221_1000622 | 3300003371 | Bacteria | 2990 |
| 5 | Ga0058862_12494334 | 3300004803 | Bacteria | 1039 |
| 6 | Ga0065715_10343468 | 3300005293 | Bacteria | 963 |
| 7 | Ga0065707_10082920 | 3300005295 | Bacteria | 11403 |
| 8 | Ga0065707_10147163 | 3300005295 | Bacteria | 1699 |
| 9 | Ga0065707_10155957 | 3300005295 | Unclassified | 1608 |
| 10 | Ga0065707_10156844 | 3300005295 | Bacteria | 1600 |
| 11 | Ga0070676_10000208 | 3300005328 | Bacteria | 24961 |
| 12 | Ga0070676_10334801 | 3300005328 | Bacteria | 1036 |
| 13 | Ga0070683_100013326 | 3300005329 | Bacteria | 7167 |
| 14 | Ga0070690_100000336 | 3300005330 | Bacteria | 24075 |
| 15 | Ga0070690_100053293 | 3300005330 | Bacteria | 2588 |
| 16 | Ga0070690_100255661 | 3300005330 | Bacteria | 1241 |
| 17 | Ga0070670_100035231 | 3300005331 | Bacteria | 4309 |
| 18 | Ga0070677_10033528 | 3300005333 | Bacteria | 1978 |
| 19 | Ga0070677_10125513 | 3300005333 | Bacteria | 1165 |
| 20 | Ga0068869_100044072 | 3300005334 | Bacteria | 3208 |
| 21 | Ga0070666_10093743 | 3300005335 | Bacteria | 2065 |
| 22 | Ga0070680_100014057 | 3300005336 | Bacteria | 6249 |
| 23 | Ga0070680_100015879 | 3300005336 | Bacteria | 5912 |
| 24 | Ga0070680_100245468 | 3300005336 | Bacteria | 1514 |
| 25 | Ga0068868_100003923 | 3300005338 | Bacteria | 10391 |
| 26 | Ga0070660_100155336 | 3300005339 | Bacteria | 1841 |
| 27 | Ga0070689_100000066 | 3300005340 | Bacteria | 62639 |
| 28 | Ga0070689_100013687 | 3300005340 | Bacteria | 5876 |
| 29 | Ga0070689_100027407 | 3300005340 | Bacteria | 4295 |
| 30 | Ga0070689_100166053 | 3300005340 | Bacteria | 1787 |
| 31 | Ga0070689_100499628 | 3300005340 | Bacteria | 1042 |
| 32 | Ga0070689_100922121 | 3300005340 | Bacteria | 774 |
| 33 | Ga0070691_10000458 | 3300005341 | Bacteria | 15123 |
| 34 | Ga0070691_10098550 | 3300005341 | Bacteria | 1449 |
| 35 | Ga0070687_100007886 | 3300005343 | Bacteria | 4477 |
| 36 | Ga0070687_100014961 | 3300005343 | Bacteria | 3498 |
| 37 | Ga0070661_100059011 | 3300005344 | Bacteria | 2813 |
| 38 | Ga0070661_100162922 | 3300005344 | Bacteria | 1690 |
| 39 | Ga0070692_10007059 | 3300005345 | Bacteria | 4928 |
| 40 | Ga0070692_10052047 | 3300005345 | Bacteria | 2132 |
| 41 | Ga0070692_10065240 | 3300005345 | Unclassified | 1927 |
| 42 | Ga0070692_10351715 | 3300005345 | Bacteria | 916 |
| 43 | Ga0070669_100001454 | 3300005353 | Bacteria | 17172 |
| 44 | Ga0070675_100022925 | 3300005354 | Bacteria | 4989 |
| 45 | Ga0070675_100121241 | 3300005354 | Bacteria | 2222 |
| 46 | Ga0070674_100002716 | 3300005356 | Bacteria | 9792 |
| 47 | Ga0070674_100622115 | 3300005356 | Bacteria | 915 |
| 48 | Ga0070673_100003965 | 3300005364 | Bacteria | 9304 |
| 49 | Ga0070673_100166502 | 3300005364 | Bacteria | 1879 |
| 50 | Ga0070688_100000114 | 3300005365 | Bacteria | 41990 |
| 51 | Ga0070688_100003042 | 3300005365 | Bacteria | 8559 |
| 52 | Ga0070659_100045053 | 3300005366 | Bacteria | 3455 |
| 53 | Ga0070667_100044367 | 3300005367 | Bacteria | 3733 |
| 54 | Ga0070703_10098849 | 3300005406 | Unclassified | 1025 |
| 55 | Ga0070713_100039551 | 3300005436 | Bacteria | 3828 |
| 56 | Ga0070713_100082959 | 3300005436 | Bacteria | 2739 |
| 57 | Ga0070701_10000020 | 3300005438 | Bacteria | 41399 |
| 58 | Ga0070701_10083380 | 3300005438 | Bacteria | 1736 |
| 59 | Ga0070705_100173865 | 3300005440 | Bacteria | 1452 |
| 60 | Ga0070700_100000818 | 3300005441 | Bacteria | 15281 |
| 61 | Ga0070700_100006314 | 3300005441 | Bacteria | 6328 |
| 62 | Ga0070700_100019665 | 3300005441 | Bacteria | 3901 |
| 63 | Ga0070700_100137940 | 3300005441 | Bacteria | 1654 |
| 64 | Ga0070700_100174157 | 3300005441 | Unclassified | 1492 |
| 65 | Ga0070700_100387141 | 3300005441 | Bacteria | 1047 |
| 66 | Ga0070694_100085689 | 3300005444 | Bacteria | 2201 |
| 67 | Ga0070694_100131611 | 3300005444 | Bacteria | 1807 |
| 68 | Ga0070678_100002436 | 3300005456 | Bacteria | 10191 |
| 69 | Ga0070662_100027204 | 3300005457 | Bacteria | 3967 |
| 70 | Ga0070681_10000949 | 3300005458 | Bacteria | 24425 |
| 71 | Ga0070681_10065947 | 3300005458 | Bacteria | 3589 |
| 72 | Ga0068867_100001096 | 3300005459 | Bacteria | 18486 |
| 73 | Ga0068867_100004904 | 3300005459 | Bacteria | 9421 |
| 74 | Ga0068867_100010555 | 3300005459 | Bacteria | 6516 |
| 75 | Ga0068867_100184350 | 3300005459 | Unclassified | 1661 |
| 76 | Ga0068867_100298694 | 3300005459 | Bacteria | 1327 |
| 77 | Ga0070685_10000069 | 3300005466 | Bacteria | 60941 |
| 78 | Ga0070706_100046137 | 3300005467 | Bacteria | 4023 |
| 79 | Ga0070707_100000174 | 3300005468 | Bacteria | 62748 |
| 80 | Ga0070707_100043125 | 3300005468 | Bacteria | 4318 |
| 81 | Ga0070698_100055324 | 3300005471 | Bacteria | 4025 |
| 82 | Ga0070699_100000203 | 3300005518 | Bacteria | 58650 |
| 83 | Ga0070699_100007807 | 3300005518 | Bacteria | 9301 |
| 84 | Ga0070699_100025037 | 3300005518 | Bacteria | 5146 |
| 85 | Ga0070699_100054256 | 3300005518 | Unclassified | 3469 |
| 86 | Ga0070699_100109040 | 3300005518 | Bacteria | 2429 |
| 87 | Ga0070699_100615989 | 3300005518 | Bacteria | 990 |
| 88 | Ga0070679_100073196 | 3300005530 | Bacteria | 3418 |
| 89 | Ga0070679_100086185 | 3300005530 | Bacteria | 3128 |
| 90 | Ga0070697_100000769 | 3300005536 | Bacteria | 23994 |
| 91 | Ga0070697_100006083 | 3300005536 | Bacteria | 9334 |
| 92 | Ga0070697_100009078 | 3300005536 | Bacteria | 7768 |
| 93 | Ga0070697_100094160 | 3300005536 | Bacteria | 2481 |
| 94 | Ga0070697_100384266 | 3300005536 | Bacteria | 1216 |
| 95 | Ga0070672_100014728 | 3300005543 | Bacteria | 5548 |
| 96 | Ga0070672_100018616 | 3300005543 | Bacteria | 5026 |
| 97 | Ga0070672_100462267 | 3300005543 | Unclassified | 1094 |
| 98 | Ga0070686_100000100 | 3300005544 | Bacteria | 59351 |
| 99 | Ga0070686_100112019 | 3300005544 | Bacteria | 1861 |
| 100 | Ga0070686_100152750 | 3300005544 | Bacteria | 1619 |
| 101 | Ga0070695_100017152 | 3300005545 | Bacteria | 4391 |
| 102 | Ga0070695_100161371 | 3300005545 | Bacteria | 1574 |
| 103 | Ga0070696_100001020 | 3300005546 | Bacteria | 18098 |
| 104 | Ga0070696_100003911 | 3300005546 | Bacteria | 9952 |
| 105 | Ga0070696_100171976 | 3300005546 | Unclassified | 1602 |
| 106 | Ga0070696_100248670 | 3300005546 | Bacteria | 1344 |
| 107 | Ga0070696_100356335 | 3300005546 | Bacteria | 1134 |
| 108 | Ga0070665_100011203 | 3300005548 | Bacteria | 9066 |
| 109 | Ga0070704_100012684 | 3300005549 | Bacteria | 5214 |
| 110 | Ga0070704_100059758 | 3300005549 | Bacteria | 2721 |
| 111 | Ga0070704_100260063 | 3300005549 | Bacteria | 1429 |
| 112 | Ga0070664_100000584 | 3300005564 | Bacteria | 27791 |
| 113 | Ga0070664_100029223 | 3300005564 | Bacteria | 4594 |
| 114 | Ga0068857_100020770 | 3300005577 | Bacteria | 5778 |
| 115 | Ga0068857_100164213 | 3300005577 | Bacteria | 2016 |
| 116 | Ga0068854_100360819 | 3300005578 | Bacteria | 1192 |
| 117 | Ga0070702_100125430 | 3300005615 | Bacteria | 1613 |
| 118 | Ga0070702_100176181 | 3300005615 | Bacteria | 1395 |
| 119 | Ga0068859_100000797 | 3300005617 | Bacteria | 31969 |
| 120 | Ga0068859_100314500 | 3300005617 | Bacteria | 1660 |
| 121 | Ga0068866_10008391 | 3300005718 | Bacteria | 4353 |
| 122 | Ga0068861_100003214 | 3300005719 | Bacteria | 10812 |
| 123 | Ga0068861_100325067 | 3300005719 | Bacteria | 1341 |
| 124 | Ga0068861_100418324 | 3300005719 | Bacteria | 1194 |
| 125 | Ga0068851_10000190 | 3300005834 | Bacteria | 30256 |
| 126 | Ga0068870_10642586 | 3300005840 | Bacteria | 726 |
| 127 | Ga0068860_100033522 | 3300005843 | Bacteria | 4927 |
| 128 | Ga0068860_100247168 | 3300005843 | Unclassified | 1736 |
| 129 | Ga0068862_100005771 | 3300005844 | Bacteria | 10322 |
| 130 | Ga0068862_100018207 | 3300005844 | Bacteria | 5848 |
| 131 | Ga0068862_100711854 | 3300005844 | Bacteria | 973 |
| 132 | Ga0081455_10000786 | 3300005937 | Bacteria | 40744 |
| 133 | Ga0070717_10022747 | 3300006028 | Bacteria | 4958 |
| 134 | Ga0070717_10057237 | 3300006028 | Bacteria | 3222 |
| 135 | Ga0075432_10000036 | 3300006058 | Bacteria | 25056 |
| 136 | Ga0075427_10008727 | 3300006194 | Bacteria | 1506 |
| 137 | Ga0097621_100050861 | 3300006237 | Bacteria | 3371 |
| 138 | Ga0097621_100185432 | 3300006237 | Bacteria | 1800 |
| 139 | Ga0068871_100142571 | 3300006358 | Bacteria | 2038 |
| 140 | Ga0075428_100047540 | 3300006844 | Bacteria | 4712 |
| 141 | Ga0075428_100063247 | 3300006844 | Bacteria | 4051 |
| 142 | Ga0075428_100791110 | 3300006844 | Bacteria | 1008 |
| 143 | Ga0075428_100818097 | 3300006844 | Bacteria | 990 |
| 144 | Ga0075428_101342255 | 3300006844 | Unclassified | 751 |
| 145 | Ga0075430_100003725 | 3300006846 | Bacteria | 12810 |
| 146 | Ga0075430_100006133 | 3300006846 | Bacteria | 10128 |
| 147 | Ga0075430_100033289 | 3300006846 | Bacteria | 4374 |
| 148 | Ga0075430_100113843 | 3300006846 | Bacteria | 2255 |
| 149 | Ga0075430_100120701 | 3300006846 | Bacteria | 2185 |
| 150 | Ga0075431_100001499 | 3300006847 | Bacteria | 21616 |
| 151 | Ga0075431_100002174 | 3300006847 | Bacteria | 18731 |
| 152 | Ga0075431_100124758 | 3300006847 | Unclassified | 2657 |
