metagRoot

F460310

General Info

Members	Datasets	Scaffolds	Average Seq Length
532	281	532	223

Family's Representative Sequence

Representative Sequence	3300045051\|Ga0451576_0206586\|Ga0451576_0206586_1215_1970
Length	251
Sequence	MALREKSRPAVRSARKTNEGSTPVSKGRLIRLLLVDDHEVVRLGLRALFNRTGTIRVVGEADTMESAIAQAVRLKPDVILMDVRLPDGDGIEACREIRSECPDIRVLFLTSYSDEAAVVSTVFAGAAGFLLKEIGGSALVQAIETVAKGQSIFDPSAVQRMIAQMHPQSADEKPSPEDALSPRDERILALVAEGKTNKQIAVELNLSDKTIKNLLSVIFQKLQISRRSQAAAIFVKRAAAHYYPVIPKKDE

Samples

	Sample ID	Description	Type	Environment
1	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
2	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
3	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
4	3300003371	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM	Metagenome	Rhizosphere
5	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
6	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
7	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
8	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
9	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
10	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
11	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
12	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
13	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
14	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
15	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
16	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
17	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
18	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
19	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
20	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
21	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
22	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
23	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
24	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
25	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
26	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
27	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
28	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
29	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
30	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
31	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
32	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
33	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
34	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
35	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
36	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
37	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
38	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
39	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
40	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
41	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
42	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
43	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
44	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
45	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
46	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
47	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
48	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
49	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
50	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
51	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
52	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
53	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
54	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
55	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
56	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
59	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
60	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
61	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
65	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
66	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
67	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
68	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
70	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
71	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
72	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
73	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
74	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
75	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
76	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
77	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
78	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
80	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
81	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
83	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
85	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
86	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
87	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
88	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
89	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
90	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
91	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
92	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
95	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
96	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
97	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
159	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
163	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
164	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
165	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
166	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
167	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
168	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
169	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
170	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
171	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
172	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
173	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
174	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
175	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
176	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
177	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
178	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
179	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
180	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
181	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
182	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
183	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
184	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
185	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
186	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
187	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
188	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
189	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
190	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
191	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
192	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
193	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
194	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
195	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
196	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
197	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
198	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
199	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
200	3300049514	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought	Metagenome	Rhizosphere
201	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
202	3300049517	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control	Metagenome	Rhizosphere
203	3300049518	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control	Metagenome	Rhizosphere
204	3300049519	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought	Metagenome	Rhizosphere
205	3300049520	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought	Metagenome	Rhizosphere
206	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
207	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
208	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
209	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
210	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
212	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
213	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
214	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
215	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
216	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
218	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
220	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
221	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
222	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
223	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
225	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
226	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049651	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought	Metagenome	Rhizosphere
229	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
230	3300049654	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control	Metagenome	Rhizosphere
231	3300049660	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control	Metagenome	Rhizosphere
232	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
233	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
234	3300049666	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control	Metagenome	Rhizosphere
235	3300049667	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control	Metagenome	Rhizosphere
236	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
237	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
238	3300049670	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought	Metagenome	Rhizosphere
239	3300049672	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought	Metagenome	Rhizosphere
240	3300049675	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control	Metagenome	Rhizosphere