| 153 | Ga0075431_100171987 | 3300006847 | Bacteria | 2225 |
| 154 | Ga0075431_100452497 | 3300006847 | Bacteria | 1279 |
| 155 | Ga0075431_100580619 | 3300006847 | Bacteria | 1106 |
| 156 | Ga0075431_100752293 | 3300006847 | Bacteria | 950 |
| 157 | Ga0075433_10034668 | 3300006852 | Bacteria | 4336 |
| 158 | Ga0075433_10073129 | 3300006852 | Unclassified | 3015 |
| 159 | Ga0075433_10413226 | 3300006852 | Bacteria | 1190 |
| 160 | Ga0075434_100025831 | 3300006871 | Bacteria | 5749 |
| 161 | Ga0075434_100551876 | 3300006871 | Bacteria | 1172 |
| 162 | Ga0075429_100001236 | 3300006880 | Bacteria | 20721 |
| 163 | Ga0075429_100018761 | 3300006880 | Bacteria | 5990 |
| 164 | Ga0075429_100044800 | 3300006880 | Bacteria | 3848 |
| 165 | Ga0075429_100150385 | 3300006880 | Bacteria | 2038 |
| 166 | Ga0075429_100323505 | 3300006880 | Bacteria | 1349 |
| 167 | Ga0075429_100886570 | 3300006880 | Bacteria | 781 |
| 168 | Ga0068865_100005516 | 3300006881 | Bacteria | 7677 |
| 169 | Ga0068865_100061183 | 3300006881 | Bacteria | 2638 |
| 170 | Ga0075436_100025325 | 3300006914 | Bacteria | 4082 |
| 171 | Ga0075436_100120137 | 3300006914 | Bacteria | 1838 |
| 172 | Ga0097620_100000797 | 3300006931 | Bacteria | 31969 |
| 173 | Ga0097620_100314511 | 3300006931 | Bacteria | 1660 |
| 174 | Ga0075435_100015728 | 3300007076 | Bacteria | 5691 |
| 175 | Ga0075435_100120978 | 3300007076 | Bacteria | 2184 |
| 176 | Ga0105240_10317588 | 3300009093 | Bacteria | 1776 |
| 177 | Ga0111539_10086759 | 3300009094 | Bacteria | 3677 |
| 178 | Ga0111539_10221675 | 3300009094 | Bacteria | 2202 |
| 179 | Ga0111539_11377951 | 3300009094 | Bacteria | 818 |
| 180 | Ga0105245_10012432 | 3300009098 | Bacteria | 7408 |
| 181 | Ga0114129_10016132 | 3300009147 | Bacteria | 10629 |
| 182 | Ga0114129_10018292 | 3300009147 | Bacteria | 9981 |
| 183 | Ga0114129_10036857 | 3300009147 | Bacteria | 6905 |
| 184 | Ga0114129_10094153 | 3300009147 | Bacteria | 4149 |
| 185 | Ga0114129_10471088 | 3300009147 | Bacteria | 1645 |
| 186 | Ga0114129_10698086 | 3300009147 | Bacteria | 1304 |
| 187 | Ga0114129_10992145 | 3300009147 | Bacteria | 1058 |
| 188 | Ga0105243_10000238 | 3300009148 | Bacteria | 63019 |
| 189 | Ga0105243_10003957 | 3300009148 | Bacteria | 11823 |
| 190 | Ga0105243_10621152 | 3300009148 | Bacteria | 1043 |
| 191 | Ga0105243_10746354 | 3300009148 | Unclassified | 959 |
| 192 | Ga0105243_11091783 | 3300009148 | Bacteria | 806 |
| 193 | Ga0105242_10001243 | 3300009176 | Bacteria | 20071 |
| 194 | Ga0105242_10022908 | 3300009176 | Bacteria | 4919 |
| 195 | Ga0105248_10000910 | 3300009177 | Bacteria | 32974 |
| 196 | Ga0105248_10039972 | 3300009177 | Bacteria | 5257 |
| 197 | Ga0105249_10011144 | 3300009553 | Bacteria | 7899 |
| 198 | Ga0105249_10063640 | 3300009553 | Bacteria | 3389 |
| 199 | Ga0105249_10172519 | 3300009553 | Bacteria | 2098 |
| 200 | Ga0105246_10077959 | 3300011119 | Bacteria | 2352 |
| 201 | Ga0157373_10218328 | 3300013100 | Bacteria | 1345 |
| 202 | Ga0157374_10064849 | 3300013296 | Bacteria | 3429 |
| 203 | Ga0157374_10334043 | 3300013296 | Bacteria | 1504 |
| 204 | Ga0157374_10632712 | 3300013296 | Bacteria | 1081 |
| 205 | Ga0157378_10009137 | 3300013297 | Bacteria | 8626 |
| 206 | Ga0163162_10209229 | 3300013306 | Bacteria | 2080 |
| 207 | Ga0163162_10593695 | 3300013306 | Bacteria | 1234 |
| 208 | Ga0163162_10598085 | 3300013306 | Bacteria | 1229 |
| 209 | Ga0157375_10082249 | 3300013308 | Bacteria | 3261 |
| 210 | Ga0157375_10681122 | 3300013308 | Bacteria | 1183 |
| 211 | Ga0157380_10011230 | 3300014326 | Bacteria | 6467 |
| 212 | Ga0157380_10029960 | 3300014326 | Bacteria | 4164 |
| 213 | Ga0157380_10653923 | 3300014326 | Bacteria | 1049 |
| 214 | Ga0157380_10687698 | 3300014326 | Bacteria | 1026 |
| 215 | Ga0157377_10018864 | 3300014745 | Bacteria | 3593 |
| 216 | Ga0157377_10415448 | 3300014745 | Bacteria | 920 |
| 217 | Ga0157376_10080700 | 3300014969 | Bacteria | 2791 |
| 218 | Ga0209437_100301 | 3300025233 | Bacteria | 69230 |
| 219 | Ga0209233_1000285 | 3300025261 | Bacteria | 69238 |
| 220 | Ga0207682_10011353 | 3300025893 | Bacteria | 3478 |
| 221 | Ga0207692_10100998 | 3300025898 | Bacteria | 1583 |
| 222 | Ga0207642_10005018 | 3300025899 | Bacteria | 4296 |
| 223 | Ga0207688_10016869 | 3300025901 | Bacteria | 3966 |
| 224 | Ga0207680_10065528 | 3300025903 | Bacteria | 2230 |
| 225 | Ga0207645_10000472 | 3300025907 | Bacteria | 33217 |
| 226 | Ga0207643_10215690 | 3300025908 | Bacteria | 1173 |
| 227 | Ga0207684_10039479 | 3300025910 | Bacteria | 4004 |
| 228 | Ga0207684_10227179 | 3300025910 | Bacteria | 1611 |
| 229 | Ga0207684_10367547 | 3300025910 | Unclassified | 1238 |
| 230 | Ga0207707_10003210 | 3300025912 | Bacteria | 14520 |
| 231 | Ga0207707_10223182 | 3300025912 | Bacteria | 1640 |
| 232 | Ga0207660_10004716 | 3300025917 | Bacteria | 8877 |
| 233 | Ga0207660_10016768 | 3300025917 | Bacteria | 4857 |
| 234 | Ga0207660_10135434 | 3300025917 | Bacteria | 1879 |
| 235 | Ga0207660_10230076 | 3300025917 | Bacteria | 1457 |
| 236 | Ga0207662_10001208 | 3300025918 | Bacteria | 12343 |
| 237 | Ga0207662_10001387 | 3300025918 | Bacteria | 11704 |
| 238 | Ga0207662_10243616 | 3300025918 | Bacteria | 1178 |
| 239 | Ga0207662_10438188 | 3300025918 | Bacteria | 892 |
| 240 | Ga0207657_10026122 | 3300025919 | Bacteria | 5372 |
| 241 | Ga0207649_10102270 | 3300025920 | Bacteria | 1899 |
| 242 | Ga0207649_10138219 | 3300025920 | Bacteria | 1663 |
| 243 | Ga0207652_10063414 | 3300025921 | Bacteria | 3196 |
| 244 | Ga0207652_10107581 | 3300025921 | Bacteria | 2470 |
| 245 | Ga0207646_10000002 | 3300025922 | Bacteria | 550880 |
| 246 | Ga0207646_10084589 | 3300025922 | Bacteria | 2839 |
| 247 | Ga0207681_10007353 | 3300025923 | Bacteria | 6746 |
| 248 | Ga0207681_10078341 | 3300025923 | Bacteria | 2325 |
| 249 | Ga0207650_10028346 | 3300025925 | Bacteria | 4014 |
| 250 | Ga0207659_10070962 | 3300025926 | Bacteria | 2542 |
| 251 | Ga0207659_10141810 | 3300025926 | Bacteria | 1866 |
| 252 | Ga0207700_10013697 | 3300025928 | Bacteria | 5288 |
| 253 | Ga0207690_10041191 | 3300025932 | Bacteria | 3025 |
| 254 | Ga0207706_10001209 | 3300025933 | Bacteria | 26097 |
| 255 | Ga0207670_10000098 | 3300025936 | Bacteria | 60320 |
| 256 | Ga0207670_10006458 | 3300025936 | Bacteria | 6504 |
| 257 | Ga0207670_10069318 | 3300025936 | Bacteria | 2432 |
| 258 | Ga0207670_10121442 | 3300025936 | Bacteria | 1900 |
| 259 | Ga0207669_10000358 | 3300025937 | Bacteria | 20723 |
| 260 | Ga0207704_10022133 | 3300025938 | Bacteria | 3399 |
| 261 | Ga0207704_10432912 | 3300025938 | Bacteria | 1046 |
| 262 | Ga0207691_10000555 | 3300025940 | Bacteria | 37340 |
| 263 | Ga0207691_10102607 | 3300025940 | Bacteria | 2551 |
| 264 | Ga0207691_10392893 | 3300025940 | Unclassified | 1183 |
| 265 | Ga0207711_10005850 | 3300025941 | Bacteria | 10384 |
| 266 | Ga0207711_10069993 | 3300025941 | Unclassified | 3042 |
| 267 | Ga0207689_10003806 | 3300025942 | Bacteria | 13754 |
| 268 | Ga0207689_10093509 | 3300025942 | Bacteria | 2470 |
| 269 | Ga0207661_10507493 | 3300025944 | Bacteria | 1102 |
| 270 | Ga0207679_10002301 | 3300025945 | Bacteria | 11774 |
| 271 | Ga0207679_10003057 | 3300025945 | Bacteria | 10362 |
| 272 | Ga0207667_10191581 | 3300025949 | Bacteria | 2098 |
| 273 | Ga0207651_10003023 | 3300025960 | Bacteria | 8151 |
| 274 | Ga0207651_10219155 | 3300025960 | Bacteria | 1537 |
| 275 | Ga0207712_10006987 | 3300025961 | Bacteria | 7118 |
| 276 | Ga0207668_10001671 | 3300025972 | Bacteria | 12968 |
| 277 | Ga0207668_10053140 | 3300025972 | Bacteria | 2806 |
| 278 | Ga0207640_10011726 | 3300025981 | Bacteria | 4970 |
| 279 | Ga0207658_10011910 | 3300025986 | Bacteria | 5930 |
| 280 | Ga0207677_10072678 | 3300026023 | Bacteria | 2432 |
| 281 | Ga0207677_10802127 | 3300026023 | Unclassified | 843 |
| 282 | Ga0207708_10003299 | 3300026075 | Bacteria | 11877 |
| 283 | Ga0207708_10015027 | 3300026075 | Bacteria | 5802 |
| 284 | Ga0207708_10048088 | 3300026075 | Bacteria | 3247 |
| 285 | Ga0207641_10037514 | 3300026088 | Bacteria | 4048 |
| 286 | Ga0207648_10000276 | 3300026089 | Bacteria | 55713 |
| 287 | Ga0207648_10000543 | 3300026089 | Bacteria | 42056 |
| 288 | Ga0207648_10001721 | 3300026089 | Bacteria | 23956 |
| 289 | Ga0207648_10224956 | 3300026089 | Unclassified | 1668 |
| 290 | Ga0207648_10383978 | 3300026089 | Bacteria | 1270 |
| 291 | Ga0207674_10029412 | 3300026116 | Bacteria | 5784 |
| 292 | Ga0207674_10205004 | 3300026116 | Bacteria | 1921 |
| 293 | Ga0207675_100007574 | 3300026118 | Bacteria | 10257 |
| 294 | Ga0207675_100096568 | 3300026118 | Bacteria | 2782 |
| 295 | Ga0207675_100458692 | 3300026118 | Bacteria | 1264 |
| 296 | Ga0207675_100740546 | 3300026118 | Bacteria | 994 |
| 297 | Ga0207683_10001107 | 3300026121 | Bacteria | 24547 |
| 298 | Ga0209973_1000627 | 3300027252 | Bacteria | 2769 |
| 299 | Ga0209969_1000008 | 3300027360 | Bacteria | 28047 |
| 300 | Ga0209967_1000144 | 3300027364 | Bacteria | 9733 |
| 301 | Ga0209981_1000003 | 3300027378 | Bacteria | 30420 |
| 302 | Ga0209996_1000058 | 3300027395 | Bacteria | 15054 |