241	3300049676	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control	Metagenome	Rhizosphere
242	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
243	3300049681	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought	Metagenome	Rhizosphere
244	3300049682	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought	Metagenome	Rhizosphere
245	3300049687	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought	Metagenome	Rhizosphere
246	3300049690	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought	Metagenome	Rhizosphere
247	3300049703	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control	Metagenome	Rhizosphere
248	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
249	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
250	3300049707	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought	Metagenome	Rhizosphere
251	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
252	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
253	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
254	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
255	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
256	3300049757	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control	Metagenome	Rhizosphere
257	3300049760	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control	Metagenome	Rhizosphere
258	3300049761	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control	Metagenome	Rhizosphere
259	3300049762	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control	Metagenome	Rhizosphere
260	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
261	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
262	3300049767	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought	Metagenome	Rhizosphere
263	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
264	3300049772	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control	Metagenome	Rhizosphere
265	3300049773	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control	Metagenome	Rhizosphere
266	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
267	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
268	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
269	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
270	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
271	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
272	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
273	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
274	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
275	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
276	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
277	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
278	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
279	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
280	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
281	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.81
Metatranscriptomes	0.19
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.75
Nodule	0
Rhizoplane	0.56
Rhizosphere	98.68
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24737J22298_10035592	3300001990	Bacteria	1540
2	JGI25162J39368_1001285	3300002737	Bacteria	14229
3	JGI25165J46597_1000649	3300003214	Bacteria	28510
4	JGI26145J50221_1000622	3300003371	Bacteria	2990
5	Ga0058862_12494334	3300004803	Bacteria	1039
6	Ga0065715_10343468	3300005293	Bacteria	963
7	Ga0065707_10082920	3300005295	Bacteria	11403
8	Ga0065707_10147163	3300005295	Bacteria	1699
9	Ga0065707_10155957	3300005295	Unclassified	1608
10	Ga0065707_10156844	3300005295	Bacteria	1600
11	Ga0070676_10000208	3300005328	Bacteria	24961
12	Ga0070676_10334801	3300005328	Bacteria	1036
13	Ga0070683_100013326	3300005329	Bacteria	7167
14	Ga0070690_100000336	3300005330	Bacteria	24075
15	Ga0070690_100053293	3300005330	Bacteria	2588
16	Ga0070690_100255661	3300005330	Bacteria	1241
17	Ga0070670_100035231	3300005331	Bacteria	4309
18	Ga0070677_10033528	3300005333	Bacteria	1978
19	Ga0070677_10125513	3300005333	Bacteria	1165
20	Ga0068869_100044072	3300005334	Bacteria	3208
21	Ga0070666_10093743	3300005335	Bacteria	2065
22	Ga0070680_100014057	3300005336	Bacteria	6249
23	Ga0070680_100015879	3300005336	Bacteria	5912
24	Ga0070680_100245468	3300005336	Bacteria	1514
25	Ga0068868_100003923	3300005338	Bacteria	10391
26	Ga0070660_100155336	3300005339	Bacteria	1841
27	Ga0070689_100000066	3300005340	Bacteria	62639
28	Ga0070689_100013687	3300005340	Bacteria	5876
29	Ga0070689_100027407	3300005340	Bacteria	4295
30	Ga0070689_100166053	3300005340	Bacteria	1787
31	Ga0070689_100499628	3300005340	Bacteria	1042
32	Ga0070689_100922121	3300005340	Bacteria	774
33	Ga0070691_10000458	3300005341	Bacteria	15123
34	Ga0070691_10098550	3300005341	Bacteria	1449
35	Ga0070687_100007886	3300005343	Bacteria	4477
36	Ga0070687_100014961	3300005343	Bacteria	3498
37	Ga0070661_100059011	3300005344	Bacteria	2813
38	Ga0070661_100162922	3300005344	Bacteria	1690
39	Ga0070692_10007059	3300005345	Bacteria	4928
40	Ga0070692_10052047	3300005345	Bacteria	2132
41	Ga0070692_10065240	3300005345	Unclassified	1927
42	Ga0070692_10351715	3300005345	Bacteria	916
43	Ga0070669_100001454	3300005353	Bacteria	17172
44	Ga0070675_100022925	3300005354	Bacteria	4989
45	Ga0070675_100121241	3300005354	Bacteria	2222
46	Ga0070674_100002716	3300005356	Bacteria	9792
47	Ga0070674_100622115	3300005356	Bacteria	915
48	Ga0070673_100003965	3300005364	Bacteria	9304
49	Ga0070673_100166502	3300005364	Bacteria	1879
50	Ga0070688_100000114	3300005365	Bacteria	41990
51	Ga0070688_100003042	3300005365	Bacteria	8559
52	Ga0070659_100045053	3300005366	Bacteria	3455
53	Ga0070667_100044367	3300005367	Bacteria	3733
54	Ga0070703_10098849	3300005406	Unclassified	1025
55	Ga0070713_100039551	3300005436	Bacteria	3828
56	Ga0070713_100082959	3300005436	Bacteria	2739
57	Ga0070701_10000020	3300005438	Bacteria	41399
58	Ga0070701_10083380	3300005438	Bacteria	1736
59	Ga0070705_100173865	3300005440	Bacteria	1452
60	Ga0070700_100000818	3300005441	Bacteria	15281
61	Ga0070700_100006314	3300005441	Bacteria	6328
62	Ga0070700_100019665	3300005441	Bacteria	3901
63	Ga0070700_100137940	3300005441	Bacteria	1654
64	Ga0070700_100174157	3300005441	Unclassified	1492
65	Ga0070700_100387141	3300005441	Bacteria	1047
66	Ga0070694_100085689	3300005444	Bacteria	2201
67	Ga0070694_100131611	3300005444	Bacteria	1807
68	Ga0070678_100002436	3300005456	Bacteria	10191
69	Ga0070662_100027204	3300005457	Bacteria	3967
70	Ga0070681_10000949	3300005458	Bacteria	24425
71	Ga0070681_10065947	3300005458	Bacteria	3589
72	Ga0068867_100001096	3300005459	Bacteria	18486
73	Ga0068867_100004904	3300005459	Bacteria	9421
74	Ga0068867_100010555	3300005459	Bacteria	6516
75	Ga0068867_100184350	3300005459	Unclassified	1661
76	Ga0068867_100298694	3300005459	Bacteria	1327
77	Ga0070685_10000069	3300005466	Bacteria	60941
78	Ga0070706_100046137	3300005467	Bacteria	4023
79	Ga0070707_100000174	3300005468	Bacteria	62748
80	Ga0070707_100043125	3300005468	Bacteria	4318
81	Ga0070698_100055324	3300005471	Bacteria	4025
82	Ga0070699_100000203	3300005518	Bacteria	58650
83	Ga0070699_100007807	3300005518	Bacteria	9301
84	Ga0070699_100025037	3300005518	Bacteria	5146
85	Ga0070699_100054256	3300005518	Unclassified	3469
86	Ga0070699_100109040	3300005518	Bacteria	2429
87	Ga0070699_100615989	3300005518	Bacteria	990
88	Ga0070679_100073196	3300005530	Bacteria	3418
89	Ga0070679_100086185	3300005530	Bacteria	3128
90	Ga0070697_100000769	3300005536	Bacteria	23994
91	Ga0070697_100006083	3300005536	Bacteria	9334
92	Ga0070697_100009078	3300005536	Bacteria	7768
93	Ga0070697_100094160	3300005536	Bacteria	2481
94	Ga0070697_100384266	3300005536	Bacteria	1216
95	Ga0070672_100014728	3300005543	Bacteria	5548
96	Ga0070672_100018616	3300005543	Bacteria	5026
97	Ga0070672_100462267	3300005543	Unclassified	1094
98	Ga0070686_100000100	3300005544	Bacteria	59351
99	Ga0070686_100112019	3300005544	Bacteria	1861
100	Ga0070686_100152750	3300005544	Bacteria	1619
101	Ga0070695_100017152	3300005545	Bacteria	4391
102	Ga0070695_100161371	3300005545	Bacteria	1574
103	Ga0070696_100001020	3300005546	Bacteria	18098
104	Ga0070696_100003911	3300005546	Bacteria	9952
105	Ga0070696_100171976	3300005546	Unclassified	1602
106	Ga0070696_100248670	3300005546	Bacteria	1344
107	Ga0070696_100356335	3300005546	Bacteria	1134
108	Ga0070665_100011203	3300005548	Bacteria	9066
109	Ga0070704_100012684	3300005549	Bacteria	5214
110	Ga0070704_100059758	3300005549	Bacteria	2721
111	Ga0070704_100260063	3300005549	Bacteria	1429
112	Ga0070664_100000584	3300005564	Bacteria	27791
113	Ga0070664_100029223	3300005564	Bacteria	4594
114	Ga0068857_100020770	3300005577	Bacteria	5778
115	Ga0068857_100164213	3300005577	Bacteria	2016
116	Ga0068854_100360819	3300005578	Bacteria	1192
117	Ga0070702_100125430	3300005615	Bacteria	1613
118	Ga0070702_100176181	3300005615	Bacteria	1395
119	Ga0068859_100000797	3300005617	Bacteria	31969
120	Ga0068859_100314500	3300005617	Bacteria	1660
121	Ga0068866_10008391	3300005718	Bacteria	4353
122	Ga0068861_100003214	3300005719	Bacteria	10812
123	Ga0068861_100325067	3300005719	Bacteria	1341
124	Ga0068861_100418324	3300005719	Bacteria	1194
125	Ga0068851_10000190	3300005834	Bacteria	30256
126	Ga0068870_10642586	3300005840	Bacteria	726
127	Ga0068860_100033522	3300005843	Bacteria	4927
128	Ga0068860_100247168	3300005843	Unclassified	1736
129	Ga0068862_100005771	3300005844	Bacteria	10322
130	Ga0068862_100018207	3300005844	Bacteria	5848
131	Ga0068862_100711854	3300005844	Bacteria	973
132	Ga0081455_10000786	3300005937	Bacteria	40744
133	Ga0070717_10022747	3300006028	Bacteria	4958
134	Ga0070717_10057237	3300006028	Bacteria	3222
135	Ga0075432_10000036	3300006058	Bacteria	25056
136	Ga0075427_10008727	3300006194	Bacteria	1506
137	Ga0097621_100050861	3300006237	Bacteria	3371
138	Ga0097621_100185432	3300006237	Bacteria	1800
139	Ga0068871_100142571	3300006358	Bacteria	2038
140	Ga0075428_100047540	3300006844	Bacteria	4712
141	Ga0075428_100063247	3300006844	Bacteria	4051
142	Ga0075428_100791110	3300006844	Bacteria	1008
143	Ga0075428_100818097	3300006844	Bacteria	990
144	Ga0075428_101342255	3300006844	Unclassified	751
145	Ga0075430_100003725	3300006846	Bacteria	12810
146	Ga0075430_100006133	3300006846	Bacteria	10128
147	Ga0075430_100033289	3300006846	Bacteria	4374
148	Ga0075430_100113843	3300006846	Bacteria	2255
149	Ga0075430_100120701	3300006846	Bacteria	2185
150	Ga0075431_100001499	3300006847	Bacteria	21616
151	Ga0075431_100002174	3300006847	Bacteria	18731
152	Ga0075431_100124758	3300006847	Unclassified	2657
153	Ga0075431_100171987	3300006847	Bacteria	2225
154	Ga0075431_100452497	3300006847	Bacteria	1279
155	Ga0075431_100580619	3300006847	Bacteria	1106
156	Ga0075431_100752293	3300006847	Bacteria	950
157	Ga0075433_10034668	3300006852	Bacteria	4336
158	Ga0075433_10073129	3300006852	Unclassified	3015
159	Ga0075433_10413226	3300006852	Bacteria	1190
160	Ga0075434_100025831	3300006871	Bacteria	5749
161	Ga0075434_100551876	3300006871	Bacteria	1172
162	Ga0075429_100001236	3300006880	Bacteria	20721
163	Ga0075429_100018761	3300006880	Bacteria	5990
164	Ga0075429_100044800	3300006880	Bacteria	3848
165	Ga0075429_100150385	3300006880	Bacteria	2038
166	Ga0075429_100323505	3300006880	Bacteria	1349
167	Ga0075429_100886570	3300006880	Bacteria	781
168	Ga0068865_100005516	3300006881	Bacteria	7677
169	Ga0068865_100061183	3300006881	Bacteria	2638
170	Ga0075436_100025325	3300006914	Bacteria	4082
171	Ga0075436_100120137	3300006914	Bacteria	1838
172	Ga0097620_100000797	3300006931	Bacteria	31969
173	Ga0097620_100314511	3300006931	Bacteria	1660
174	Ga0075435_100015728	3300007076	Bacteria	5691
175	Ga0075435_100120978	3300007076	Bacteria	2184
176	Ga0105240_10317588	3300009093	Bacteria	1776
177	Ga0111539_10086759	3300009094	Bacteria	3677
178	Ga0111539_10221675	3300009094	Bacteria	2202
179	Ga0111539_11377951	3300009094	Bacteria	818
180	Ga0105245_10012432	3300009098	Bacteria	7408
181	Ga0114129_10016132	3300009147	Bacteria	10629
182	Ga0114129_10018292	3300009147	Bacteria	9981
183	Ga0114129_10036857	3300009147	Bacteria	6905
184	Ga0114129_10094153	3300009147	Bacteria	4149
185	Ga0114129_10471088	3300009147	Bacteria	1645
186	Ga0114129_10698086	3300009147	Bacteria	1304
187	Ga0114129_10992145	3300009147	Bacteria	1058
188	Ga0105243_10000238	3300009148	Bacteria	63019
189	Ga0105243_10003957	3300009148	Bacteria	11823
190	Ga0105243_10621152	3300009148	Bacteria	1043
191	Ga0105243_10746354	3300009148	Unclassified	959
192	Ga0105243_11091783	3300009148	Bacteria	806
193	Ga0105242_10001243	3300009176	Bacteria	20071
194	Ga0105242_10022908	3300009176	Bacteria	4919
195	Ga0105248_10000910	3300009177	Bacteria	32974
196	Ga0105248_10039972	3300009177	Bacteria	5257
197	Ga0105249_10011144	3300009553	Bacteria	7899
198	Ga0105249_10063640	3300009553	Bacteria	3389
199	Ga0105249_10172519	3300009553	Bacteria	2098
200	Ga0105246_10077959	3300011119	Bacteria	2352
201	Ga0157373_10218328	3300013100	Bacteria	1345
202	Ga0157374_10064849	3300013296	Bacteria	3429
203	Ga0157374_10334043	3300013296	Bacteria	1504
204	Ga0157374_10632712	3300013296	Bacteria	1081
205	Ga0157378_10009137	3300013297	Bacteria	8626
206	Ga0163162_10209229	3300013306	Bacteria	2080
207	Ga0163162_10593695	3300013306	Bacteria	1234
208	Ga0163162_10598085	3300013306	Bacteria	1229
209	Ga0157375_10082249	3300013308	Bacteria	3261
210	Ga0157375_10681122	3300013308	Bacteria	1183
211	Ga0157380_10011230	3300014326	Bacteria	6467
212	Ga0157380_10029960	3300014326	Bacteria	4164
213	Ga0157380_10653923	3300014326	Bacteria	1049
214	Ga0157380_10687698	3300014326	Bacteria	1026
215	Ga0157377_10018864	3300014745	Bacteria	3593
216	Ga0157377_10415448	3300014745	Bacteria	920
217	Ga0157376_10080700	3300014969	Bacteria	2791
218	Ga0209437_100301	3300025233	Bacteria	69230
219	Ga0209233_1000285	3300025261	Bacteria	69238
220	Ga0207682_10011353	3300025893	Bacteria	3478
221	Ga0207692_10100998	3300025898	Bacteria	1583
222	Ga0207642_10005018	3300025899	Bacteria	4296
223	Ga0207688_10016869	3300025901	Bacteria	3966
224	Ga0207680_10065528	3300025903	Bacteria	2230
225	Ga0207645_10000472	3300025907	Bacteria	33217
226	Ga0207643_10215690	3300025908	Bacteria	1173
227	Ga0207684_10039479	3300025910	Bacteria	4004
228	Ga0207684_10227179	3300025910	Bacteria	1611
229	Ga0207684_10367547	3300025910	Unclassified	1238
230	Ga0207707_10003210	3300025912	Bacteria	14520
231	Ga0207707_10223182	3300025912	Bacteria	1640
232	Ga0207660_10004716	3300025917	Bacteria	8877
233	Ga0207660_10016768	3300025917	Bacteria	4857
234	Ga0207660_10135434	3300025917	Bacteria	1879
235	Ga0207660_10230076	3300025917	Bacteria	1457
236	Ga0207662_10001208	3300025918	Bacteria	12343
237	Ga0207662_10001387	3300025918	Bacteria	11704
238	Ga0207662_10243616	3300025918	Bacteria	1178
239	Ga0207662_10438188	3300025918	Bacteria	892
240	Ga0207657_10026122	3300025919	Bacteria	5372
241	Ga0207649_10102270	3300025920	Bacteria	1899
242	Ga0207649_10138219	3300025920	Bacteria	1663
243	Ga0207652_10063414	3300025921	Bacteria	3196
244	Ga0207652_10107581	3300025921	Bacteria	2470
245	Ga0207646_10000002	3300025922	Bacteria	550880
246	Ga0207646_10084589	3300025922	Bacteria	2839
247	Ga0207681_10007353	3300025923	Bacteria	6746
248	Ga0207681_10078341	3300025923	Bacteria	2325
249	Ga0207650_10028346	3300025925	Bacteria	4014
250	Ga0207659_10070962	3300025926	Bacteria	2542
251	Ga0207659_10141810	3300025926	Bacteria	1866
252	Ga0207700_10013697	3300025928	Bacteria	5288
253	Ga0207690_10041191	3300025932	Bacteria	3025
254	Ga0207706_10001209	3300025933	Bacteria	26097
255	Ga0207670_10000098	3300025936	Bacteria	60320
256	Ga0207670_10006458	3300025936	Bacteria	6504
257	Ga0207670_10069318	3300025936	Bacteria	2432
258	Ga0207670_10121442	3300025936	Bacteria	1900
259	Ga0207669_10000358	3300025937	Bacteria	20723
260	Ga0207704_10022133	3300025938	Bacteria	3399
261	Ga0207704_10432912	3300025938	Bacteria	1046
262	Ga0207691_10000555	3300025940	Bacteria	37340
263	Ga0207691_10102607	3300025940	Bacteria	2551
264	Ga0207691_10392893	3300025940	Unclassified	1183
265	Ga0207711_10005850	3300025941	Bacteria	10384
266	Ga0207711_10069993	3300025941	Unclassified	3042
267	Ga0207689_10003806	3300025942	Bacteria	13754
268	Ga0207689_10093509	3300025942	Bacteria	2470
269	Ga0207661_10507493	3300025944	Bacteria	1102
270	Ga0207679_10002301	3300025945	Bacteria	11774
271	Ga0207679_10003057	3300025945	Bacteria	10362
272	Ga0207667_10191581	3300025949	Bacteria	2098
273	Ga0207651_10003023	3300025960	Bacteria	8151
274	Ga0207651_10219155	3300025960	Bacteria	1537
275	Ga0207712_10006987	3300025961	Bacteria	7118
276	Ga0207668_10001671	3300025972	Bacteria	12968
277	Ga0207668_10053140	3300025972	Bacteria	2806
278	Ga0207640_10011726	3300025981	Bacteria	4970
279	Ga0207658_10011910	3300025986	Bacteria	5930
280	Ga0207677_10072678	3300026023	Bacteria	2432
281	Ga0207677_10802127	3300026023	Unclassified	843
282	Ga0207708_10003299	3300026075	Bacteria	11877
283	Ga0207708_10015027	3300026075	Bacteria	5802
284	Ga0207708_10048088	3300026075	Bacteria	3247
285	Ga0207641_10037514	3300026088	Bacteria	4048
286	Ga0207648_10000276	3300026089	Bacteria	55713
287	Ga0207648_10000543	3300026089	Bacteria	42056
288	Ga0207648_10001721	3300026089	Bacteria	23956
289	Ga0207648_10224956	3300026089	Unclassified	1668
290	Ga0207648_10383978	3300026089	Bacteria	1270
291	Ga0207674_10029412	3300026116	Bacteria	5784
292	Ga0207674_10205004	3300026116	Bacteria	1921
293	Ga0207675_100007574	3300026118	Bacteria	10257
294	Ga0207675_100096568	3300026118	Bacteria	2782
295	Ga0207675_100458692	3300026118	Bacteria	1264
296	Ga0207675_100740546	3300026118	Bacteria	994
297	Ga0207683_10001107	3300026121	Bacteria	24547
298	Ga0209973_1000627	3300027252	Bacteria	2769
299	Ga0209969_1000008	3300027360	Bacteria	28047
300	Ga0209967_1000144	3300027364	Bacteria	9733
301	Ga0209981_1000003	3300027378	Bacteria	30420
302	Ga0209996_1000058	3300027395	Bacteria	15054
303	Ga0210000_1000024	3300027462	Bacteria	23307
304	Ga0209995_1000087	3300027471	Bacteria	14662
305	Ga0209968_1000019	3300027526	Bacteria	32234
306	Ga0209968_1036060	3300027526	Bacteria	836
307	Ga0209999_1000055	3300027543	Bacteria	12672
308	Ga0209982_1000541	3300027552	Bacteria	4709
309	Ga0209982_1028476	3300027552	Bacteria	874
310	Ga0209970_1000013	3300027614	Bacteria	24097
311	Ga0210002_1000024	3300027617	Bacteria	23321
312	Ga0210002_1047157	3300027617	Bacteria	739
313	Ga0209983_1000253	3300027665	Bacteria	10950
314	Ga0209971_1000232	3300027682	Bacteria	15872
315	Ga0209966_1000331	3300027695	Bacteria	14989
316	Ga0209998_10000094	3300027717	Bacteria	35182
317	Ga0209998_10010297	3300027717	Bacteria	1936
318	Ga0209998_10017197	3300027717	Bacteria	1526
319	Ga0209974_10000076	3300027876	Bacteria	26650
320	Ga0209974_10001696	3300027876	Bacteria	7979
321	Ga0209974_10029023	3300027876	Bacteria	1833
322	Ga0209974_10063014	3300027876	Unclassified	1257
323	Ga0207428_10000529	3300027907	Bacteria	45592
324	Ga0207428_10003555	3300027907	Bacteria	15064
325	Ga0207428_10039242	3300027907	Bacteria	3845
326	Ga0207428_10508084	3300027907	Bacteria	875
327	Ga0268266_10196812	3300028379	Bacteria	1843
328	Ga0268265_10036624	3300028380	Bacteria	3595
329	Ga0268265_10037045	3300028380	Bacteria	3576
330	Ga0268265_10070008	3300028380	Bacteria	2726
331	Ga0268265_10861719	3300028380	Bacteria	887
332	Ga0268264_10197119	3300028381	Bacteria	1839
333	Ga0265318_10006061	3300028577	Bacteria	5603
334	Ga0307408_100010072	3300031548	Bacteria	6231
335	Ga0307408_100129805	3300031548	Bacteria	1964
336	Ga0307408_100203369	3300031548	Bacteria	1605
337	Ga0307405_10017480	3300031731	Bacteria	3936
338	Ga0307405_10339847	3300031731	Bacteria	1154
339	Ga0307413_10498568	3300031824	Bacteria	977
340	Ga0307410_10453259	3300031852	Unclassified	1047
341	Ga0307407_10112802	3300031903	Unclassified	1710
342	Ga0307409_100205553	3300031995	Bacteria	1765
343	Ga0307409_100544098	3300031995	Bacteria	1139
344	Ga0307416_100088592	3300032002	Bacteria	2647
345	Ga0307416_101325507	3300032002	Unclassified	826
346	Ga0307414_10050348	3300032004	Bacteria	2885
347	Ga0307411_10106373	3300032005	Bacteria	1997
348	Ga0307411_10117509	3300032005	Bacteria	1916
349	Ga0307415_100246860	3300032126	Bacteria	1448
350	Ga0307415_100300003	3300032126	Bacteria	1330
351	Ga0373940_0143078	3300035088	Bacteria	757
352	Ga0373941_0065300	3300035115	Bacteria	1194
353	Ga0373941_0072554	3300035115	Bacteria	1146
354	Ga0373942_0019679	3300035207	Bacteria	1687
355	Ga0373942_0076952	3300035207	Bacteria	984
356	Ga0373961_0025237	3300035241	Bacteria	1614