| 303 | Ga0210000_1000024 | 3300027462 | Bacteria | 23307 |
| 304 | Ga0209995_1000087 | 3300027471 | Bacteria | 14662 |
| 305 | Ga0209968_1000019 | 3300027526 | Bacteria | 32234 |
| 306 | Ga0209968_1036060 | 3300027526 | Bacteria | 836 |
| 307 | Ga0209999_1000055 | 3300027543 | Bacteria | 12672 |
| 308 | Ga0209982_1000541 | 3300027552 | Bacteria | 4709 |
| 309 | Ga0209982_1028476 | 3300027552 | Bacteria | 874 |
| 310 | Ga0209970_1000013 | 3300027614 | Bacteria | 24097 |
| 311 | Ga0210002_1000024 | 3300027617 | Bacteria | 23321 |
| 312 | Ga0210002_1047157 | 3300027617 | Bacteria | 739 |
| 313 | Ga0209983_1000253 | 3300027665 | Bacteria | 10950 |
| 314 | Ga0209971_1000232 | 3300027682 | Bacteria | 15872 |
| 315 | Ga0209966_1000331 | 3300027695 | Bacteria | 14989 |
| 316 | Ga0209998_10000094 | 3300027717 | Bacteria | 35182 |
| 317 | Ga0209998_10010297 | 3300027717 | Bacteria | 1936 |
| 318 | Ga0209998_10017197 | 3300027717 | Bacteria | 1526 |
| 319 | Ga0209974_10000076 | 3300027876 | Bacteria | 26650 |
| 320 | Ga0209974_10001696 | 3300027876 | Bacteria | 7979 |
| 321 | Ga0209974_10029023 | 3300027876 | Bacteria | 1833 |
| 322 | Ga0209974_10063014 | 3300027876 | Unclassified | 1257 |
| 323 | Ga0207428_10000529 | 3300027907 | Bacteria | 45592 |
| 324 | Ga0207428_10003555 | 3300027907 | Bacteria | 15064 |
| 325 | Ga0207428_10039242 | 3300027907 | Bacteria | 3845 |
| 326 | Ga0207428_10508084 | 3300027907 | Bacteria | 875 |
| 327 | Ga0268266_10196812 | 3300028379 | Bacteria | 1843 |
| 328 | Ga0268265_10036624 | 3300028380 | Bacteria | 3595 |
| 329 | Ga0268265_10037045 | 3300028380 | Bacteria | 3576 |
| 330 | Ga0268265_10070008 | 3300028380 | Bacteria | 2726 |
| 331 | Ga0268265_10861719 | 3300028380 | Bacteria | 887 |
| 332 | Ga0268264_10197119 | 3300028381 | Bacteria | 1839 |
| 333 | Ga0265318_10006061 | 3300028577 | Bacteria | 5603 |
| 334 | Ga0307408_100010072 | 3300031548 | Bacteria | 6231 |
| 335 | Ga0307408_100129805 | 3300031548 | Bacteria | 1964 |
| 336 | Ga0307408_100203369 | 3300031548 | Bacteria | 1605 |
| 337 | Ga0307405_10017480 | 3300031731 | Bacteria | 3936 |
| 338 | Ga0307405_10339847 | 3300031731 | Bacteria | 1154 |
| 339 | Ga0307413_10498568 | 3300031824 | Bacteria | 977 |
| 340 | Ga0307410_10453259 | 3300031852 | Unclassified | 1047 |
| 341 | Ga0307407_10112802 | 3300031903 | Unclassified | 1710 |
| 342 | Ga0307409_100205553 | 3300031995 | Bacteria | 1765 |
| 343 | Ga0307409_100544098 | 3300031995 | Bacteria | 1139 |
| 344 | Ga0307416_100088592 | 3300032002 | Bacteria | 2647 |
| 345 | Ga0307416_101325507 | 3300032002 | Unclassified | 826 |
| 346 | Ga0307414_10050348 | 3300032004 | Bacteria | 2885 |
| 347 | Ga0307411_10106373 | 3300032005 | Bacteria | 1997 |
| 348 | Ga0307411_10117509 | 3300032005 | Bacteria | 1916 |
| 349 | Ga0307415_100246860 | 3300032126 | Bacteria | 1448 |
| 350 | Ga0307415_100300003 | 3300032126 | Bacteria | 1330 |
| 351 | Ga0373940_0143078 | 3300035088 | Bacteria | 757 |
| 352 | Ga0373941_0065300 | 3300035115 | Bacteria | 1194 |
| 353 | Ga0373941_0072554 | 3300035115 | Bacteria | 1146 |
| 354 | Ga0373942_0019679 | 3300035207 | Bacteria | 1687 |
| 355 | Ga0373942_0076952 | 3300035207 | Bacteria | 984 |
| 356 | Ga0373961_0025237 | 3300035241 | Bacteria | 1614 |
| 357 | Ga0373931_0012622 | 3300035691 | Bacteria | 4097 |
| 358 | Ga0373931_0427214 | 3300035691 | Unclassified | 843 |
| 359 | Ga0395900_0858248 | 3300037418 | Bacteria | 833 |
| 360 | Ga0439438_015089 | 3300041405 | Bacteria | 2282 |
| 361 | Ga0439441_011852 | 3300042001 | Bacteria | 1486 |
| 362 | Ga0439445_0032238 | 3300042004 | Bacteria | 1365 |
| 363 | Ga0439432_018382 | 3300042006 | Bacteria | 2336 |
| 364 | Ga0439450_000289 | 3300042008 | Bacteria | 6222 |
| 365 | Ga0439452_012134 | 3300042010 | Bacteria | 2460 |
| 366 | Ga0439462_0011814 | 3300042015 | Bacteria | 2227 |
| 367 | Ga0439463_049351 | 3300042016 | Bacteria | 1073 |
| 368 | Ga0450888_005211 | 3300042126 | Bacteria | 1379 |
| 369 | Ga0450905_015836 | 3300042142 | Bacteria | 1083 |
| 370 | Ga0439458_0036830 | 3300042157 | Bacteria | 1178 |
| 371 | Ga0439434_0003138 | 3300042435 | Bacteria | 4858 |
| 372 | Ga0439464_0053663 | 3300042439 | Bacteria | 1170 |
| 373 | Ga0439460_0019607 | 3300042461 | Bacteria | 1833 |
| 374 | Ga0439460_0028323 | 3300042461 | Bacteria | 1580 |
| 375 | Ga0453683_0152319 | 3300044673 | Bacteria | 1461 |
| 376 | Ga0453684_0025592 | 3300044712 | Bacteria | 8563 |
| 377 | Ga0451576_0005198 | 3300045051 | Bacteria | 16438 |
| 378 | Ga0451576_0021687 | 3300045051 | Bacteria | 6978 |
| 379 | Ga0451576_0060593 | 3300045051 | Bacteria | 3948 |
| 380 | Ga0451576_0076318 | 3300045051 | Bacteria | 3488 |
| 381 | Ga0451576_0101652 | 3300045051 | Unclassified | 2990 |
| 382 | Ga0451576_0206586 | 3300045051 | Bacteria | 2051 |
| 383 | Ga0451576_0522823 | 3300045051 | Bacteria | 1247 |
| 384 | Ga0451576_0577234 | 3300045051 | Bacteria | 1181 |
| 385 | Ga0451576_0903461 | 3300045051 | Bacteria | 926 |
| 386 | Ga0495613_0541488 | 3300046689 | Unclassified | 780 |
| 387 | Ga0496106_0168144 | 3300048909 | Bacteria | 1737 |
| 388 | Ga0496106_0641795 | 3300048909 | Bacteria | 849 |
| 389 | Ga0496112_0650879 | 3300048915 | Bacteria | 983 |
| 390 | Ga0501290_000059 | 3300049513 | Bacteria | 15168 |
| 391 | Ga0501291_000488 | 3300049514 | Bacteria | 4616 |
| 392 | Ga0501291_037816 | 3300049514 | Bacteria | 838 |
| 393 | Ga0501292_000129 | 3300049515 | Bacteria | 12783 |
| 394 | Ga0501294_001147 | 3300049517 | Bacteria | 2758 |
| 395 | Ga0501295_000527 | 3300049518 | Bacteria | 3586 |
| 396 | Ga0501296_000322 | 3300049519 | Bacteria | 4918 |
| 397 | Ga0501297_006586 | 3300049520 | Bacteria | 1244 |
| 398 | Ga0501298_014650 | 3300049521 | Bacteria | 1403 |
| 399 | Ga0501299_000048 | 3300049522 | Bacteria | 13201 |
| 400 | Ga0501300_000939 | 3300049523 | Bacteria | 4450 |
| 401 | Ga0501031_0000180 | 3300049568 | Bacteria | 35738 |
| 402 | Ga0501031_0005414 | 3300049568 | Bacteria | 8309 |
| 403 | Ga0501031_0021701 | 3300049568 | Bacteria | 4186 |
| 404 | Ga0501036_0045620 | 3300049572 | Bacteria | 3712 |
| 405 | Ga0501036_0113453 | 3300049572 | Bacteria | 2290 |
| 406 | Ga0501036_0847867 | 3300049572 | Bacteria | 751 |
| 407 | Ga0501037_0317158 | 3300049573 | Bacteria | 1080 |
| 408 | Ga0501038_0016430 | 3300049574 | Bacteria | 6707 |
| 409 | Ga0501038_0483461 | 3300049574 | Bacteria | 949 |
| 410 | Ga0501039_0000834 | 3300049575 | Bacteria | 22277 |
| 411 | Ga0501039_0000919 | 3300049575 | Bacteria | 21494 |
| 412 | Ga0501039_0688762 | 3300049575 | Bacteria | 799 |
| 413 | Ga0501040_0003533 | 3300049576 | Bacteria | 10103 |
| 414 | Ga0501040_0011021 | 3300049576 | Bacteria | 5910 |
| 415 | Ga0501040_0036594 | 3300049576 | Bacteria | 3332 |
| 416 | Ga0501041_0000481 | 3300049577 | Bacteria | 20342 |
| 417 | Ga0501041_0229934 | 3300049577 | Bacteria | 1164 |
| 418 | Ga0501042_0000164 | 3300049578 | Bacteria | 30409 |
| 419 | Ga0501042_0031091 | 3300049578 | Bacteria | 3777 |
| 420 | Ga0501042_0495586 | 3300049578 | Bacteria | 887 |
| 421 | Ga0501043_0048992 | 3300049579 | Bacteria | 3321 |
| 422 | Ga0501046_0002388 | 3300049580 | Bacteria | 17642 |
| 423 | Ga0501046_0003725 | 3300049580 | Bacteria | 13952 |
| 424 | Ga0501046_0235579 | 3300049580 | Bacteria | 1351 |
| 425 | Ga0501048_0001626 | 3300049582 | Bacteria | 17099 |
| 426 | Ga0501048_0058909 | 3300049582 | Bacteria | 2721 |
| 427 | Ga0501067_0050791 | 3300049583 | Bacteria | 2298 |
| 428 | Ga0501068_0401912 | 3300049584 | Bacteria | 883 |
| 429 | Ga0501070_0009317 | 3300049586 | Bacteria | 8305 |
| 430 | Ga0501071_0038595 | 3300049587 | Bacteria | 3413 |
| 431 | Ga0501071_0051850 | 3300049587 | Bacteria | 2957 |
| 432 | Ga0501071_0052916 | 3300049587 | Bacteria | 2928 |
| 433 | Ga0501072_0440431 | 3300049588 | Bacteria | 1032 |
| 434 | Ga0501075_0093869 | 3300049591 | Bacteria | 2277 |
| 435 | Ga0501075_0105994 | 3300049591 | Bacteria | 2136 |
| 436 | Ga0501075_0349573 | 3300049591 | Bacteria | 1127 |
| 437 | Ga0501076_0020223 | 3300049592 | Bacteria | 5094 |
| 438 | Ga0501076_0038758 | 3300049592 | Bacteria | 3741 |
| 439 | Ga0501076_0150033 | 3300049592 | Bacteria | 1896 |
| 440 | Ga0501076_0304192 | 3300049592 | Bacteria | 1307 |
| 441 | Ga0501077_0025561 | 3300049593 | Bacteria | 3750 |
| 442 | Ga0501077_0081064 | 3300049593 | Bacteria | 2055 |
| 443 | Ga0501077_0428857 | 3300049593 | Unclassified | 846 |
| 444 | Ga0501201_002201 | 3300049651 | Bacteria | 1789 |
| 445 | Ga0501202_002220 | 3300049652 | Bacteria | 3241 |
| 446 | Ga0501207_002773 | 3300049654 | Bacteria | 2288 |
| 447 | Ga0501216_026863 | 3300049660 | Bacteria | 1041 |
| 448 | Ga0501217_006804 | 3300049661 | Bacteria | 2438 |
| 449 | Ga0501227_054178 | 3300049665 | Bacteria | 1017 |
| 450 | Ga0501228_000969 | 3300049666 | Bacteria | 1983 |
| 451 | Ga0501230_003655 | 3300049667 | Bacteria | 2060 |
| 452 | Ga0501233_001024 | 3300049668 | Bacteria | 4752 |
| 453 | Ga0501235_005843 | 3300049669 | Bacteria | 2679 |
| 454 | Ga0501236_002097 | 3300049670 | Bacteria | 2274 |