357	Ga0373931_0012622	3300035691	Bacteria	4097
358	Ga0373931_0427214	3300035691	Unclassified	843
359	Ga0395900_0858248	3300037418	Bacteria	833
360	Ga0439438_015089	3300041405	Bacteria	2282
361	Ga0439441_011852	3300042001	Bacteria	1486
362	Ga0439445_0032238	3300042004	Bacteria	1365
363	Ga0439432_018382	3300042006	Bacteria	2336
364	Ga0439450_000289	3300042008	Bacteria	6222
365	Ga0439452_012134	3300042010	Bacteria	2460
366	Ga0439462_0011814	3300042015	Bacteria	2227
367	Ga0439463_049351	3300042016	Bacteria	1073
368	Ga0450888_005211	3300042126	Bacteria	1379
369	Ga0450905_015836	3300042142	Bacteria	1083
370	Ga0439458_0036830	3300042157	Bacteria	1178
371	Ga0439434_0003138	3300042435	Bacteria	4858
372	Ga0439464_0053663	3300042439	Bacteria	1170
373	Ga0439460_0019607	3300042461	Bacteria	1833
374	Ga0439460_0028323	3300042461	Bacteria	1580
375	Ga0453683_0152319	3300044673	Bacteria	1461
376	Ga0453684_0025592	3300044712	Bacteria	8563
377	Ga0451576_0005198	3300045051	Bacteria	16438
378	Ga0451576_0021687	3300045051	Bacteria	6978
379	Ga0451576_0060593	3300045051	Bacteria	3948
380	Ga0451576_0076318	3300045051	Bacteria	3488
381	Ga0451576_0101652	3300045051	Unclassified	2990
382	Ga0451576_0206586	3300045051	Bacteria	2051
383	Ga0451576_0522823	3300045051	Bacteria	1247
384	Ga0451576_0577234	3300045051	Bacteria	1181
385	Ga0451576_0903461	3300045051	Bacteria	926
386	Ga0495613_0541488	3300046689	Unclassified	780
387	Ga0496106_0168144	3300048909	Bacteria	1737
388	Ga0496106_0641795	3300048909	Bacteria	849
389	Ga0496112_0650879	3300048915	Bacteria	983
390	Ga0501290_000059	3300049513	Bacteria	15168
391	Ga0501291_000488	3300049514	Bacteria	4616
392	Ga0501291_037816	3300049514	Bacteria	838
393	Ga0501292_000129	3300049515	Bacteria	12783
394	Ga0501294_001147	3300049517	Bacteria	2758
395	Ga0501295_000527	3300049518	Bacteria	3586
396	Ga0501296_000322	3300049519	Bacteria	4918
397	Ga0501297_006586	3300049520	Bacteria	1244
398	Ga0501298_014650	3300049521	Bacteria	1403
399	Ga0501299_000048	3300049522	Bacteria	13201
400	Ga0501300_000939	3300049523	Bacteria	4450
401	Ga0501031_0000180	3300049568	Bacteria	35738
402	Ga0501031_0005414	3300049568	Bacteria	8309
403	Ga0501031_0021701	3300049568	Bacteria	4186
404	Ga0501036_0045620	3300049572	Bacteria	3712
405	Ga0501036_0113453	3300049572	Bacteria	2290
406	Ga0501036_0847867	3300049572	Bacteria	751
407	Ga0501037_0317158	3300049573	Bacteria	1080
408	Ga0501038_0016430	3300049574	Bacteria	6707
409	Ga0501038_0483461	3300049574	Bacteria	949
410	Ga0501039_0000834	3300049575	Bacteria	22277
411	Ga0501039_0000919	3300049575	Bacteria	21494
412	Ga0501039_0688762	3300049575	Bacteria	799
413	Ga0501040_0003533	3300049576	Bacteria	10103
414	Ga0501040_0011021	3300049576	Bacteria	5910
415	Ga0501040_0036594	3300049576	Bacteria	3332
416	Ga0501041_0000481	3300049577	Bacteria	20342
417	Ga0501041_0229934	3300049577	Bacteria	1164
418	Ga0501042_0000164	3300049578	Bacteria	30409
419	Ga0501042_0031091	3300049578	Bacteria	3777
420	Ga0501042_0495586	3300049578	Bacteria	887
421	Ga0501043_0048992	3300049579	Bacteria	3321
422	Ga0501046_0002388	3300049580	Bacteria	17642
423	Ga0501046_0003725	3300049580	Bacteria	13952
424	Ga0501046_0235579	3300049580	Bacteria	1351
425	Ga0501048_0001626	3300049582	Bacteria	17099
426	Ga0501048_0058909	3300049582	Bacteria	2721
427	Ga0501067_0050791	3300049583	Bacteria	2298
428	Ga0501068_0401912	3300049584	Bacteria	883
429	Ga0501070_0009317	3300049586	Bacteria	8305
430	Ga0501071_0038595	3300049587	Bacteria	3413
431	Ga0501071_0051850	3300049587	Bacteria	2957
432	Ga0501071_0052916	3300049587	Bacteria	2928
433	Ga0501072_0440431	3300049588	Bacteria	1032
434	Ga0501075_0093869	3300049591	Bacteria	2277
435	Ga0501075_0105994	3300049591	Bacteria	2136
436	Ga0501075_0349573	3300049591	Bacteria	1127
437	Ga0501076_0020223	3300049592	Bacteria	5094
438	Ga0501076_0038758	3300049592	Bacteria	3741
439	Ga0501076_0150033	3300049592	Bacteria	1896
440	Ga0501076_0304192	3300049592	Bacteria	1307
441	Ga0501077_0025561	3300049593	Bacteria	3750
442	Ga0501077_0081064	3300049593	Bacteria	2055
443	Ga0501077_0428857	3300049593	Unclassified	846
444	Ga0501201_002201	3300049651	Bacteria	1789
445	Ga0501202_002220	3300049652	Bacteria	3241
446	Ga0501207_002773	3300049654	Bacteria	2288
447	Ga0501216_026863	3300049660	Bacteria	1041
448	Ga0501217_006804	3300049661	Bacteria	2438
449	Ga0501227_054178	3300049665	Bacteria	1017
450	Ga0501228_000969	3300049666	Bacteria	1983
451	Ga0501230_003655	3300049667	Bacteria	2060
452	Ga0501233_001024	3300049668	Bacteria	4752
453	Ga0501235_005843	3300049669	Bacteria	2679
454	Ga0501236_002097	3300049670	Bacteria	2274
455	Ga0501239_002111	3300049672	Bacteria	1780
456	Ga0501243_001231	3300049675	Bacteria	3669
457	Ga0501246_000121	3300049676	Bacteria	4745
458	Ga0501249_005735	3300049679	Bacteria	2537
459	Ga0501251_000290	3300049681	Bacteria	4440
460	Ga0501251_010919	3300049681	Bacteria	1074
461	Ga0501252_003336	3300049682	Bacteria	1648
462	Ga0501258_000856	3300049687	Bacteria	2277
463	Ga0501261_024892	3300049690	Bacteria	878
464	Ga0501219_001566	3300049703	Bacteria	2106
465	Ga0501221_002583	3300049704	Bacteria	2986
466	Ga0501225_0044852	3300049705	Bacteria	1223
467	Ga0501234_000290	3300049707	Bacteria	7353
468	Ga0501245_002169	3300049708	Bacteria	2609
469	Ga0501079_0012495	3300049741	Bacteria	6481
470	Ga0501079_0019443	3300049741	Bacteria	5188
471	Ga0501079_0061866	3300049741	Bacteria	2887
472	Ga0501079_0335315	3300049741	Bacteria	1184
473	Ga0501080_0085095	3300049742	Bacteria	2938
474	Ga0501080_0263680	3300049742	Bacteria	1569
475	Ga0501081_0108341	3300049743	Bacteria	1970
476	Ga0501081_0170750	3300049743	Unclassified	1570
477	Ga0501083_0055564	3300049744	Bacteria	2654
478	Ga0501232_002905	3300049757	Bacteria	1526
479	Ga0501263_032821	3300049760	Unclassified	739
480	Ga0501264_000674	3300049761	Bacteria	4684
481	Ga0501265_000090	3300049762	Bacteria	7953
482	Ga0501265_013488	3300049762	Bacteria	1029
483	Ga0501266_001401	3300049763	Bacteria	3079
484	Ga0501268_005185	3300049765	Bacteria	1864
485	Ga0501270_003400	3300049767	Bacteria	1715
486	Ga0501273_006029	3300049770	Bacteria	1389
487	Ga0501275_001141	3300049772	Bacteria	2682
488	Ga0501276_000898	3300049773	Bacteria	1908
489	Ga0501279_005900	3300049775	Bacteria	1612
490	Ga0501279_041955	3300049775	Bacteria	705
491	Ga0501283_004101	3300049779	Bacteria	1955
492	Ga0501035_0003730	3300049822	Bacteria	14525
493	Ga0501035_0020689	3300049822	Bacteria	6047
494	Ga0501035_0048260	3300049822	Bacteria	3819
495	Ga0501045_0409737	3300049824	Bacteria	1008
496	Ga0501226_002731	3300049853	Bacteria	2128
497	nmdc:mga05p37_35207_c1	3300050507	Bacteria	6138
498	nmdc:mga05p37_358868_c1	3300050507	Bacteria	1714
499	nmdc:mga05p37_384581_c1	3300050507	Bacteria	1643
500	nmdc:mga05p37_592468_c1	3300050507	Bacteria	1253
501	nmdc:mga05p37_7114_c1	3300050507	Bacteria	13190
502	nmdc:mga09592_21121_c1	3300050508	Bacteria	5363
503	nmdc:mga09592_57742_c1	3300050508	Bacteria	3281
504	nmdc:mga0qj67_123910_c1	3300050509	Bacteria	2091
505	nmdc:mga0qj67_324046_c1	3300050509	Bacteria	1247
506	nmdc:mga0qj67_570435_c1	3300050509	Bacteria	907
507	nmdc:mga0qj67_59229_c1	3300050509	Bacteria	3037
508	nmdc:mga0qj67_62613_c1	3300050509	Bacteria	2956
509	nmdc:mga0qj67_7716_c1	3300050509	Bacteria	7952
510	nmdc:mga06r32_12645_c1	3300050510	Bacteria	7627
511	nmdc:mga06r32_170190_c1	3300050510	Bacteria	2162
512	nmdc:mga06r32_31431_c1	3300050510	Bacteria	4987
513	nmdc:mga06r32_541094_c1	3300050510	Bacteria	1139
514	nmdc:mga06r32_629_c1	3300050510	Bacteria	6261
515	nmdc:mga06r32_81312_c1	3300050510	Bacteria	3155
516	nmdc:mga06r32_861914_c1	3300050510	Bacteria	864
517	nmdc:mga06r32_965086_c1	3300050510	Bacteria	806
518	nmdc:mga08y16_21330_c1	3300050511	Bacteria	6840
519	nmdc:mga08y16_21638_c1	3300050511	Bacteria	6790
520	nmdc:mga08y16_579686_c1	3300050511	Bacteria	1133
521	nmdc:mga0n895_124385_c1	3300050512	Bacteria	2602
522	nmdc:mga0n895_296077_c1	3300050512	Bacteria	1641
523	nmdc:mga0n895_33678_c1	3300050512	Bacteria	4924
524	nmdc:mga0n895_530764_c1	3300050512	Bacteria	1184
525	nmdc:mga0n895_53286_c1	3300050512	Bacteria	3975
526	nmdc:mga0rr50_11342_c1	3300050513	Bacteria	5701
527	nmdc:mga0a205_6503_c1	3300050515	Bacteria	10566
528	Ga0501084_0312913	3300054114	Unclassified	1326
529	Ga0501082_0103840	3300060353	Bacteria	2458
530	Ga0501082_0157448	3300060353	Bacteria	1973
531	Ga0530510_0031102	3300061734	Bacteria	3837
532	Ga0530510_0363815	3300061734	Bacteria	1087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049775	Ga0501279_041955	Ga0501279_041955_22_561	172
2	3300005340	Ga0070689_100922121	Ga0070689_1009221211	187
3	3300050509	nmdc:mga0qj67_570435_c1	nmdc:mga0qj67_570435_c1_310_897	188
4	3300050507	nmdc:mga05p37_358868_c1	nmdc:mga05p37_358868_c1_17_616	193
5	3300013306	Ga0163162_10593695	Ga0163162_105936952	196
6	3300005328	Ga0070676_10334801	Ga0070676_103348011	197
7	3300005354	Ga0070675_100121241	Ga0070675_1001212412	197
8	3300005364	Ga0070673_100166502	Ga0070673_1001665022	197
9	3300005459	Ga0068867_100298694	Ga0068867_1002986942	197
10	3300005840	Ga0068870_10642586	Ga0068870_106425862	197
11	3300014745	Ga0157377_10415448	Ga0157377_104154482	197
12	3300025908	Ga0207643_10215690	Ga0207643_102156902	197
13	3300025926	Ga0207659_10141810	Ga0207659_101418102	197
14	3300025942	Ga0207689_10093509	Ga0207689_100935091	197
15	3300025960	Ga0207651_10219155	Ga0207651_102191552	197
16	3300026089	Ga0207648_10383978	Ga0207648_103839782	197
17	3300006846	Ga0075430_100003725	Ga0075430_1000037256	198
18	3300006846	Ga0075430_100113843	Ga0075430_1001138432	198
19	3300009147	Ga0114129_10471088	Ga0114129_104710881	198
20	3300031548	Ga0307408_100203369	Ga0307408_1002033692	198
21	3300031731	Ga0307405_10339847	Ga0307405_103398471	198
22	3300031995	Ga0307409_100544098	Ga0307409_1005440981	198
23	3300032002	Ga0307416_100088592	Ga0307416_1000885923	198
24	3300050507	nmdc:mga05p37_384581_c1	nmdc:mga05p37_384581_c1_129_752	198
25	3300050509	nmdc:mga0qj67_62613_c1	nmdc:mga0qj67_62613_c1_1947_2564	198
26	3300050509	nmdc:mga0qj67_7716_c1	nmdc:mga0qj67_7716_c1_474_1091	198
27	3300005441	Ga0070700_100387141	Ga0070700_1003871412	199
28	3300005719	Ga0068861_100325067	Ga0068861_1003250672	199
29	3300005844	Ga0068862_100711854	Ga0068862_1007118542	199
30	3300009147	Ga0114129_10992145	Ga0114129_109921452	199
31	3300009148	Ga0105243_11091783	Ga0105243_110917832	199
32	3300014326	Ga0157380_10653923	Ga0157380_106539232	199
33	3300025917	Ga0207660_10135434	Ga0207660_101354342	199
34	3300026118	Ga0207675_100458692	Ga0207675_1004586923	199
35	3300027907	Ga0207428_10039242	Ga0207428_100392422	199
36	3300027907	Ga0207428_10508084	Ga0207428_105080842	199
37	3300028380	Ga0268265_10036624	Ga0268265_100366243	199
38	3300031548	Ga0307408_100010072	Ga0307408_1000100724	199
39	3300035207	Ga0373942_0076952	Ga0373942_0076952_54_683	199
40	3300050509	nmdc:mga0qj67_59229_c1	nmdc:mga0qj67_59229_c1_1726_2355	199
41	3300050511	nmdc:mga08y16_579686_c1	nmdc:mga08y16_579686_c1_470_1099	199
42	3300006844	Ga0075428_100818097	Ga0075428_1008180972	200
43	3300006847	Ga0075431_100452497	Ga0075431_1004524972	200
44	3300050510	nmdc:mga06r32_541094_c1	nmdc:mga06r32_541094_c1_442_1074	200
45	3300049575	Ga0501039_0688762	Ga0501039_0688762_10_672	201
46	3300005345	Ga0070692_10351715	Ga0070692_103517152	202
47	3300005458	Ga0070681_10065947	Ga0070681_100659474	202
48	3300005530	Ga0070679_100073196	Ga0070679_1000731962	202
49	3300025912	Ga0207707_10003210	Ga0207707_100032102	202
50	3300025921	Ga0207652_10107581	Ga0207652_101075812	202
51	3300035115	Ga0373941_0065300	Ga0373941_0065300_546_1160	202
52	3300035207	Ga0373942_0019679	Ga0373942_0019679_366_980	202
53	3300035691	Ga0373931_0012622	Ga0373931_0012622_23_637	202
54	3300049583	Ga0501067_0050791	Ga0501067_0050791_220_834	202
55	3300005333	Ga0070677_10125513	Ga0070677_101255132	204
56	3300005336	Ga0070680_100245468	Ga0070680_1002454683	204
57	3300005345	Ga0070692_10007059	Ga0070692_100070593	204
58	3300005441	Ga0070700_100019665	Ga0070700_1000196654	204
59	3300005459	Ga0068867_100004904	Ga0068867_1000049042	204
60	3300005546	Ga0070696_100248670	Ga0070696_1002486702	204
61	3300005577	Ga0068857_100164213	Ga0068857_1001642134	204
62	3300005615	Ga0070702_100125430	Ga0070702_1001254301	204
63	3300005718	Ga0068866_10008391	Ga0068866_100083914	204
64	3300005719	Ga0068861_100003214	Ga0068861_1000032149	204
65	3300005844	Ga0068862_100005771	Ga0068862_1000057713	204
66	3300006844	Ga0075428_100063247	Ga0075428_1000632473	204
67	3300006852	Ga0075433_10413226	Ga0075433_104132262	204
68	3300006880	Ga0075429_100044800	Ga0075429_1000448003	204
69	3300006881	Ga0068865_100005516	Ga0068865_1000055164	204
70	3300009094	Ga0111539_10086759	Ga0111539_100867593	204
71	3300009147	Ga0114129_10036857	Ga0114129_100368576	204
72	3300009553	Ga0105249_10011144	Ga0105249_100111445	204
73	3300025899	Ga0207642_10005018	Ga0207642_100050184	204
74	3300025917	Ga0207660_10230076	Ga0207660_102300763	204
75	3300025923	Ga0207681_10007353	Ga0207681_100073535	204
76	3300025938	Ga0207704_10432912	Ga0207704_104329122	204
77	3300025961	Ga0207712_10006987	Ga0207712_100069874	204
78	3300025972	Ga0207668_10053140	Ga0207668_100531404	204
79	3300026075	Ga0207708_10048088	Ga0207708_100480882	204
80	3300026089	Ga0207648_10000276	Ga0207648_1000027620	204
81	3300026116	Ga0207674_10205004	Ga0207674_102050042	204
82	3300026118	Ga0207675_100007574	Ga0207675_1000075744	204
83	3300027907	Ga0207428_10003555	Ga0207428_1000355512	204
84	3300028380	Ga0268265_10070008	Ga0268265_100700084	204
85	3300050507	nmdc:mga05p37_7114_c1	nmdc:mga05p37_7114_c1_400_1044	204
86	3300050508	nmdc:mga09592_21121_c1	nmdc:mga09592_21121_c1_4376_5020	204
87	3300050511	nmdc:mga08y16_21638_c1	nmdc:mga08y16_21638_c1_2904_3548	204
88	3300044712	Ga0453684_0025592	Ga0453684_0025592_7503_8192	205
89	3300005834	Ga0068851_10000190	Ga0068851_1000019017	206
90	3300014326	Ga0157380_10687698	Ga0157380_106876981	206
91	3300031852	Ga0307410_10453259	Ga0307410_104532592	206
92	3300009094	Ga0111539_11377951	Ga0111539_113779511	207
93	3300009148	Ga0105243_10003957	Ga0105243_1000395715	207
94	3300009553	Ga0105249_10063640	Ga0105249_100636401	207
95	3300013306	Ga0163162_10209229	Ga0163162_102092293	207
96	3300048909	Ga0496106_0641795	Ga0496106_0641795_159_800	207
97	3300005440	Ga0070705_100173865	Ga0070705_1001738652	208
98	3300005615	Ga0070702_100176181	Ga0070702_1001761811	208
99	3300006844	Ga0075428_100791110	Ga0075428_1007911102	208
100	3300025918	Ga0207662_10438188	Ga0207662_104381882	208
101	3300002737	JGI25162J39368_1001285	JGI25162J39368_10012859	209
102	3300003214	JGI25165J46597_1000649	JGI25165J46597_100064924	209
103	3300025233	Ga0209437_100301	Ga0209437_1003014	209
104	3300025261	Ga0209233_1000285	Ga0209233_10002854	209
105	3300049573	Ga0501037_0317158	Ga0501037_0317158_64_750	209
106	3300049574	Ga0501038_0483461	Ga0501038_0483461_237_923	209
107	3300049586	Ga0501070_0009317	Ga0501070_0009317_1875_2561	209
108	3300049742	Ga0501080_0263680	Ga0501080_0263680_377_1063	209
109	3300049822	Ga0501035_0048260	Ga0501035_0048260_171_857	209
110	3300005459	Ga0068867_100184350	Ga0068867_1001843502	210
111	3300005543	Ga0070672_100462267	Ga0070672_1004622672	210
112	3300005843	Ga0068860_100247168	Ga0068860_1002471682	210
113	3300025940	Ga0207691_10392893	Ga0207691_103928932	210
114	3300026089	Ga0207648_10224956	Ga0207648_102249561	210
115	3300032002	Ga0307416_101325507	Ga0307416_1013255071	210
116	3300005536	Ga0070697_100000769	Ga0070697_10000076923	211
117	3300009093	Ga0105240_10317588	Ga0105240_103175883	211
118	3300009094	Ga0111539_10221675	Ga0111539_102216752	211
119	3300009098	Ga0105245_10012432	Ga0105245_100124324	211
120	3300009147	Ga0114129_10016132	Ga0114129_100161322	211
121	3300009553	Ga0105249_10172519	Ga0105249_101725193	211
122	3300011119	Ga0105246_10077959	Ga0105246_100779594	211
123	3300013100	Ga0157373_10218328	Ga0157373_102183282	211
124	3300013296	Ga0157374_10632712	Ga0157374_106327121	211
125	3300013297	Ga0157378_10009137	Ga0157378_100091374	211
126	3300013308	Ga0157375_10082249	Ga0157375_100822494	211
127	3300014326	Ga0157380_10011230	Ga0157380_100112305	211
128	3300014745	Ga0157377_10018864	Ga0157377_100188642	211
129	3300014969	Ga0157376_10080700	Ga0157376_100807004	211
130	3300025918	Ga0207662_10243616	Ga0207662_102436162	211
131	3300035115	Ga0373941_0072554	Ga0373941_0072554_326_961	211
132	3300042157	Ga0439458_0036830	Ga0439458_0036830_15_650	211
133	3300045051	Ga0451576_0577234	Ga0451576_0577234_181_816	211
134	3300045051	Ga0451576_0903461	Ga0451576_0903461_181_816	211
135	3300048909	Ga0496106_0168144	Ga0496106_0168144_841_1476	211
136	3300050507	nmdc:mga05p37_35207_c1	nmdc:mga05p37_35207_c1_2501_3136	211
137	3300050508	nmdc:mga09592_57742_c1	nmdc:mga09592_57742_c1_1907_2542	211
138	3300050510	nmdc:mga06r32_31431_c1	nmdc:mga06r32_31431_c1_1361_1996	211
139	3300050511	nmdc:mga08y16_21330_c1	nmdc:mga08y16_21330_c1_1012_1647	211
140	3300050512	nmdc:mga0n895_296077_c1	nmdc:mga0n895_296077_c1_799_1434	211
141	3300050512	nmdc:mga0n895_53286_c1	nmdc:mga0n895_53286_c1_3247_3882	211
142	3300050513	nmdc:mga0rr50_11342_c1	nmdc:mga0rr50_11342_c1_606_1241	211
143	3300050515	nmdc:mga0a205_6503_c1	nmdc:mga0a205_6503_c1_1979_2614	211
144	3300005295	Ga0065707_10155957	Ga0065707_101559572	212
145	3300005468	Ga0070707_100043125	Ga0070707_1000431253	212
146	3300005518	Ga0070699_100109040	Ga0070699_1001090403	212
147	3300005536	Ga0070697_100094160	Ga0070697_1000941602	212
148	3300005549	Ga0070704_100260063	Ga0070704_1002600631	212
149	3300006846	Ga0075430_100033289	Ga0075430_1000332895	212
150	3300006847	Ga0075431_100001499	Ga0075431_10000149918	212
151	3300006847	Ga0075431_100124758	Ga0075431_1001247583	212
152	3300006880	Ga0075429_100150385	Ga0075429_1001503852	212
153	3300025910	Ga0207684_10227179	Ga0207684_102271792	212
154	3300025922	Ga0207646_10084589	Ga0207646_100845894	212
155	3300026023	Ga0207677_10802127	Ga0207677_108021271	212
156	3300050509	nmdc:mga0qj67_123910_c1	nmdc:mga0qj67_123910_c1_1105_1779	212
157	3300050510	nmdc:mga06r32_12645_c1	nmdc:mga06r32_12645_c1_6095_6769	212
158	3300050510	nmdc:mga06r32_170190_c1	nmdc:mga06r32_170190_c1_1166_1807	212
159	3300006847	Ga0075431_100580619	Ga0075431_1005806192	213
160	3300031731	Ga0307405_10017480	Ga0307405_100174802	213
161	3300031824	Ga0307413_10498568	Ga0307413_104985681	213
162	3300031903	Ga0307407_10112802	Ga0307407_101128022	213
163	3300032005	Ga0307411_10106373	Ga0307411_101063732	213
164	3300049681	Ga0501251_010919	Ga0501251_010919_399_1043	213
165	3300049762	Ga0501265_013488	Ga0501265_013488_214_858	213
166	3300050510	nmdc:mga06r32_861914_c1	nmdc:mga06r32_861914_c1_171_848	213
167	3300005356	Ga0070674_100622115	Ga0070674_1006221151	214
168	3300005441	Ga0070700_100137940	Ga0070700_1001379402	214
169	3300005546	Ga0070696_100356335	Ga0070696_1003563352	214
170	3300006914	Ga0075436_100120137	Ga0075436_1001201372	214
171	3300032126	Ga0307415_100246860	Ga0307415_1002468602	214
172	3300005295	Ga0065707_10147163	Ga0065707_101471632	215
173	3300005406	Ga0070703_10098849	Ga0070703_100988491	215
174	3300005518	Ga0070699_100615989	Ga0070699_1006159891	215
175	3300006847	Ga0075431_100171987	Ga0075431_1001719872	215
176	3300006871	Ga0075434_100551876	Ga0075434_1005518762	215
177	3300009177	Ga0105248_10039972	Ga0105248_100399724	215
178	3300013306	Ga0163162_10598085	Ga0163162_105980852	215
179	3300025941	Ga0207711_10069993	Ga0207711_100699932	215
180	3300026118	Ga0207675_100740546	Ga0207675_1007405462	215
181	3300035088	Ga0373940_0143078	Ga0373940_0143078_95_742	215
182	3300037418	Ga0395900_0858248	Ga0395900_0858248_116_790	215
183	3300045051	Ga0451576_0060593	Ga0451576_0060593_1752_2411	215
184	3300045051	Ga0451576_0522823	Ga0451576_0522823_92_742	215
185	3300046689	Ga0495613_0541488	Ga0495613_0541488_30_689	215
186	3300050510	nmdc:mga06r32_629_c1	nmdc:mga06r32_629_c1_4693_5358	215
187	3300050512	nmdc:mga0n895_530764_c1	nmdc:mga0n895_530764_c1_124_783	215
188	3300005436	Ga0070713_100082959	Ga0070713_1000829592	216
189	3300005518	Ga0070699_100000203	Ga0070699_10000020312	216
190	3300005518	Ga0070699_100007807	Ga0070699_10000780717	216
191	3300006028	Ga0070717_10022747	Ga0070717_100227474	216
192	3300049591	Ga0501075_0105994	Ga0501075_0105994_365_1039	216
193	3300049592	Ga0501076_0150033	Ga0501076_0150033_113_787	216
194	3300049593	Ga0501077_0025561	Ga0501077_0025561_1069_1743	216
195	3300049741	Ga0501079_0061866	Ga0501079_0061866_290_964	216
196	3300050512	nmdc:mga0n895_124385_c1	nmdc:mga0n895_124385_c1_626_1330	216