| 455 | Ga0501239_002111 | 3300049672 | Bacteria | 1780 |
| 456 | Ga0501243_001231 | 3300049675 | Bacteria | 3669 |
| 457 | Ga0501246_000121 | 3300049676 | Bacteria | 4745 |
| 458 | Ga0501249_005735 | 3300049679 | Bacteria | 2537 |
| 459 | Ga0501251_000290 | 3300049681 | Bacteria | 4440 |
| 460 | Ga0501251_010919 | 3300049681 | Bacteria | 1074 |
| 461 | Ga0501252_003336 | 3300049682 | Bacteria | 1648 |
| 462 | Ga0501258_000856 | 3300049687 | Bacteria | 2277 |
| 463 | Ga0501261_024892 | 3300049690 | Bacteria | 878 |
| 464 | Ga0501219_001566 | 3300049703 | Bacteria | 2106 |
| 465 | Ga0501221_002583 | 3300049704 | Bacteria | 2986 |
| 466 | Ga0501225_0044852 | 3300049705 | Bacteria | 1223 |
| 467 | Ga0501234_000290 | 3300049707 | Bacteria | 7353 |
| 468 | Ga0501245_002169 | 3300049708 | Bacteria | 2609 |
| 469 | Ga0501079_0012495 | 3300049741 | Bacteria | 6481 |
| 470 | Ga0501079_0019443 | 3300049741 | Bacteria | 5188 |
| 471 | Ga0501079_0061866 | 3300049741 | Bacteria | 2887 |
| 472 | Ga0501079_0335315 | 3300049741 | Bacteria | 1184 |
| 473 | Ga0501080_0085095 | 3300049742 | Bacteria | 2938 |
| 474 | Ga0501080_0263680 | 3300049742 | Bacteria | 1569 |
| 475 | Ga0501081_0108341 | 3300049743 | Bacteria | 1970 |
| 476 | Ga0501081_0170750 | 3300049743 | Unclassified | 1570 |
| 477 | Ga0501083_0055564 | 3300049744 | Bacteria | 2654 |
| 478 | Ga0501232_002905 | 3300049757 | Bacteria | 1526 |
| 479 | Ga0501263_032821 | 3300049760 | Unclassified | 739 |
| 480 | Ga0501264_000674 | 3300049761 | Bacteria | 4684 |
| 481 | Ga0501265_000090 | 3300049762 | Bacteria | 7953 |
| 482 | Ga0501265_013488 | 3300049762 | Bacteria | 1029 |
| 483 | Ga0501266_001401 | 3300049763 | Bacteria | 3079 |
| 484 | Ga0501268_005185 | 3300049765 | Bacteria | 1864 |
| 485 | Ga0501270_003400 | 3300049767 | Bacteria | 1715 |
| 486 | Ga0501273_006029 | 3300049770 | Bacteria | 1389 |
| 487 | Ga0501275_001141 | 3300049772 | Bacteria | 2682 |
| 488 | Ga0501276_000898 | 3300049773 | Bacteria | 1908 |
| 489 | Ga0501279_005900 | 3300049775 | Bacteria | 1612 |
| 490 | Ga0501279_041955 | 3300049775 | Bacteria | 705 |
| 491 | Ga0501283_004101 | 3300049779 | Bacteria | 1955 |
| 492 | Ga0501035_0003730 | 3300049822 | Bacteria | 14525 |
| 493 | Ga0501035_0020689 | 3300049822 | Bacteria | 6047 |
| 494 | Ga0501035_0048260 | 3300049822 | Bacteria | 3819 |
| 495 | Ga0501045_0409737 | 3300049824 | Bacteria | 1008 |
| 496 | Ga0501226_002731 | 3300049853 | Bacteria | 2128 |
| 497 | nmdc:mga05p37_35207_c1 | 3300050507 | Bacteria | 6138 |
| 498 | nmdc:mga05p37_358868_c1 | 3300050507 | Bacteria | 1714 |
| 499 | nmdc:mga05p37_384581_c1 | 3300050507 | Bacteria | 1643 |
| 500 | nmdc:mga05p37_592468_c1 | 3300050507 | Bacteria | 1253 |
| 501 | nmdc:mga05p37_7114_c1 | 3300050507 | Bacteria | 13190 |
| 502 | nmdc:mga09592_21121_c1 | 3300050508 | Bacteria | 5363 |
| 503 | nmdc:mga09592_57742_c1 | 3300050508 | Bacteria | 3281 |
| 504 | nmdc:mga0qj67_123910_c1 | 3300050509 | Bacteria | 2091 |
| 505 | nmdc:mga0qj67_324046_c1 | 3300050509 | Bacteria | 1247 |
| 506 | nmdc:mga0qj67_570435_c1 | 3300050509 | Bacteria | 907 |
| 507 | nmdc:mga0qj67_59229_c1 | 3300050509 | Bacteria | 3037 |
| 508 | nmdc:mga0qj67_62613_c1 | 3300050509 | Bacteria | 2956 |
| 509 | nmdc:mga0qj67_7716_c1 | 3300050509 | Bacteria | 7952 |
| 510 | nmdc:mga06r32_12645_c1 | 3300050510 | Bacteria | 7627 |
| 511 | nmdc:mga06r32_170190_c1 | 3300050510 | Bacteria | 2162 |
| 512 | nmdc:mga06r32_31431_c1 | 3300050510 | Bacteria | 4987 |
| 513 | nmdc:mga06r32_541094_c1 | 3300050510 | Bacteria | 1139 |
| 514 | nmdc:mga06r32_629_c1 | 3300050510 | Bacteria | 6261 |
| 515 | nmdc:mga06r32_81312_c1 | 3300050510 | Bacteria | 3155 |
| 516 | nmdc:mga06r32_861914_c1 | 3300050510 | Bacteria | 864 |
| 517 | nmdc:mga06r32_965086_c1 | 3300050510 | Bacteria | 806 |
| 518 | nmdc:mga08y16_21330_c1 | 3300050511 | Bacteria | 6840 |
| 519 | nmdc:mga08y16_21638_c1 | 3300050511 | Bacteria | 6790 |
| 520 | nmdc:mga08y16_579686_c1 | 3300050511 | Bacteria | 1133 |
| 521 | nmdc:mga0n895_124385_c1 | 3300050512 | Bacteria | 2602 |
| 522 | nmdc:mga0n895_296077_c1 | 3300050512 | Bacteria | 1641 |
| 523 | nmdc:mga0n895_33678_c1 | 3300050512 | Bacteria | 4924 |
| 524 | nmdc:mga0n895_530764_c1 | 3300050512 | Bacteria | 1184 |
| 525 | nmdc:mga0n895_53286_c1 | 3300050512 | Bacteria | 3975 |
| 526 | nmdc:mga0rr50_11342_c1 | 3300050513 | Bacteria | 5701 |
| 527 | nmdc:mga0a205_6503_c1 | 3300050515 | Bacteria | 10566 |
| 528 | Ga0501084_0312913 | 3300054114 | Unclassified | 1326 |
| 529 | Ga0501082_0103840 | 3300060353 | Bacteria | 2458 |
| 530 | Ga0501082_0157448 | 3300060353 | Bacteria | 1973 |
| 531 | Ga0530510_0031102 | 3300061734 | Bacteria | 3837 |
| 532 | Ga0530510_0363815 | 3300061734 | Bacteria | 1087 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049775 | Ga0501279_041955 | Ga0501279_041955_22_561 | 172 |
| 2 | 3300005340 | Ga0070689_100922121 | Ga0070689_1009221211 | 187 |
| 3 | 3300050509 | nmdc:mga0qj67_570435_c1 | nmdc:mga0qj67_570435_c1_310_897 | 188 |
| 4 | 3300050507 | nmdc:mga05p37_358868_c1 | nmdc:mga05p37_358868_c1_17_616 | 193 |
| 5 | 3300013306 | Ga0163162_10593695 | Ga0163162_105936952 | 196 |
| 6 | 3300005328 | Ga0070676_10334801 | Ga0070676_103348011 | 197 |
| 7 | 3300005354 | Ga0070675_100121241 | Ga0070675_1001212412 | 197 |
| 8 | 3300005364 | Ga0070673_100166502 | Ga0070673_1001665022 | 197 |
| 9 | 3300005459 | Ga0068867_100298694 | Ga0068867_1002986942 | 197 |
| 10 | 3300005840 | Ga0068870_10642586 | Ga0068870_106425862 | 197 |
| 11 | 3300014745 | Ga0157377_10415448 | Ga0157377_104154482 | 197 |
| 12 | 3300025908 | Ga0207643_10215690 | Ga0207643_102156902 | 197 |
| 13 | 3300025926 | Ga0207659_10141810 | Ga0207659_101418102 | 197 |
| 14 | 3300025942 | Ga0207689_10093509 | Ga0207689_100935091 | 197 |
| 15 | 3300025960 | Ga0207651_10219155 | Ga0207651_102191552 | 197 |
| 16 | 3300026089 | Ga0207648_10383978 | Ga0207648_103839782 | 197 |
| 17 | 3300006846 | Ga0075430_100003725 | Ga0075430_1000037256 | 198 |
| 18 | 3300006846 | Ga0075430_100113843 | Ga0075430_1001138432 | 198 |
| 19 | 3300009147 | Ga0114129_10471088 | Ga0114129_104710881 | 198 |
| 20 | 3300031548 | Ga0307408_100203369 | Ga0307408_1002033692 | 198 |
| 21 | 3300031731 | Ga0307405_10339847 | Ga0307405_103398471 | 198 |
| 22 | 3300031995 | Ga0307409_100544098 | Ga0307409_1005440981 | 198 |
| 23 | 3300032002 | Ga0307416_100088592 | Ga0307416_1000885923 | 198 |
| 24 | 3300050507 | nmdc:mga05p37_384581_c1 | nmdc:mga05p37_384581_c1_129_752 | 198 |
| 25 | 3300050509 | nmdc:mga0qj67_62613_c1 | nmdc:mga0qj67_62613_c1_1947_2564 | 198 |
| 26 | 3300050509 | nmdc:mga0qj67_7716_c1 | nmdc:mga0qj67_7716_c1_474_1091 | 198 |
| 27 | 3300005441 | Ga0070700_100387141 | Ga0070700_1003871412 | 199 |
| 28 | 3300005719 | Ga0068861_100325067 | Ga0068861_1003250672 | 199 |
| 29 | 3300005844 | Ga0068862_100711854 | Ga0068862_1007118542 | 199 |
| 30 | 3300009147 | Ga0114129_10992145 | Ga0114129_109921452 | 199 |
| 31 | 3300009148 | Ga0105243_11091783 | Ga0105243_110917832 | 199 |
| 32 | 3300014326 | Ga0157380_10653923 | Ga0157380_106539232 | 199 |
| 33 | 3300025917 | Ga0207660_10135434 | Ga0207660_101354342 | 199 |
| 34 | 3300026118 | Ga0207675_100458692 | Ga0207675_1004586923 | 199 |
| 35 | 3300027907 | Ga0207428_10039242 | Ga0207428_100392422 | 199 |
| 36 | 3300027907 | Ga0207428_10508084 | Ga0207428_105080842 | 199 |
| 37 | 3300028380 | Ga0268265_10036624 | Ga0268265_100366243 | 199 |
| 38 | 3300031548 | Ga0307408_100010072 | Ga0307408_1000100724 | 199 |
| 39 | 3300035207 | Ga0373942_0076952 | Ga0373942_0076952_54_683 | 199 |
| 40 | 3300050509 | nmdc:mga0qj67_59229_c1 | nmdc:mga0qj67_59229_c1_1726_2355 | 199 |
| 41 | 3300050511 | nmdc:mga08y16_579686_c1 | nmdc:mga08y16_579686_c1_470_1099 | 199 |
| 42 | 3300006844 | Ga0075428_100818097 | Ga0075428_1008180972 | 200 |
| 43 | 3300006847 | Ga0075431_100452497 | Ga0075431_1004524972 | 200 |
| 44 | 3300050510 | nmdc:mga06r32_541094_c1 | nmdc:mga06r32_541094_c1_442_1074 | 200 |
| 45 | 3300049575 | Ga0501039_0688762 | Ga0501039_0688762_10_672 | 201 |
| 46 | 3300005345 | Ga0070692_10351715 | Ga0070692_103517152 | 202 |
| 47 | 3300005458 | Ga0070681_10065947 | Ga0070681_100659474 | 202 |
| 48 | 3300005530 | Ga0070679_100073196 | Ga0070679_1000731962 | 202 |
| 49 | 3300025912 | Ga0207707_10003210 | Ga0207707_100032102 | 202 |
| 50 | 3300025921 | Ga0207652_10107581 | Ga0207652_101075812 | 202 |
| 51 | 3300035115 | Ga0373941_0065300 | Ga0373941_0065300_546_1160 | 202 |
| 52 | 3300035207 | Ga0373942_0019679 | Ga0373942_0019679_366_980 | 202 |
| 53 | 3300035691 | Ga0373931_0012622 | Ga0373931_0012622_23_637 | 202 |
| 54 | 3300049583 | Ga0501067_0050791 | Ga0501067_0050791_220_834 | 202 |
| 55 | 3300005333 | Ga0070677_10125513 | Ga0070677_101255132 | 204 |
| 56 | 3300005336 | Ga0070680_100245468 | Ga0070680_1002454683 | 204 |
| 57 | 3300005345 | Ga0070692_10007059 | Ga0070692_100070593 | 204 |
| 58 | 3300005441 | Ga0070700_100019665 | Ga0070700_1000196654 | 204 |
| 59 | 3300005459 | Ga0068867_100004904 | Ga0068867_1000049042 | 204 |