197	3300050512	nmdc:mga0n895_33678_c1	nmdc:mga0n895_33678_c1_2948_3628	216
198	3300005436	Ga0070713_100039551	Ga0070713_1000395512	217
199	3300006028	Ga0070717_10057237	Ga0070717_100572373	217
200	3300025928	Ga0207700_10013697	Ga0207700_100136973	217
201	3300005295	Ga0065707_10156844	Ga0065707_101568442	218
202	3300005330	Ga0070690_100000336	Ga0070690_10000033613	218
203	3300005330	Ga0070690_100255661	Ga0070690_1002556612	218
204	3300005336	Ga0070680_100015879	Ga0070680_1000158791	218
205	3300005340	Ga0070689_100000066	Ga0070689_10000006623	218
206	3300005340	Ga0070689_100013687	Ga0070689_1000136875	218
207	3300005340	Ga0070689_100499628	Ga0070689_1004996282	218
208	3300005341	Ga0070691_10098550	Ga0070691_100985502	218
209	3300005345	Ga0070692_10065240	Ga0070692_100652402	218
210	3300005365	Ga0070688_100000114	Ga0070688_1000001142	218
211	3300005438	Ga0070701_10000020	Ga0070701_1000002021	218
212	3300005441	Ga0070700_100000818	Ga0070700_10000081814	218
213	3300005441	Ga0070700_100174157	Ga0070700_1001741573	218
214	3300005444	Ga0070694_100131611	Ga0070694_1001316112	218
215	3300005459	Ga0068867_100010555	Ga0068867_1000105552	218
216	3300005466	Ga0070685_10000069	Ga0070685_1000006948	218
217	3300005467	Ga0070706_100046137	Ga0070706_1000461371	218
218	3300005468	Ga0070707_100000174	Ga0070707_10000017458	218
219	3300005471	Ga0070698_100055324	Ga0070698_1000553243	218
220	3300005518	Ga0070699_100025037	Ga0070699_1000250374	218
221	3300005518	Ga0070699_100054256	Ga0070699_1000542562	218
222	3300005536	Ga0070697_100006083	Ga0070697_1000060836	218
223	3300005536	Ga0070697_100009078	Ga0070697_1000090786	218
224	3300005536	Ga0070697_100384266	Ga0070697_1003842661	218
225	3300005544	Ga0070686_100000100	Ga0070686_10000010019	218
226	3300005545	Ga0070695_100017152	Ga0070695_1000171523	218
227	3300005546	Ga0070696_100001020	Ga0070696_10000102023	218
228	3300005546	Ga0070696_100171976	Ga0070696_1001719762	218
229	3300005549	Ga0070704_100059758	Ga0070704_1000597582	218
230	3300005617	Ga0068859_100000797	Ga0068859_10000079734	218
231	3300005617	Ga0068859_100314500	Ga0068859_1003145002	218
232	3300006844	Ga0075428_101342255	Ga0075428_1013422551	218
233	3300006846	Ga0075430_100120701	Ga0075430_1001207012	218
234	3300006847	Ga0075431_100752293	Ga0075431_1007522931	218
235	3300006852	Ga0075433_10073129	Ga0075433_100731292	218
236	3300006880	Ga0075429_100886570	Ga0075429_1008865701	218
237	3300006931	Ga0097620_100000797	Ga0097620_10000079734	218
238	3300006931	Ga0097620_100314511	Ga0097620_1003145112	218
239	3300009147	Ga0114129_10698086	Ga0114129_106980862	218
240	3300009148	Ga0105243_10621152	Ga0105243_106211521	218
241	3300009148	Ga0105243_10746354	Ga0105243_107463542	218
242	3300009176	Ga0105242_10022908	Ga0105242_100229084	218
243	3300009177	Ga0105248_10000910	Ga0105248_1000091018	218
244	3300013308	Ga0157375_10681122	Ga0157375_106811222	218
245	3300014326	Ga0157380_10029960	Ga0157380_100299601	218
246	3300025910	Ga0207684_10039479	Ga0207684_100394791	218
247	3300025910	Ga0207684_10367547	Ga0207684_103675471	218
248	3300025917	Ga0207660_10016768	Ga0207660_100167683	218
249	3300025922	Ga0207646_10000002	Ga0207646_10000002207	218
250	3300025936	Ga0207670_10000098	Ga0207670_1000009820	218
251	3300025936	Ga0207670_10006458	Ga0207670_100064583	218
252	3300025941	Ga0207711_10005850	Ga0207711_100058508	218
253	3300026075	Ga0207708_10015027	Ga0207708_100150272	218
254	3300026088	Ga0207641_10037514	Ga0207641_100375145	218
255	3300026089	Ga0207648_10001721	Ga0207648_100017212	218
256	3300027617	Ga0210002_1047157	Ga0210002_10471571	218
257	3300027717	Ga0209998_10017197	Ga0209998_100171972	218
258	3300027876	Ga0209974_10029023	Ga0209974_100290232	218
259	3300027876	Ga0209974_10063014	Ga0209974_100630142	218
260	3300028380	Ga0268265_10861719	Ga0268265_108617192	218
261	3300028577	Ga0265318_10006061	Ga0265318_100060615	218
262	3300044673	Ga0453683_0152319	Ga0453683_0152319_190_849	218
263	3300045051	Ga0451576_0076318	Ga0451576_0076318_29_688	218
264	3300045051	Ga0451576_0101652	Ga0451576_0101652_608_1276	218
265	3300049568	Ga0501031_0000180	Ga0501031_0000180_10484_11146	218
266	3300049568	Ga0501031_0005414	Ga0501031_0005414_7045_7719	218
267	3300049572	Ga0501036_0045620	Ga0501036_0045620_225_899	218
268	3300049572	Ga0501036_0847867	Ga0501036_0847867_36_698	218
269	3300049574	Ga0501038_0016430	Ga0501038_0016430_5416_6090	218
270	3300049575	Ga0501039_0000834	Ga0501039_0000834_3388_4062	218
271	3300049575	Ga0501039_0000919	Ga0501039_0000919_10450_11112	218
272	3300049576	Ga0501040_0003533	Ga0501040_0003533_6558_7232	218
273	3300049576	Ga0501040_0036594	Ga0501040_0036594_106_768	218
274	3300049577	Ga0501041_0000481	Ga0501041_0000481_16641_17315	218
275	3300049578	Ga0501042_0000164	Ga0501042_0000164_2372_3046	218
276	3300049578	Ga0501042_0031091	Ga0501042_0031091_1464_2126	218
277	3300049579	Ga0501043_0048992	Ga0501043_0048992_745_1419	218
278	3300049580	Ga0501046_0002388	Ga0501046_0002388_10525_11187	218
279	3300049580	Ga0501046_0003725	Ga0501046_0003725_7051_7725	218
280	3300049582	Ga0501048_0001626	Ga0501048_0001626_14195_14869	218
281	3300049587	Ga0501071_0038595	Ga0501071_0038595_1995_2669	218
282	3300049587	Ga0501071_0052916	Ga0501071_0052916_592_1272	218
283	3300049588	Ga0501072_0440431	Ga0501072_0440431_199_879	218
284	3300049591	Ga0501075_0093869	Ga0501075_0093869_677_1351	218
285	3300049592	Ga0501076_0020223	Ga0501076_0020223_3149_3823	218
286	3300049592	Ga0501076_0304192	Ga0501076_0304192_145_825	218
287	3300049593	Ga0501077_0081064	Ga0501077_0081064_739_1419	218
288	3300049593	Ga0501077_0428857	Ga0501077_0428857_72_746	218
289	3300049741	Ga0501079_0012495	Ga0501079_0012495_4969_5649	218
290	3300049741	Ga0501079_0019443	Ga0501079_0019443_4067_4741	218
291	3300049743	Ga0501081_0170750	Ga0501081_0170750_677_1351	218
292	3300049822	Ga0501035_0003730	Ga0501035_0003730_7271_7945	218
293	3300049822	Ga0501035_0020689	Ga0501035_0020689_4481_5143	218
294	3300050507	nmdc:mga05p37_592468_c1	nmdc:mga05p37_592468_c1_165_827	218
295	3300050509	nmdc:mga0qj67_324046_c1	nmdc:mga0qj67_324046_c1_309_971	218
296	3300054114	Ga0501084_0312913	Ga0501084_0312913_420_1094	218
297	3300060353	Ga0501082_0157448	Ga0501082_0157448_806_1480	218
298	3300013296	Ga0157374_10334043	Ga0157374_103340432	219
299	3300050510	nmdc:mga06r32_81312_c1	nmdc:mga06r32_81312_c1_1868_2533	219
300	3300049681	Ga0501251_000290	Ga0501251_000290_548_1228	226
301	3300049652	Ga0501202_002220	Ga0501202_002220_183_872	229
302	3300005937	Ga0081455_10000786	Ga0081455_1000078625	230
303	3300049568	Ga0501031_0021701	Ga0501031_0021701_1671_2363	230
304	3300049572	Ga0501036_0113453	Ga0501036_0113453_1120_1812	230
305	3300049576	Ga0501040_0011021	Ga0501040_0011021_3020_3712	230
306	3300049577	Ga0501041_0229934	Ga0501041_0229934_202_894	230
307	3300049580	Ga0501046_0235579	Ga0501046_0235579_315_1007	230
308	3300049582	Ga0501048_0058909	Ga0501048_0058909_1749_2441	230
309	3300049584	Ga0501068_0401912	Ga0501068_0401912_154_846	230
310	3300049587	Ga0501071_0051850	Ga0501071_0051850_1562_2254	230
311	3300049592	Ga0501076_0038758	Ga0501076_0038758_2835_3545	230
312	3300049741	Ga0501079_0335315	Ga0501079_0335315_357_1049	230
313	3300049742	Ga0501080_0085095	Ga0501080_0085095_266_976	230
314	3300049743	Ga0501081_0108341	Ga0501081_0108341_1186_1878	230
315	3300049744	Ga0501083_0055564	Ga0501083_0055564_329_1039	230
316	3300049824	Ga0501045_0409737	Ga0501045_0409737_284_976	230
317	3300060353	Ga0501082_0103840	Ga0501082_0103840_446_1138	230
318	3300061734	Ga0530510_0031102	Ga0530510_0031102_1797_2507	230
319	3300061734	Ga0530510_0363815	Ga0530510_0363815_83_775	230
320	3300001990	JGI24737J22298_10035592	JGI24737J22298_100355922	231
321	3300003371	JGI26145J50221_1000622	JGI26145J50221_10006223	231
322	3300004803	Ga0058862_12494334	Ga0058862_124943341	231
323	3300005293	Ga0065715_10343468	Ga0065715_103434682	231
324	3300005295	Ga0065707_10082920	Ga0065707_100829209	231
325	3300005328	Ga0070676_10000208	Ga0070676_1000020820	231
326	3300005329	Ga0070683_100013326	Ga0070683_1000133269	231
327	3300005330	Ga0070690_100053293	Ga0070690_1000532933	231
328	3300005331	Ga0070670_100035231	Ga0070670_1000352312	231
329	3300005333	Ga0070677_10033528	Ga0070677_100335282	231
330	3300005334	Ga0068869_100044072	Ga0068869_1000440722	231
331	3300005335	Ga0070666_10093743	Ga0070666_100937431	231
332	3300005336	Ga0070680_100014057	Ga0070680_1000140574	231
333	3300005338	Ga0068868_100003923	Ga0068868_1000039233	231
334	3300005339	Ga0070660_100155336	Ga0070660_1001553362	231
335	3300005340	Ga0070689_100027407	Ga0070689_1000274072	231
336	3300005340	Ga0070689_100166053	Ga0070689_1001660532	231
337	3300005341	Ga0070691_10000458	Ga0070691_100004583	231
338	3300005343	Ga0070687_100007886	Ga0070687_1000078862	231
339	3300005343	Ga0070687_100014961	Ga0070687_1000149611	231
340	3300005344	Ga0070661_100059011	Ga0070661_1000590113	231
341	3300005344	Ga0070661_100162922	Ga0070661_1001629221	231
342	3300005345	Ga0070692_10052047	Ga0070692_100520472	231
343	3300005353	Ga0070669_100001454	Ga0070669_1000014546	231
344	3300005354	Ga0070675_100022925	Ga0070675_1000229254	231
345	3300005356	Ga0070674_100002716	Ga0070674_1000027166	231
346	3300005364	Ga0070673_100003965	Ga0070673_1000039656	231
347	3300005365	Ga0070688_100003042	Ga0070688_1000030421	231
348	3300005366	Ga0070659_100045053	Ga0070659_1000450533	231
349	3300005367	Ga0070667_100044367	Ga0070667_1000443673	231
350	3300005438	Ga0070701_10083380	Ga0070701_100833803	231
351	3300005441	Ga0070700_100006314	Ga0070700_1000063144	231
352	3300005444	Ga0070694_100085689	Ga0070694_1000856893	231
353	3300005456	Ga0070678_100002436	Ga0070678_1000024363	231
354	3300005457	Ga0070662_100027204	Ga0070662_1000272042	231
355	3300005458	Ga0070681_10000949	Ga0070681_100009492	231
356	3300005459	Ga0068867_100001096	Ga0068867_10000109612	231
357	3300005530	Ga0070679_100086185	Ga0070679_1000861853	231
358	3300005543	Ga0070672_100014728	Ga0070672_1000147282	231
359	3300005543	Ga0070672_100018616	Ga0070672_1000186161	231
360	3300005544	Ga0070686_100112019	Ga0070686_1001120193	231
361	3300005544	Ga0070686_100152750	Ga0070686_1001527502	231
362	3300005545	Ga0070695_100161371	Ga0070695_1001613712	231
363	3300005546	Ga0070696_100003911	Ga0070696_1000039115	231
364	3300005548	Ga0070665_100011203	Ga0070665_1000112032	231
365	3300005549	Ga0070704_100012684	Ga0070704_1000126844	231
366	3300005564	Ga0070664_100000584	Ga0070664_10000058418	231
367	3300005564	Ga0070664_100029223	Ga0070664_1000292233	231
368	3300005577	Ga0068857_100020770	Ga0068857_1000207704	231
369	3300005578	Ga0068854_100360819	Ga0068854_1003608192	231
370	3300005719	Ga0068861_100418324	Ga0068861_1004183242	231
371	3300005843	Ga0068860_100033522	Ga0068860_1000335225	231
372	3300005844	Ga0068862_100018207	Ga0068862_1000182075	231
373	3300006058	Ga0075432_10000036	Ga0075432_100000363	231
374	3300006194	Ga0075427_10008727	Ga0075427_100087272	231
375	3300006237	Ga0097621_100050861	Ga0097621_1000508612	231
376	3300006237	Ga0097621_100185432	Ga0097621_1001854322	231
377	3300006358	Ga0068871_100142571	Ga0068871_1001425712	231
378	3300006844	Ga0075428_100047540	Ga0075428_1000475403	231
379	3300006846	Ga0075430_100006133	Ga0075430_1000061335	231
380	3300006847	Ga0075431_100002174	Ga0075431_1000021742	231
381	3300006852	Ga0075433_10034668	Ga0075433_100346682	231
382	3300006871	Ga0075434_100025831	Ga0075434_1000258314	231
383	3300006880	Ga0075429_100001236	Ga0075429_10000123616	231
384	3300006880	Ga0075429_100018761	Ga0075429_1000187613	231
385	3300006880	Ga0075429_100323505	Ga0075429_1003235052	231
386	3300006881	Ga0068865_100061183	Ga0068865_1000611832	231
387	3300006914	Ga0075436_100025325	Ga0075436_1000253253	231
388	3300007076	Ga0075435_100015728	Ga0075435_1000157284	231
389	3300007076	Ga0075435_100120978	Ga0075435_1001209782	231
390	3300009147	Ga0114129_10018292	Ga0114129_100182924	231
391	3300009147	Ga0114129_10094153	Ga0114129_100941535	231
392	3300009148	Ga0105243_10000238	Ga0105243_1000023825	231
393	3300009176	Ga0105242_10001243	Ga0105242_1000124314	231
394	3300013296	Ga0157374_10064849	Ga0157374_100648492	231
395	3300025893	Ga0207682_10011353	Ga0207682_100113531	231
396	3300025898	Ga0207692_10100998	Ga0207692_101009983	231
397	3300025901	Ga0207688_10016869	Ga0207688_100168694	231
398	3300025903	Ga0207680_10065528	Ga0207680_100655282	231
399	3300025907	Ga0207645_10000472	Ga0207645_1000047230	231
400	3300025912	Ga0207707_10223182	Ga0207707_102231823	231
401	3300025917	Ga0207660_10004716	Ga0207660_100047164	231
402	3300025918	Ga0207662_10001208	Ga0207662_100012089	231
403	3300025918	Ga0207662_10001387	Ga0207662_100013871	231
404	3300025919	Ga0207657_10026122	Ga0207657_100261224	231
405	3300025920	Ga0207649_10102270	Ga0207649_101022703	231
406	3300025920	Ga0207649_10138219	Ga0207649_101382193	231
407	3300025921	Ga0207652_10063414	Ga0207652_100634143	231
408	3300025923	Ga0207681_10078341	Ga0207681_100783412	231
409	3300025925	Ga0207650_10028346	Ga0207650_100283463	231
410	3300025926	Ga0207659_10070962	Ga0207659_100709623	231
411	3300025932	Ga0207690_10041191	Ga0207690_100411913	231
412	3300025933	Ga0207706_10001209	Ga0207706_1000120923	231
413	3300025936	Ga0207670_10069318	Ga0207670_100693182	231
414	3300025936	Ga0207670_10121442	Ga0207670_101214423	231
415	3300025937	Ga0207669_10000358	Ga0207669_1000035816	231
416	3300025938	Ga0207704_10022133	Ga0207704_100221333	231
417	3300025940	Ga0207691_10000555	Ga0207691_1000055538	231
418	3300025940	Ga0207691_10102607	Ga0207691_101026073	231
419	3300025942	Ga0207689_10003806	Ga0207689_1000380614	231
420	3300025944	Ga0207661_10507493	Ga0207661_105074932	231
421	3300025945	Ga0207679_10002301	Ga0207679_100023016	231
422	3300025945	Ga0207679_10003057	Ga0207679_1000305710	231
423	3300025949	Ga0207667_10191581	Ga0207667_101915813	231
424	3300025960	Ga0207651_10003023	Ga0207651_100030234	231
425	3300025972	Ga0207668_10001671	Ga0207668_100016714	231
426	3300025981	Ga0207640_10011726	Ga0207640_100117263	231
427	3300025986	Ga0207658_10011910	Ga0207658_100119108	231
428	3300026023	Ga0207677_10072678	Ga0207677_100726782	231
429	3300026075	Ga0207708_10003299	Ga0207708_100032999	231
430	3300026089	Ga0207648_10000543	Ga0207648_1000054325	231
431	3300026116	Ga0207674_10029412	Ga0207674_100294125	231
432	3300026118	Ga0207675_100096568	Ga0207675_1000965682	231
433	3300026121	Ga0207683_10001107	Ga0207683_1000110710	231
434	3300027252	Ga0209973_1000627	Ga0209973_10006274	231
435	3300027360	Ga0209969_1000008	Ga0209969_100000825	231
436	3300027364	Ga0209967_1000144	Ga0209967_10001444	231
437	3300027378	Ga0209981_1000003	Ga0209981_100000325	231
438	3300027395	Ga0209996_1000058	Ga0209996_10000586	231
439	3300027462	Ga0210000_1000024	Ga0210000_100002418	231
440	3300027471	Ga0209995_1000087	Ga0209995_10000876	231
441	3300027526	Ga0209968_1000019	Ga0209968_100001916	231
442	3300027526	Ga0209968_1036060	Ga0209968_10360601	231
443	3300027543	Ga0209999_1000055	Ga0209999_10000558	231
444	3300027552	Ga0209982_1000541	Ga0209982_10005414	231
445	3300027552	Ga0209982_1028476	Ga0209982_10284761	231
446	3300027614	Ga0209970_1000013	Ga0209970_100001318	231
447	3300027617	Ga0210002_1000024	Ga0210002_100002412	231
448	3300027665	Ga0209983_1000253	Ga0209983_10002539	231
449	3300027682	Ga0209971_1000232	Ga0209971_10002327	231
450	3300027695	Ga0209966_1000331	Ga0209966_100033113	231
451	3300027717	Ga0209998_10000094	Ga0209998_1000009425	231
452	3300027717	Ga0209998_10010297	Ga0209998_100102973	231
453	3300027876	Ga0209974_10000076	Ga0209974_1000007624	231
454	3300027876	Ga0209974_10001696	Ga0209974_1000169610	231
455	3300027907	Ga0207428_10000529	Ga0207428_1000052923	231
456	3300028379	Ga0268266_10196812	Ga0268266_101968122	231
457	3300028380	Ga0268265_10037045	Ga0268265_100370453	231
458	3300028381	Ga0268264_10197119	Ga0268264_101971192	231
459	3300031548	Ga0307408_100129805	Ga0307408_1001298053	231
460	3300031995	Ga0307409_100205553	Ga0307409_1002055533	231
461	3300032004	Ga0307414_10050348	Ga0307414_100503482	231
462	3300032005	Ga0307411_10117509	Ga0307411_101175093	231
463	3300032126	Ga0307415_100300003	Ga0307415_1003000032	231
464	3300035241	Ga0373961_0025237	Ga0373961_0025237_567_1262	231
465	3300035691	Ga0373931_0427214	Ga0373931_0427214_52_753	231
466	3300041405	Ga0439438_015089	Ga0439438_015089_767_1462	231
467	3300042001	Ga0439441_011852	Ga0439441_011852_66_761	231
468	3300042004	Ga0439445_0032238	Ga0439445_0032238_328_1023	231
469	3300042006	Ga0439432_018382	Ga0439432_018382_764_1459	231
470	3300042008	Ga0439450_000289	Ga0439450_000289_3369_4064	231
471	3300042010	Ga0439452_012134	Ga0439452_012134_1521_2216	231
472	3300042015	Ga0439462_0011814	Ga0439462_0011814_1453_2148	231
473	3300042016	Ga0439463_049351	Ga0439463_049351_173_871	231
474	3300042126	Ga0450888_005211	Ga0450888_005211_632_1327	231
475	3300042142	Ga0450905_015836	Ga0450905_015836_206_901	231
476	3300042435	Ga0439434_0003138	Ga0439434_0003138_10_705	231
477	3300042439	Ga0439464_0053663	Ga0439464_0053663_340_1035	231
478	3300042461	Ga0439460_0019607	Ga0439460_0019607_407_1102	231
479	3300042461	Ga0439460_0028323	Ga0439460_0028323_813_1508	231
480	3300045051	Ga0451576_0005198	Ga0451576_0005198_10190_10885	231
481	3300045051	Ga0451576_0021687	Ga0451576_0021687_4464_5159	231
482	3300045051	Ga0451576_0206586	Ga0451576_0206586_1215_1970	231
483	3300048915	Ga0496112_0650879	Ga0496112_0650879_173_868	231
484	3300049513	Ga0501290_000059	Ga0501290_000059_1683_2378	231
485	3300049514	Ga0501291_000488	Ga0501291_000488_3288_3983	231
486	3300049514	Ga0501291_037816	Ga0501291_037816_83_778	231
487	3300049515	Ga0501292_000129	Ga0501292_000129_10193_10888	231
488	3300049517	Ga0501294_001147	Ga0501294_001147_314_1009	231
489	3300049518	Ga0501295_000527	Ga0501295_000527_2442_3137	231
490	3300049519	Ga0501296_000322	Ga0501296_000322_2619_3314	231
491	3300049520	Ga0501297_006586	Ga0501297_006586_414_1109	231
492	3300049521	Ga0501298_014650	Ga0501298_014650_532_1227	231
493	3300049522	Ga0501299_000048	Ga0501299_000048_2305_3000	231
494	3300049523	Ga0501300_000939	Ga0501300_000939_900_1595	231
495	3300049578	Ga0501042_0495586	Ga0501042_0495586_16_711	231
496	3300049591	Ga0501075_0349573	Ga0501075_0349573_361_1074	231
497	3300049651	Ga0501201_002201	Ga0501201_002201_731_1426	231
498	3300049654	Ga0501207_002773	Ga0501207_002773_1365_2060	231
499	3300049660	Ga0501216_026863	Ga0501216_026863_75_770	231
500	3300049661	Ga0501217_006804	Ga0501217_006804_788_1483	231
501	3300049665	Ga0501227_054178	Ga0501227_054178_144_839	231
502	3300049666	Ga0501228_000969	Ga0501228_000969_1263_1958	231
503	3300049667	Ga0501230_003655	Ga0501230_003655_181_876	231
504	3300049668	Ga0501233_001024	Ga0501233_001024_2326_3021	231
505	3300049669	Ga0501235_005843	Ga0501235_005843_209_904	231
506	3300049670	Ga0501236_002097	Ga0501236_002097_591_1286	231
507	3300049672	Ga0501239_002111	Ga0501239_002111_427_1122	231
508	3300049675	Ga0501243_001231	Ga0501243_001231_818_1513	231
509	3300049676	Ga0501246_000121	Ga0501246_000121_1969_2664	231
510	3300049679	Ga0501249_005735	Ga0501249_005735_1410_2105	231
511	3300049682	Ga0501252_003336	Ga0501252_003336_760_1455	231
512	3300049687	Ga0501258_000856	Ga0501258_000856_843_1538	231
513	3300049690	Ga0501261_024892	Ga0501261_024892_59_754	231
514	3300049703	Ga0501219_001566	Ga0501219_001566_291_986	231
515	3300049704	Ga0501221_002583	Ga0501221_002583_1955_2650	231
516	3300049705	Ga0501225_0044852	Ga0501225_0044852_181_876	231
517	3300049707	Ga0501234_000290	Ga0501234_000290_2294_2989	231
518	3300049708	Ga0501245_002169	Ga0501245_002169_1367_2062	231
519	3300049757	Ga0501232_002905	Ga0501232_002905_676_1371	231
520	3300049760	Ga0501263_032821	Ga0501263_032821_20_715	231
521	3300049761	Ga0501264_000674	Ga0501264_000674_3806_4501	231
522	3300049762	Ga0501265_000090	Ga0501265_000090_140_835	231
523	3300049763	Ga0501266_001401	Ga0501266_001401_96_791	231
524	3300049765	Ga0501268_005185	Ga0501268_005185_659_1354	231
525	3300049767	Ga0501270_003400	Ga0501270_003400_621_1316	231
526	3300049770	Ga0501273_006029	Ga0501273_006029_549_1244	231
527	3300049772	Ga0501275_001141	Ga0501275_001141_1440_2135	231
528	3300049773	Ga0501276_000898	Ga0501276_000898_1078_1773	231
529	3300049775	Ga0501279_005900	Ga0501279_005900_319_1014	231
530	3300049779	Ga0501283_004101	Ga0501283_004101_1221_1916	231
531	3300049853	Ga0501226_002731	Ga0501226_002731_1402_2097	231
532	3300050510	nmdc:mga06r32_965086_c1	nmdc:mga06r32_965086_c1_72_767	231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