| 60 | 3300005546 | Ga0070696_100248670 | Ga0070696_1002486702 | 204 |
| 61 | 3300005577 | Ga0068857_100164213 | Ga0068857_1001642134 | 204 |
| 62 | 3300005615 | Ga0070702_100125430 | Ga0070702_1001254301 | 204 |
| 63 | 3300005718 | Ga0068866_10008391 | Ga0068866_100083914 | 204 |
| 64 | 3300005719 | Ga0068861_100003214 | Ga0068861_1000032149 | 204 |
| 65 | 3300005844 | Ga0068862_100005771 | Ga0068862_1000057713 | 204 |
| 66 | 3300006844 | Ga0075428_100063247 | Ga0075428_1000632473 | 204 |
| 67 | 3300006852 | Ga0075433_10413226 | Ga0075433_104132262 | 204 |
| 68 | 3300006880 | Ga0075429_100044800 | Ga0075429_1000448003 | 204 |
| 69 | 3300006881 | Ga0068865_100005516 | Ga0068865_1000055164 | 204 |
| 70 | 3300009094 | Ga0111539_10086759 | Ga0111539_100867593 | 204 |
| 71 | 3300009147 | Ga0114129_10036857 | Ga0114129_100368576 | 204 |
| 72 | 3300009553 | Ga0105249_10011144 | Ga0105249_100111445 | 204 |
| 73 | 3300025899 | Ga0207642_10005018 | Ga0207642_100050184 | 204 |
| 74 | 3300025917 | Ga0207660_10230076 | Ga0207660_102300763 | 204 |
| 75 | 3300025923 | Ga0207681_10007353 | Ga0207681_100073535 | 204 |
| 76 | 3300025938 | Ga0207704_10432912 | Ga0207704_104329122 | 204 |
| 77 | 3300025961 | Ga0207712_10006987 | Ga0207712_100069874 | 204 |
| 78 | 3300025972 | Ga0207668_10053140 | Ga0207668_100531404 | 204 |
| 79 | 3300026075 | Ga0207708_10048088 | Ga0207708_100480882 | 204 |
| 80 | 3300026089 | Ga0207648_10000276 | Ga0207648_1000027620 | 204 |
| 81 | 3300026116 | Ga0207674_10205004 | Ga0207674_102050042 | 204 |
| 82 | 3300026118 | Ga0207675_100007574 | Ga0207675_1000075744 | 204 |
| 83 | 3300027907 | Ga0207428_10003555 | Ga0207428_1000355512 | 204 |
| 84 | 3300028380 | Ga0268265_10070008 | Ga0268265_100700084 | 204 |
| 85 | 3300050507 | nmdc:mga05p37_7114_c1 | nmdc:mga05p37_7114_c1_400_1044 | 204 |
| 86 | 3300050508 | nmdc:mga09592_21121_c1 | nmdc:mga09592_21121_c1_4376_5020 | 204 |
| 87 | 3300050511 | nmdc:mga08y16_21638_c1 | nmdc:mga08y16_21638_c1_2904_3548 | 204 |
| 88 | 3300044712 | Ga0453684_0025592 | Ga0453684_0025592_7503_8192 | 205 |
| 89 | 3300005834 | Ga0068851_10000190 | Ga0068851_1000019017 | 206 |
| 90 | 3300014326 | Ga0157380_10687698 | Ga0157380_106876981 | 206 |
| 91 | 3300031852 | Ga0307410_10453259 | Ga0307410_104532592 | 206 |
| 92 | 3300009094 | Ga0111539_11377951 | Ga0111539_113779511 | 207 |
| 93 | 3300009148 | Ga0105243_10003957 | Ga0105243_1000395715 | 207 |
| 94 | 3300009553 | Ga0105249_10063640 | Ga0105249_100636401 | 207 |
| 95 | 3300013306 | Ga0163162_10209229 | Ga0163162_102092293 | 207 |
| 96 | 3300048909 | Ga0496106_0641795 | Ga0496106_0641795_159_800 | 207 |
| 97 | 3300005440 | Ga0070705_100173865 | Ga0070705_1001738652 | 208 |
| 98 | 3300005615 | Ga0070702_100176181 | Ga0070702_1001761811 | 208 |
| 99 | 3300006844 | Ga0075428_100791110 | Ga0075428_1007911102 | 208 |
| 100 | 3300025918 | Ga0207662_10438188 | Ga0207662_104381882 | 208 |
| 101 | 3300002737 | JGI25162J39368_1001285 | JGI25162J39368_10012859 | 209 |
| 102 | 3300003214 | JGI25165J46597_1000649 | JGI25165J46597_100064924 | 209 |
| 103 | 3300025233 | Ga0209437_100301 | Ga0209437_1003014 | 209 |
| 104 | 3300025261 | Ga0209233_1000285 | Ga0209233_10002854 | 209 |
| 105 | 3300049573 | Ga0501037_0317158 | Ga0501037_0317158_64_750 | 209 |
| 106 | 3300049574 | Ga0501038_0483461 | Ga0501038_0483461_237_923 | 209 |
| 107 | 3300049586 | Ga0501070_0009317 | Ga0501070_0009317_1875_2561 | 209 |
| 108 | 3300049742 | Ga0501080_0263680 | Ga0501080_0263680_377_1063 | 209 |
| 109 | 3300049822 | Ga0501035_0048260 | Ga0501035_0048260_171_857 | 209 |
| 110 | 3300005459 | Ga0068867_100184350 | Ga0068867_1001843502 | 210 |
| 111 | 3300005543 | Ga0070672_100462267 | Ga0070672_1004622672 | 210 |
| 112 | 3300005843 | Ga0068860_100247168 | Ga0068860_1002471682 | 210 |
| 113 | 3300025940 | Ga0207691_10392893 | Ga0207691_103928932 | 210 |
| 114 | 3300026089 | Ga0207648_10224956 | Ga0207648_102249561 | 210 |
| 115 | 3300032002 | Ga0307416_101325507 | Ga0307416_1013255071 | 210 |
| 116 | 3300005536 | Ga0070697_100000769 | Ga0070697_10000076923 | 211 |
| 117 | 3300009093 | Ga0105240_10317588 | Ga0105240_103175883 | 211 |
| 118 | 3300009094 | Ga0111539_10221675 | Ga0111539_102216752 | 211 |
| 119 | 3300009098 | Ga0105245_10012432 | Ga0105245_100124324 | 211 |
| 120 | 3300009147 | Ga0114129_10016132 | Ga0114129_100161322 | 211 |
| 121 | 3300009553 | Ga0105249_10172519 | Ga0105249_101725193 | 211 |
| 122 | 3300011119 | Ga0105246_10077959 | Ga0105246_100779594 | 211 |
| 123 | 3300013100 | Ga0157373_10218328 | Ga0157373_102183282 | 211 |
| 124 | 3300013296 | Ga0157374_10632712 | Ga0157374_106327121 | 211 |
| 125 | 3300013297 | Ga0157378_10009137 | Ga0157378_100091374 | 211 |
| 126 | 3300013308 | Ga0157375_10082249 | Ga0157375_100822494 | 211 |
| 127 | 3300014326 | Ga0157380_10011230 | Ga0157380_100112305 | 211 |
| 128 | 3300014745 | Ga0157377_10018864 | Ga0157377_100188642 | 211 |
| 129 | 3300014969 | Ga0157376_10080700 | Ga0157376_100807004 | 211 |
| 130 | 3300025918 | Ga0207662_10243616 | Ga0207662_102436162 | 211 |
| 131 | 3300035115 | Ga0373941_0072554 | Ga0373941_0072554_326_961 | 211 |
| 132 | 3300042157 | Ga0439458_0036830 | Ga0439458_0036830_15_650 | 211 |
| 133 | 3300045051 | Ga0451576_0577234 | Ga0451576_0577234_181_816 | 211 |
| 134 | 3300045051 | Ga0451576_0903461 | Ga0451576_0903461_181_816 | 211 |
| 135 | 3300048909 | Ga0496106_0168144 | Ga0496106_0168144_841_1476 | 211 |
| 136 | 3300050507 | nmdc:mga05p37_35207_c1 | nmdc:mga05p37_35207_c1_2501_3136 | 211 |
| 137 | 3300050508 | nmdc:mga09592_57742_c1 | nmdc:mga09592_57742_c1_1907_2542 | 211 |
| 138 | 3300050510 | nmdc:mga06r32_31431_c1 | nmdc:mga06r32_31431_c1_1361_1996 | 211 |
| 139 | 3300050511 | nmdc:mga08y16_21330_c1 | nmdc:mga08y16_21330_c1_1012_1647 | 211 |
| 140 | 3300050512 | nmdc:mga0n895_296077_c1 | nmdc:mga0n895_296077_c1_799_1434 | 211 |
| 141 | 3300050512 | nmdc:mga0n895_53286_c1 | nmdc:mga0n895_53286_c1_3247_3882 | 211 |
| 142 | 3300050513 | nmdc:mga0rr50_11342_c1 | nmdc:mga0rr50_11342_c1_606_1241 | 211 |
| 143 | 3300050515 | nmdc:mga0a205_6503_c1 | nmdc:mga0a205_6503_c1_1979_2614 | 211 |
| 144 | 3300005295 | Ga0065707_10155957 | Ga0065707_101559572 | 212 |
| 145 | 3300005468 | Ga0070707_100043125 | Ga0070707_1000431253 | 212 |
| 146 | 3300005518 | Ga0070699_100109040 | Ga0070699_1001090403 | 212 |
| 147 | 3300005536 | Ga0070697_100094160 | Ga0070697_1000941602 | 212 |
| 148 | 3300005549 | Ga0070704_100260063 | Ga0070704_1002600631 | 212 |
| 149 | 3300006846 | Ga0075430_100033289 | Ga0075430_1000332895 | 212 |
| 150 | 3300006847 | Ga0075431_100001499 | Ga0075431_10000149918 | 212 |
| 151 | 3300006847 | Ga0075431_100124758 | Ga0075431_1001247583 | 212 |
| 152 | 3300006880 | Ga0075429_100150385 | Ga0075429_1001503852 | 212 |
| 153 | 3300025910 | Ga0207684_10227179 | Ga0207684_102271792 | 212 |
| 154 | 3300025922 | Ga0207646_10084589 | Ga0207646_100845894 | 212 |
| 155 | 3300026023 | Ga0207677_10802127 | Ga0207677_108021271 | 212 |
| 156 | 3300050509 | nmdc:mga0qj67_123910_c1 | nmdc:mga0qj67_123910_c1_1105_1779 | 212 |
| 157 | 3300050510 | nmdc:mga06r32_12645_c1 | nmdc:mga06r32_12645_c1_6095_6769 | 212 |
| 158 | 3300050510 | nmdc:mga06r32_170190_c1 | nmdc:mga06r32_170190_c1_1166_1807 | 212 |
| 159 | 3300006847 | Ga0075431_100580619 | Ga0075431_1005806192 | 213 |
| 160 | 3300031731 | Ga0307405_10017480 | Ga0307405_100174802 | 213 |
| 161 | 3300031824 | Ga0307413_10498568 | Ga0307413_104985681 | 213 |
| 162 | 3300031903 | Ga0307407_10112802 | Ga0307407_101128022 | 213 |
| 163 | 3300032005 | Ga0307411_10106373 | Ga0307411_101063732 | 213 |
| 164 | 3300049681 | Ga0501251_010919 | Ga0501251_010919_399_1043 | 213 |
| 165 | 3300049762 | Ga0501265_013488 | Ga0501265_013488_214_858 | 213 |
| 166 | 3300050510 | nmdc:mga06r32_861914_c1 | nmdc:mga06r32_861914_c1_171_848 | 213 |
| 167 | 3300005356 | Ga0070674_100622115 | Ga0070674_1006221151 | 214 |
| 168 | 3300005441 | Ga0070700_100137940 | Ga0070700_1001379402 | 214 |
| 169 | 3300005546 | Ga0070696_100356335 | Ga0070696_1003563352 | 214 |
| 170 | 3300006914 | Ga0075436_100120137 | Ga0075436_1001201372 | 214 |
| 171 | 3300032126 | Ga0307415_100246860 | Ga0307415_1002468602 | 214 |
| 172 | 3300005295 | Ga0065707_10147163 | Ga0065707_101471632 | 215 |
| 173 | 3300005406 | Ga0070703_10098849 | Ga0070703_100988491 | 215 |
| 174 | 3300005518 | Ga0070699_100615989 | Ga0070699_1006159891 | 215 |
| 175 | 3300006847 | Ga0075431_100171987 | Ga0075431_1001719872 | 215 |
| 176 | 3300006871 | Ga0075434_100551876 | Ga0075434_1005518762 | 215 |
| 177 | 3300009177 | Ga0105248_10039972 | Ga0105248_100399724 | 215 |
| 178 | 3300013306 | Ga0163162_10598085 | Ga0163162_105980852 | 215 |
| 179 | 3300025941 | Ga0207711_10069993 | Ga0207711_100699932 | 215 |
| 180 | 3300026118 | Ga0207675_100740546 | Ga0207675_1007405462 | 215 |
| 181 | 3300035088 | Ga0373940_0143078 | Ga0373940_0143078_95_742 | 215 |
| 182 | 3300037418 | Ga0395900_0858248 | Ga0395900_0858248_116_790 | 215 |