32

144

0.97 PF00196

GerE

Bacterial regulatory proteins, luxR family

178

234

0.96 PF08281

Sigma70_r4_2

Sigma-70, region 4

178

222

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4wul-assembly1.cif.gz_A	crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna	0.98	173	230
4wsz-assembly1.cif.gz_B	crystal structure of the dna binding domains of wild type liar from e. faecalis	0.972	171	230
4wsz-assembly1.cif.gz_A	crystal structure of the dna binding domains of wild type liar from e. faecalis	0.9712	171	230
4wu4-assembly1.cif.gz_A	crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna	0.9687	171	230
3ulq-assembly1.cif.gz_B	crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain	0.9686	173	224

ID	Description	Score	Start	End	Superfamily
3ulqB00	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9686	173	224	1.10.10.10
6ekhY00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9613	20	138	3.40.50.2300
4tmyB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9588	22	138	3.40.50.2300
4if4C02	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.958	173	229	1.10.10.10
3eulC00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9574	22	139	3.40.50.2300

ID	Description	Score	Start	End	GO Terms
AF-A0A5J4KWZ3-F1-model_v4	Response regulatory domain-containing protein	0.9728	18	115	GO:0000160 GO:0003677
AF-A0A4Y1ZA51-F1-model_v4	DNA-binding response regulator, LuxR family	0.9696	22	98	GO:0000160 GO:0003677
AF-A0A7S8FEZ6-F1-model_v4	histidine kinase (EC 2.7.13.3)	0.9673	21	138	GO:0000155 GO:0005524 GO:0016020 GO:0046983
AF-A0A701W0F1-F1-model_v4	Response regulator	0.9667	21	106	GO:0000160 GO:0003677
AF-A0A2M7A5F5-F1-model_v4	Two-component system response regulator	0.9647	48	139	GO:0000160

Feature Viewer

pLDDT	pTM	Quality
76.95	0.55	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F460310

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00072

Response_reg

Response regulator receiver domain

32

144

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

178

234

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

178

222

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map