| 183 | 3300045051 | Ga0451576_0060593 | Ga0451576_0060593_1752_2411 | 215 |
| 184 | 3300045051 | Ga0451576_0522823 | Ga0451576_0522823_92_742 | 215 |
| 185 | 3300046689 | Ga0495613_0541488 | Ga0495613_0541488_30_689 | 215 |
| 186 | 3300050510 | nmdc:mga06r32_629_c1 | nmdc:mga06r32_629_c1_4693_5358 | 215 |
| 187 | 3300050512 | nmdc:mga0n895_530764_c1 | nmdc:mga0n895_530764_c1_124_783 | 215 |
| 188 | 3300005436 | Ga0070713_100082959 | Ga0070713_1000829592 | 216 |
| 189 | 3300005518 | Ga0070699_100000203 | Ga0070699_10000020312 | 216 |
| 190 | 3300005518 | Ga0070699_100007807 | Ga0070699_10000780717 | 216 |
| 191 | 3300006028 | Ga0070717_10022747 | Ga0070717_100227474 | 216 |
| 192 | 3300049591 | Ga0501075_0105994 | Ga0501075_0105994_365_1039 | 216 |
| 193 | 3300049592 | Ga0501076_0150033 | Ga0501076_0150033_113_787 | 216 |
| 194 | 3300049593 | Ga0501077_0025561 | Ga0501077_0025561_1069_1743 | 216 |
| 195 | 3300049741 | Ga0501079_0061866 | Ga0501079_0061866_290_964 | 216 |
| 196 | 3300050512 | nmdc:mga0n895_124385_c1 | nmdc:mga0n895_124385_c1_626_1330 | 216 |
| 197 | 3300050512 | nmdc:mga0n895_33678_c1 | nmdc:mga0n895_33678_c1_2948_3628 | 216 |
| 198 | 3300005436 | Ga0070713_100039551 | Ga0070713_1000395512 | 217 |
| 199 | 3300006028 | Ga0070717_10057237 | Ga0070717_100572373 | 217 |
| 200 | 3300025928 | Ga0207700_10013697 | Ga0207700_100136973 | 217 |
| 201 | 3300005295 | Ga0065707_10156844 | Ga0065707_101568442 | 218 |
| 202 | 3300005330 | Ga0070690_100000336 | Ga0070690_10000033613 | 218 |
| 203 | 3300005330 | Ga0070690_100255661 | Ga0070690_1002556612 | 218 |
| 204 | 3300005336 | Ga0070680_100015879 | Ga0070680_1000158791 | 218 |
| 205 | 3300005340 | Ga0070689_100000066 | Ga0070689_10000006623 | 218 |
| 206 | 3300005340 | Ga0070689_100013687 | Ga0070689_1000136875 | 218 |
| 207 | 3300005340 | Ga0070689_100499628 | Ga0070689_1004996282 | 218 |
| 208 | 3300005341 | Ga0070691_10098550 | Ga0070691_100985502 | 218 |
| 209 | 3300005345 | Ga0070692_10065240 | Ga0070692_100652402 | 218 |
| 210 | 3300005365 | Ga0070688_100000114 | Ga0070688_1000001142 | 218 |
| 211 | 3300005438 | Ga0070701_10000020 | Ga0070701_1000002021 | 218 |
| 212 | 3300005441 | Ga0070700_100000818 | Ga0070700_10000081814 | 218 |
| 213 | 3300005441 | Ga0070700_100174157 | Ga0070700_1001741573 | 218 |
| 214 | 3300005444 | Ga0070694_100131611 | Ga0070694_1001316112 | 218 |
| 215 | 3300005459 | Ga0068867_100010555 | Ga0068867_1000105552 | 218 |
| 216 | 3300005466 | Ga0070685_10000069 | Ga0070685_1000006948 | 218 |
| 217 | 3300005467 | Ga0070706_100046137 | Ga0070706_1000461371 | 218 |
| 218 | 3300005468 | Ga0070707_100000174 | Ga0070707_10000017458 | 218 |
| 219 | 3300005471 | Ga0070698_100055324 | Ga0070698_1000553243 | 218 |
| 220 | 3300005518 | Ga0070699_100025037 | Ga0070699_1000250374 | 218 |
| 221 | 3300005518 | Ga0070699_100054256 | Ga0070699_1000542562 | 218 |
| 222 | 3300005536 | Ga0070697_100006083 | Ga0070697_1000060836 | 218 |
| 223 | 3300005536 | Ga0070697_100009078 | Ga0070697_1000090786 | 218 |
| 224 | 3300005536 | Ga0070697_100384266 | Ga0070697_1003842661 | 218 |
| 225 | 3300005544 | Ga0070686_100000100 | Ga0070686_10000010019 | 218 |
| 226 | 3300005545 | Ga0070695_100017152 | Ga0070695_1000171523 | 218 |
| 227 | 3300005546 | Ga0070696_100001020 | Ga0070696_10000102023 | 218 |
| 228 | 3300005546 | Ga0070696_100171976 | Ga0070696_1001719762 | 218 |
| 229 | 3300005549 | Ga0070704_100059758 | Ga0070704_1000597582 | 218 |
| 230 | 3300005617 | Ga0068859_100000797 | Ga0068859_10000079734 | 218 |
| 231 | 3300005617 | Ga0068859_100314500 | Ga0068859_1003145002 | 218 |
| 232 | 3300006844 | Ga0075428_101342255 | Ga0075428_1013422551 | 218 |
| 233 | 3300006846 | Ga0075430_100120701 | Ga0075430_1001207012 | 218 |
| 234 | 3300006847 | Ga0075431_100752293 | Ga0075431_1007522931 | 218 |
| 235 | 3300006852 | Ga0075433_10073129 | Ga0075433_100731292 | 218 |
| 236 | 3300006880 | Ga0075429_100886570 | Ga0075429_1008865701 | 218 |
| 237 | 3300006931 | Ga0097620_100000797 | Ga0097620_10000079734 | 218 |
| 238 | 3300006931 | Ga0097620_100314511 | Ga0097620_1003145112 | 218 |
| 239 | 3300009147 | Ga0114129_10698086 | Ga0114129_106980862 | 218 |
| 240 | 3300009148 | Ga0105243_10621152 | Ga0105243_106211521 | 218 |
| 241 | 3300009148 | Ga0105243_10746354 | Ga0105243_107463542 | 218 |
| 242 | 3300009176 | Ga0105242_10022908 | Ga0105242_100229084 | 218 |
| 243 | 3300009177 | Ga0105248_10000910 | Ga0105248_1000091018 | 218 |
| 244 | 3300013308 | Ga0157375_10681122 | Ga0157375_106811222 | 218 |
| 245 | 3300014326 | Ga0157380_10029960 | Ga0157380_100299601 | 218 |
| 246 | 3300025910 | Ga0207684_10039479 | Ga0207684_100394791 | 218 |
| 247 | 3300025910 | Ga0207684_10367547 | Ga0207684_103675471 | 218 |
| 248 | 3300025917 | Ga0207660_10016768 | Ga0207660_100167683 | 218 |
| 249 | 3300025922 | Ga0207646_10000002 | Ga0207646_10000002207 | 218 |
| 250 | 3300025936 | Ga0207670_10000098 | Ga0207670_1000009820 | 218 |
| 251 | 3300025936 | Ga0207670_10006458 | Ga0207670_100064583 | 218 |
| 252 | 3300025941 | Ga0207711_10005850 | Ga0207711_100058508 | 218 |
| 253 | 3300026075 | Ga0207708_10015027 | Ga0207708_100150272 | 218 |
| 254 | 3300026088 | Ga0207641_10037514 | Ga0207641_100375145 | 218 |
| 255 | 3300026089 | Ga0207648_10001721 | Ga0207648_100017212 | 218 |
| 256 | 3300027617 | Ga0210002_1047157 | Ga0210002_10471571 | 218 |
| 257 | 3300027717 | Ga0209998_10017197 | Ga0209998_100171972 | 218 |
| 258 | 3300027876 | Ga0209974_10029023 | Ga0209974_100290232 | 218 |
| 259 | 3300027876 | Ga0209974_10063014 | Ga0209974_100630142 | 218 |
| 260 | 3300028380 | Ga0268265_10861719 | Ga0268265_108617192 | 218 |
| 261 | 3300028577 | Ga0265318_10006061 | Ga0265318_100060615 | 218 |
| 262 | 3300044673 | Ga0453683_0152319 | Ga0453683_0152319_190_849 | 218 |
| 263 | 3300045051 | Ga0451576_0076318 | Ga0451576_0076318_29_688 | 218 |
| 264 | 3300045051 | Ga0451576_0101652 | Ga0451576_0101652_608_1276 | 218 |
| 265 | 3300049568 | Ga0501031_0000180 | Ga0501031_0000180_10484_11146 | 218 |
| 266 | 3300049568 | Ga0501031_0005414 | Ga0501031_0005414_7045_7719 | 218 |
| 267 | 3300049572 | Ga0501036_0045620 | Ga0501036_0045620_225_899 | 218 |
| 268 | 3300049572 | Ga0501036_0847867 | Ga0501036_0847867_36_698 | 218 |
| 269 | 3300049574 | Ga0501038_0016430 | Ga0501038_0016430_5416_6090 | 218 |
| 270 | 3300049575 | Ga0501039_0000834 | Ga0501039_0000834_3388_4062 | 218 |
| 271 | 3300049575 | Ga0501039_0000919 | Ga0501039_0000919_10450_11112 | 218 |
| 272 | 3300049576 | Ga0501040_0003533 | Ga0501040_0003533_6558_7232 | 218 |
| 273 | 3300049576 | Ga0501040_0036594 | Ga0501040_0036594_106_768 | 218 |
| 274 | 3300049577 | Ga0501041_0000481 | Ga0501041_0000481_16641_17315 | 218 |
| 275 | 3300049578 | Ga0501042_0000164 | Ga0501042_0000164_2372_3046 | 218 |
| 276 | 3300049578 | Ga0501042_0031091 | Ga0501042_0031091_1464_2126 | 218 |
| 277 | 3300049579 | Ga0501043_0048992 | Ga0501043_0048992_745_1419 | 218 |
| 278 | 3300049580 | Ga0501046_0002388 | Ga0501046_0002388_10525_11187 | 218 |
| 279 | 3300049580 | Ga0501046_0003725 | Ga0501046_0003725_7051_7725 | 218 |
| 280 | 3300049582 | Ga0501048_0001626 | Ga0501048_0001626_14195_14869 | 218 |
| 281 | 3300049587 | Ga0501071_0038595 | Ga0501071_0038595_1995_2669 | 218 |
| 282 | 3300049587 | Ga0501071_0052916 | Ga0501071_0052916_592_1272 | 218 |
| 283 | 3300049588 | Ga0501072_0440431 | Ga0501072_0440431_199_879 | 218 |
| 284 | 3300049591 | Ga0501075_0093869 | Ga0501075_0093869_677_1351 | 218 |
| 285 | 3300049592 | Ga0501076_0020223 | Ga0501076_0020223_3149_3823 | 218 |
| 286 | 3300049592 | Ga0501076_0304192 | Ga0501076_0304192_145_825 | 218 |
| 287 | 3300049593 | Ga0501077_0081064 | Ga0501077_0081064_739_1419 | 218 |
| 288 | 3300049593 | Ga0501077_0428857 | Ga0501077_0428857_72_746 | 218 |
| 289 | 3300049741 | Ga0501079_0012495 | Ga0501079_0012495_4969_5649 | 218 |
| 290 | 3300049741 | Ga0501079_0019443 | Ga0501079_0019443_4067_4741 | 218 |
| 291 | 3300049743 | Ga0501081_0170750 | Ga0501081_0170750_677_1351 | 218 |
| 292 | 3300049822 | Ga0501035_0003730 | Ga0501035_0003730_7271_7945 | 218 |
| 293 | 3300049822 | Ga0501035_0020689 | Ga0501035_0020689_4481_5143 | 218 |
| 294 | 3300050507 | nmdc:mga05p37_592468_c1 | nmdc:mga05p37_592468_c1_165_827 | 218 |
| 295 | 3300050509 | nmdc:mga0qj67_324046_c1 | nmdc:mga0qj67_324046_c1_309_971 | 218 |
| 296 | 3300054114 | Ga0501084_0312913 | Ga0501084_0312913_420_1094 | 218 |
| 297 | 3300060353 | Ga0501082_0157448 | Ga0501082_0157448_806_1480 | 218 |
| 298 | 3300013296 | Ga0157374_10334043 | Ga0157374_103340432 | 219 |
| 299 | 3300050510 | nmdc:mga06r32_81312_c1 | nmdc:mga06r32_81312_c1_1868_2533 | 219 |
| 300 | 3300049681 | Ga0501251_000290 | Ga0501251_000290_548_1228 | 226 |
| 301 | 3300049652 | Ga0501202_002220 | Ga0501202_002220_183_872 | 229 |
| 302 | 3300005937 | Ga0081455_10000786 | Ga0081455_1000078625 | 230 |
| 303 | 3300049568 | Ga0501031_0021701 | Ga0501031_0021701_1671_2363 | 230 |
| 304 | 3300049572 | Ga0501036_0113453 | Ga0501036_0113453_1120_1812 | 230 |
| 305 | 3300049576 | Ga0501040_0011021 | Ga0501040_0011021_3020_3712 | 230 |
| 306 | 3300049577 | Ga0501041_0229934 | Ga0501041_0229934_202_894 | 230 |
| 307 | 3300049580 | Ga0501046_0235579 | Ga0501046_0235579_315_1007 | 230 |
| 308 | 3300049582 | Ga0501048_0058909 | Ga0501048_0058909_1749_2441 | 230 |
| 309 | 3300049584 | Ga0501068_0401912 | Ga0501068_0401912_154_846 | 230 |
| 310 | 3300049587 | Ga0501071_0051850 | Ga0501071_0051850_1562_2254 | 230 |
| 311 | 3300049592 | Ga0501076_0038758 | Ga0501076_0038758_2835_3545 | 230 |
| 312 | 3300049741 | Ga0501079_0335315 | Ga0501079_0335315_357_1049 | 230 |
| 313 | 3300049742 | Ga0501080_0085095 | Ga0501080_0085095_266_976 | 230 |
| 314 | 3300049743 | Ga0501081_0108341 | Ga0501081_0108341_1186_1878 | 230 |
| 315 | 3300049744 | Ga0501083_0055564 | Ga0501083_0055564_329_1039 | 230 |
| 316 | 3300049824 | Ga0501045_0409737 | Ga0501045_0409737_284_976 | 230 |
| 317 | 3300060353 | Ga0501082_0103840 | Ga0501082_0103840_446_1138 | 230 |
| 318 | 3300061734 | Ga0530510_0031102 | Ga0530510_0031102_1797_2507 | 230 |
| 319 | 3300061734 | Ga0530510_0363815 | Ga0530510_0363815_83_775 | 230 |
| 320 | 3300001990 | JGI24737J22298_10035592 | JGI24737J22298_100355922 | 231 |
| 321 | 3300003371 | JGI26145J50221_1000622 | JGI26145J50221_10006223 | 231 |
| 322 | 3300004803 | Ga0058862_12494334 | Ga0058862_124943341 | 231 |
| 323 | 3300005293 | Ga0065715_10343468 | Ga0065715_103434682 | 231 |
| 324 | 3300005295 | Ga0065707_10082920 | Ga0065707_100829209 | 231 |
| 325 | 3300005328 | Ga0070676_10000208 | Ga0070676_1000020820 | 231 |
| 326 | 3300005329 | Ga0070683_100013326 | Ga0070683_1000133269 | 231 |
| 327 | 3300005330 | Ga0070690_100053293 | Ga0070690_1000532933 | 231 |
| 328 | 3300005331 | Ga0070670_100035231 | Ga0070670_1000352312 | 231 |
| 329 | 3300005333 | Ga0070677_10033528 | Ga0070677_100335282 | 231 |
| 330 | 3300005334 | Ga0068869_100044072 | Ga0068869_1000440722 | 231 |
| 331 | 3300005335 | Ga0070666_10093743 | Ga0070666_100937431 | 231 |
| 332 | 3300005336 | Ga0070680_100014057 | Ga0070680_1000140574 | 231 |
| 333 | 3300005338 | Ga0068868_100003923 | Ga0068868_1000039233 | 231 |
| 334 | 3300005339 | Ga0070660_100155336 | Ga0070660_1001553362 | 231 |
| 335 | 3300005340 | Ga0070689_100027407 | Ga0070689_1000274072 | 231 |
| 336 | 3300005340 | Ga0070689_100166053 | Ga0070689_1001660532 | 231 |
| 337 | 3300005341 | Ga0070691_10000458 | Ga0070691_100004583 | 231 |
| 338 | 3300005343 | Ga0070687_100007886 | Ga0070687_1000078862 | 231 |
| 339 | 3300005343 | Ga0070687_100014961 | Ga0070687_1000149611 | 231 |
| 340 | 3300005344 | Ga0070661_100059011 | Ga0070661_1000590113 | 231 |
| 341 | 3300005344 | Ga0070661_100162922 | Ga0070661_1001629221 | 231 |
| 342 | 3300005345 | Ga0070692_10052047 | Ga0070692_100520472 | 231 |
| 343 | 3300005353 | Ga0070669_100001454 | Ga0070669_1000014546 | 231 |
| 344 | 3300005354 | Ga0070675_100022925 | Ga0070675_1000229254 | 231 |
| 345 | 3300005356 | Ga0070674_100002716 | Ga0070674_1000027166 | 231 |
| 346 | 3300005364 | Ga0070673_100003965 | Ga0070673_1000039656 | 231 |
| 347 | 3300005365 | Ga0070688_100003042 | Ga0070688_1000030421 | 231 |
| 348 | 3300005366 | Ga0070659_100045053 | Ga0070659_1000450533 | 231 |
| 349 | 3300005367 | Ga0070667_100044367 | Ga0070667_1000443673 | 231 |
| 350 | 3300005438 | Ga0070701_10083380 | Ga0070701_100833803 | 231 |
| 351 | 3300005441 | Ga0070700_100006314 | Ga0070700_1000063144 | 231 |
| 352 | 3300005444 | Ga0070694_100085689 | Ga0070694_1000856893 | 231 |
| 353 | 3300005456 | Ga0070678_100002436 | Ga0070678_1000024363 | 231 |
| 354 | 3300005457 | Ga0070662_100027204 | Ga0070662_1000272042 | 231 |
| 355 | 3300005458 | Ga0070681_10000949 | Ga0070681_100009492 | 231 |
| 356 | 3300005459 | Ga0068867_100001096 | Ga0068867_10000109612 | 231 |
| 357 | 3300005530 | Ga0070679_100086185 | Ga0070679_1000861853 | 231 |
| 358 | 3300005543 | Ga0070672_100014728 | Ga0070672_1000147282 | 231 |
| 359 | 3300005543 | Ga0070672_100018616 | Ga0070672_1000186161 | 231 |
| 360 | 3300005544 | Ga0070686_100112019 | Ga0070686_1001120193 | 231 |
| 361 | 3300005544 | Ga0070686_100152750 | Ga0070686_1001527502 | 231 |
| 362 | 3300005545 | Ga0070695_100161371 | Ga0070695_1001613712 | 231 |
| 363 | 3300005546 | Ga0070696_100003911 | Ga0070696_1000039115 | 231 |
| 364 | 3300005548 | Ga0070665_100011203 | Ga0070665_1000112032 | 231 |
| 365 | 3300005549 | Ga0070704_100012684 | Ga0070704_1000126844 | 231 |
| 366 | 3300005564 | Ga0070664_100000584 | Ga0070664_10000058418 | 231 |
| 367 | 3300005564 | Ga0070664_100029223 | Ga0070664_1000292233 | 231 |
| 368 | 3300005577 | Ga0068857_100020770 | Ga0068857_1000207704 | 231 |
| 369 | 3300005578 | Ga0068854_100360819 | Ga0068854_1003608192 | 231 |
| 370 | 3300005719 | Ga0068861_100418324 | Ga0068861_1004183242 | 231 |
| 371 | 3300005843 | Ga0068860_100033522 | Ga0068860_1000335225 | 231 |
| 372 | 3300005844 | Ga0068862_100018207 | Ga0068862_1000182075 | 231 |
| 373 | 3300006058 | Ga0075432_10000036 | Ga0075432_100000363 | 231 |
| 374 | 3300006194 | Ga0075427_10008727 | Ga0075427_100087272 | 231 |
| 375 | 3300006237 | Ga0097621_100050861 | Ga0097621_1000508612 | 231 |
| 376 | 3300006237 | Ga0097621_100185432 | Ga0097621_1001854322 | 231 |
| 377 | 3300006358 | Ga0068871_100142571 | Ga0068871_1001425712 | 231 |
| 378 | 3300006844 | Ga0075428_100047540 | Ga0075428_1000475403 | 231 |
| 379 | 3300006846 | Ga0075430_100006133 | Ga0075430_1000061335 | 231 |
| 380 | 3300006847 | Ga0075431_100002174 | Ga0075431_1000021742 | 231 |
| 381 | 3300006852 | Ga0075433_10034668 | Ga0075433_100346682 | 231 |
| 382 | 3300006871 | Ga0075434_100025831 | Ga0075434_1000258314 | 231 |
| 383 | 3300006880 | Ga0075429_100001236 | Ga0075429_10000123616 | 231 |
| 384 | 3300006880 | Ga0075429_100018761 | Ga0075429_1000187613 | 231 |
| 385 | 3300006880 | Ga0075429_100323505 | Ga0075429_1003235052 | 231 |
| 386 | 3300006881 | Ga0068865_100061183 | Ga0068865_1000611832 | 231 |
| 387 | 3300006914 | Ga0075436_100025325 | Ga0075436_1000253253 | 231 |
| 388 | 3300007076 | Ga0075435_100015728 | Ga0075435_1000157284 | 231 |
| 389 | 3300007076 | Ga0075435_100120978 | Ga0075435_1001209782 | 231 |
| 390 | 3300009147 | Ga0114129_10018292 | Ga0114129_100182924 | 231 |
| 391 | 3300009147 | Ga0114129_10094153 | Ga0114129_100941535 | 231 |
| 392 | 3300009148 | Ga0105243_10000238 | Ga0105243_1000023825 | 231 |
| 393 | 3300009176 | Ga0105242_10001243 | Ga0105242_1000124314 | 231 |
| 394 | 3300013296 | Ga0157374_10064849 | Ga0157374_100648492 | 231 |
| 395 | 3300025893 | Ga0207682_10011353 | Ga0207682_100113531 | 231 |
| 396 | 3300025898 | Ga0207692_10100998 | Ga0207692_101009983 | 231 |
| 397 | 3300025901 | Ga0207688_10016869 | Ga0207688_100168694 | 231 |
| 398 | 3300025903 | Ga0207680_10065528 | Ga0207680_100655282 | 231 |
| 399 | 3300025907 | Ga0207645_10000472 | Ga0207645_1000047230 | 231 |
| 400 | 3300025912 | Ga0207707_10223182 | Ga0207707_102231823 | 231 |
| 401 | 3300025917 | Ga0207660_10004716 | Ga0207660_100047164 | 231 |
| 402 | 3300025918 | Ga0207662_10001208 | Ga0207662_100012089 | 231 |
| 403 | 3300025918 | Ga0207662_10001387 | Ga0207662_100013871 | 231 |
| 404 | 3300025919 | Ga0207657_10026122 | Ga0207657_100261224 | 231 |
| 405 | 3300025920 | Ga0207649_10102270 | Ga0207649_101022703 | 231 |
| 406 | 3300025920 | Ga0207649_10138219 | Ga0207649_101382193 | 231 |
| 407 | 3300025921 | Ga0207652_10063414 | Ga0207652_100634143 | 231 |
| 408 | 3300025923 | Ga0207681_10078341 | Ga0207681_100783412 | 231 |
| 409 | 3300025925 | Ga0207650_10028346 | Ga0207650_100283463 | 231 |
| 410 | 3300025926 | Ga0207659_10070962 | Ga0207659_100709623 | 231 |
| 411 | 3300025932 | Ga0207690_10041191 | Ga0207690_100411913 | 231 |
| 412 | 3300025933 | Ga0207706_10001209 | Ga0207706_1000120923 | 231 |
| 413 | 3300025936 | Ga0207670_10069318 | Ga0207670_100693182 | 231 |
| 414 | 3300025936 | Ga0207670_10121442 | Ga0207670_101214423 | 231 |
| 415 | 3300025937 | Ga0207669_10000358 | Ga0207669_1000035816 | 231 |
| 416 | 3300025938 | Ga0207704_10022133 | Ga0207704_100221333 | 231 |
| 417 | 3300025940 | Ga0207691_10000555 | Ga0207691_1000055538 | 231 |
| 418 | 3300025940 | Ga0207691_10102607 | Ga0207691_101026073 | 231 |
| 419 | 3300025942 | Ga0207689_10003806 | Ga0207689_1000380614 | 231 |
| 420 | 3300025944 | Ga0207661_10507493 | Ga0207661_105074932 | 231 |
| 421 | 3300025945 | Ga0207679_10002301 | Ga0207679_100023016 | 231 |
| 422 | 3300025945 | Ga0207679_10003057 | Ga0207679_1000305710 | 231 |
| 423 | 3300025949 | Ga0207667_10191581 | Ga0207667_101915813 | 231 |
| 424 | 3300025960 | Ga0207651_10003023 | Ga0207651_100030234 | 231 |
| 425 | 3300025972 | Ga0207668_10001671 | Ga0207668_100016714 | 231 |
| 426 | 3300025981 | Ga0207640_10011726 | Ga0207640_100117263 | 231 |
| 427 | 3300025986 | Ga0207658_10011910 | Ga0207658_100119108 | 231 |
| 428 | 3300026023 | Ga0207677_10072678 | Ga0207677_100726782 | 231 |
| 429 | 3300026075 | Ga0207708_10003299 | Ga0207708_100032999 | 231 |
| 430 | 3300026089 | Ga0207648_10000543 | Ga0207648_1000054325 | 231 |
| 431 | 3300026116 | Ga0207674_10029412 | Ga0207674_100294125 | 231 |
| 432 | 3300026118 | Ga0207675_100096568 | Ga0207675_1000965682 | 231 |
| 433 | 3300026121 | Ga0207683_10001107 | Ga0207683_1000110710 | 231 |
| 434 | 3300027252 | Ga0209973_1000627 | Ga0209973_10006274 | 231 |
| 435 | 3300027360 | Ga0209969_1000008 | Ga0209969_100000825 | 231 |
| 436 | 3300027364 | Ga0209967_1000144 | Ga0209967_10001444 | 231 |
| 437 | 3300027378 | Ga0209981_1000003 | Ga0209981_100000325 | 231 |
| 438 | 3300027395 | Ga0209996_1000058 | Ga0209996_10000586 | 231 |
| 439 | 3300027462 | Ga0210000_1000024 | Ga0210000_100002418 | 231 |
| 440 | 3300027471 | Ga0209995_1000087 | Ga0209995_10000876 | 231 |
| 441 | 3300027526 | Ga0209968_1000019 | Ga0209968_100001916 | 231 |
| 442 | 3300027526 | Ga0209968_1036060 | Ga0209968_10360601 | 231 |
| 443 | 3300027543 | Ga0209999_1000055 | Ga0209999_10000558 | 231 |
| 444 | 3300027552 | Ga0209982_1000541 | Ga0209982_10005414 | 231 |
| 445 | 3300027552 | Ga0209982_1028476 | Ga0209982_10284761 | 231 |
| 446 | 3300027614 | Ga0209970_1000013 | Ga0209970_100001318 | 231 |
| 447 | 3300027617 | Ga0210002_1000024 | Ga0210002_100002412 | 231 |
| 448 | 3300027665 | Ga0209983_1000253 | Ga0209983_10002539 | 231 |
| 449 | 3300027682 | Ga0209971_1000232 | Ga0209971_10002327 | 231 |
| 450 | 3300027695 | Ga0209966_1000331 | Ga0209966_100033113 | 231 |
| 451 | 3300027717 | Ga0209998_10000094 | Ga0209998_1000009425 | 231 |
| 452 | 3300027717 | Ga0209998_10010297 | Ga0209998_100102973 | 231 |
| 453 | 3300027876 | Ga0209974_10000076 | Ga0209974_1000007624 | 231 |
| 454 | 3300027876 | Ga0209974_10001696 | Ga0209974_1000169610 | 231 |
| 455 | 3300027907 | Ga0207428_10000529 | Ga0207428_1000052923 | 231 |
| 456 | 3300028379 | Ga0268266_10196812 | Ga0268266_101968122 | 231 |
| 457 | 3300028380 | Ga0268265_10037045 | Ga0268265_100370453 | 231 |
| 458 | 3300028381 | Ga0268264_10197119 | Ga0268264_101971192 | 231 |
| 459 | 3300031548 | Ga0307408_100129805 | Ga0307408_1001298053 | 231 |
| 460 | 3300031995 | Ga0307409_100205553 | Ga0307409_1002055533 | 231 |
| 461 | 3300032004 | Ga0307414_10050348 | Ga0307414_100503482 | 231 |
| 462 | 3300032005 | Ga0307411_10117509 | Ga0307411_101175093 | 231 |
| 463 | 3300032126 | Ga0307415_100300003 | Ga0307415_1003000032 | 231 |
| 464 | 3300035241 | Ga0373961_0025237 | Ga0373961_0025237_567_1262 | 231 |
| 465 | 3300035691 | Ga0373931_0427214 | Ga0373931_0427214_52_753 | 231 |
| 466 | 3300041405 | Ga0439438_015089 | Ga0439438_015089_767_1462 | 231 |
| 467 | 3300042001 | Ga0439441_011852 | Ga0439441_011852_66_761 | 231 |
| 468 | 3300042004 | Ga0439445_0032238 | Ga0439445_0032238_328_1023 | 231 |
| 469 | 3300042006 | Ga0439432_018382 | Ga0439432_018382_764_1459 | 231 |
| 470 | 3300042008 | Ga0439450_000289 | Ga0439450_000289_3369_4064 | 231 |
| 471 | 3300042010 | Ga0439452_012134 | Ga0439452_012134_1521_2216 | 231 |
| 472 | 3300042015 | Ga0439462_0011814 | Ga0439462_0011814_1453_2148 | 231 |
| 473 | 3300042016 | Ga0439463_049351 | Ga0439463_049351_173_871 | 231 |
| 474 | 3300042126 | Ga0450888_005211 | Ga0450888_005211_632_1327 | 231 |
| 475 | 3300042142 | Ga0450905_015836 | Ga0450905_015836_206_901 | 231 |
| 476 | 3300042435 | Ga0439434_0003138 | Ga0439434_0003138_10_705 | 231 |
| 477 | 3300042439 | Ga0439464_0053663 | Ga0439464_0053663_340_1035 | 231 |
| 478 | 3300042461 | Ga0439460_0019607 | Ga0439460_0019607_407_1102 | 231 |
| 479 | 3300042461 | Ga0439460_0028323 | Ga0439460_0028323_813_1508 | 231 |
| 480 | 3300045051 | Ga0451576_0005198 | Ga0451576_0005198_10190_10885 | 231 |
| 481 | 3300045051 | Ga0451576_0021687 | Ga0451576_0021687_4464_5159 | 231 |
| 482 | 3300045051 | Ga0451576_0206586 | Ga0451576_0206586_1215_1970 | 231 |
| 483 | 3300048915 | Ga0496112_0650879 | Ga0496112_0650879_173_868 | 231 |
| 484 | 3300049513 | Ga0501290_000059 | Ga0501290_000059_1683_2378 | 231 |
| 485 | 3300049514 | Ga0501291_000488 | Ga0501291_000488_3288_3983 | 231 |
| 486 | 3300049514 | Ga0501291_037816 | Ga0501291_037816_83_778 | 231 |
| 487 | 3300049515 | Ga0501292_000129 | Ga0501292_000129_10193_10888 | 231 |
| 488 | 3300049517 | Ga0501294_001147 | Ga0501294_001147_314_1009 | 231 |
| 489 | 3300049518 | Ga0501295_000527 | Ga0501295_000527_2442_3137 | 231 |
| 490 | 3300049519 | Ga0501296_000322 | Ga0501296_000322_2619_3314 | 231 |
| 491 | 3300049520 | Ga0501297_006586 | Ga0501297_006586_414_1109 | 231 |
| 492 | 3300049521 | Ga0501298_014650 | Ga0501298_014650_532_1227 | 231 |
| 493 | 3300049522 | Ga0501299_000048 | Ga0501299_000048_2305_3000 | 231 |
| 494 | 3300049523 | Ga0501300_000939 | Ga0501300_000939_900_1595 | 231 |
| 495 | 3300049578 | Ga0501042_0495586 | Ga0501042_0495586_16_711 | 231 |
| 496 | 3300049591 | Ga0501075_0349573 | Ga0501075_0349573_361_1074 | 231 |
| 497 | 3300049651 | Ga0501201_002201 | Ga0501201_002201_731_1426 | 231 |
| 498 | 3300049654 | Ga0501207_002773 | Ga0501207_002773_1365_2060 | 231 |
| 499 | 3300049660 | Ga0501216_026863 | Ga0501216_026863_75_770 | 231 |
| 500 | 3300049661 | Ga0501217_006804 | Ga0501217_006804_788_1483 | 231 |
| 501 | 3300049665 | Ga0501227_054178 | Ga0501227_054178_144_839 | 231 |
| 502 | 3300049666 | Ga0501228_000969 | Ga0501228_000969_1263_1958 | 231 |
| 503 | 3300049667 | Ga0501230_003655 | Ga0501230_003655_181_876 | 231 |
| 504 | 3300049668 | Ga0501233_001024 | Ga0501233_001024_2326_3021 | 231 |
| 505 | 3300049669 | Ga0501235_005843 | Ga0501235_005843_209_904 | 231 |
| 506 | 3300049670 | Ga0501236_002097 | Ga0501236_002097_591_1286 | 231 |
| 507 | 3300049672 | Ga0501239_002111 | Ga0501239_002111_427_1122 | 231 |
| 508 | 3300049675 | Ga0501243_001231 | Ga0501243_001231_818_1513 | 231 |
| 509 | 3300049676 | Ga0501246_000121 | Ga0501246_000121_1969_2664 | 231 |
| 510 | 3300049679 | Ga0501249_005735 | Ga0501249_005735_1410_2105 | 231 |
| 511 | 3300049682 | Ga0501252_003336 | Ga0501252_003336_760_1455 | 231 |
| 512 | 3300049687 | Ga0501258_000856 | Ga0501258_000856_843_1538 | 231 |
| 513 | 3300049690 | Ga0501261_024892 | Ga0501261_024892_59_754 | 231 |
| 514 | 3300049703 | Ga0501219_001566 | Ga0501219_001566_291_986 | 231 |
| 515 | 3300049704 | Ga0501221_002583 | Ga0501221_002583_1955_2650 | 231 |
| 516 | 3300049705 | Ga0501225_0044852 | Ga0501225_0044852_181_876 | 231 |
| 517 | 3300049707 | Ga0501234_000290 | Ga0501234_000290_2294_2989 | 231 |
| 518 | 3300049708 | Ga0501245_002169 | Ga0501245_002169_1367_2062 | 231 |
| 519 | 3300049757 | Ga0501232_002905 | Ga0501232_002905_676_1371 | 231 |
| 520 | 3300049760 | Ga0501263_032821 | Ga0501263_032821_20_715 | 231 |
| 521 | 3300049761 | Ga0501264_000674 | Ga0501264_000674_3806_4501 | 231 |
| 522 | 3300049762 | Ga0501265_000090 | Ga0501265_000090_140_835 | 231 |
| 523 | 3300049763 | Ga0501266_001401 | Ga0501266_001401_96_791 | 231 |
| 524 | 3300049765 | Ga0501268_005185 | Ga0501268_005185_659_1354 | 231 |
| 525 | 3300049767 | Ga0501270_003400 | Ga0501270_003400_621_1316 | 231 |
| 526 | 3300049770 | Ga0501273_006029 | Ga0501273_006029_549_1244 | 231 |
| 527 | 3300049772 | Ga0501275_001141 | Ga0501275_001141_1440_2135 | 231 |
| 528 | 3300049773 | Ga0501276_000898 | Ga0501276_000898_1078_1773 | 231 |
| 529 | 3300049775 | Ga0501279_005900 | Ga0501279_005900_319_1014 | 231 |
| 530 | 3300049779 | Ga0501283_004101 | Ga0501283_004101_1221_1916 | 231 |
| 531 | 3300049853 | Ga0501226_002731 | Ga0501226_002731_1402_2097 | 231 |
| 532 | 3300050510 | nmdc:mga06r32_965086_c1 | nmdc:mga06r32_965086_c1_72_767 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wul-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.98 | 173 | 230 |
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.972 | 171 | 230 |
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9712 | 171 | 230 |
| 4wu4-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna | 0.9687 | 171 | 230 |
| 3ulq-assembly1.cif.gz_B | crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain | 0.9686 | 173 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ulqB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9686 | 173 | 224 | 1.10.10.10 |
| 6ekhY00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9613 | 20 | 138 | 3.40.50.2300 |
| 4tmyB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9588 | 22 | 138 | 3.40.50.2300 |
| 4if4C02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.958 | 173 | 229 | 1.10.10.10 |
| 3eulC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9574 | 22 | 139 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5J4KWZ3-F1-model_v4 | Response regulatory domain-containing protein | 0.9728 | 18 | 115 |
GO:0000160
GO:0003677 |
| AF-A0A4Y1ZA51-F1-model_v4 | DNA-binding response regulator, LuxR family | 0.9696 | 22 | 98 |
GO:0000160
GO:0003677 |
| AF-A0A7S8FEZ6-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9673 | 21 | 138 |
GO:0000155
GO:0005524 GO:0016020 GO:0046983 |
| AF-A0A701W0F1-F1-model_v4 | Response regulator | 0.9667 | 21 | 106 |
GO:0000160
GO:0003677 |
| AF-A0A2M7A5F5-F1-model_v4 | Two-component system response regulator | 0.9647 | 48 | 139 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar