F460166

General Info

Members Datasets Scaffolds Average Seq Length
531 353 510 186

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0074847|Ga0451577_0074847_2138_2683
Length 181
Sequence MRLKEKYQKEIVKQLEEKIGYKNDMLVPRLTKVVLNVGFGAHSKEKEYIASVTRGLVSISGQKPVMTLAKQSVSAFKIREGMVIGAKVTLRGNRMYDFVEKLVGITFPRVRDFRGISEKGIDNKGNMTIGFKEHVAFPEIRVEDIDNIYGLEVCLSTTAKTKEEGLELFRAFGFPFKKDSK

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
6 2643221583 Caulobacter sp. Root655 Isolate Unclassified
7 2643221584 Caulobacter sp. Root656 Isolate Unclassified
8 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
9 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
10 2643221640 Caulobacter sp. Root342 Isolate Unclassified
11 2643221642 Caulobacter sp. Root343 Isolate Unclassified
12 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
13 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
14 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
15 2818991435 Caulobacter henricii 536 Isolate Unclassified
16 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
17 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
18 2849560528 Caulobacter zeae 410 Isolate Unclassified
19 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
20 2851153111 Caulobacter radicis 736 Isolate Unclassified
21 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
22 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
23 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
188 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
232 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
233 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
234 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
235 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
236 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
239 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
240 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
241 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
259 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
260 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
280 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
281 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
286 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
287 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
307 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
318 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
326 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
327 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
331 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
332 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
333 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
334 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
335 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
336 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
337 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
338 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
341 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
342 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
343 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
344 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
345 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
346 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.53
Metatranscriptomes 4.52
Isolates 3.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.68
Nodule 0
Rhizoplane 2.45
Rhizosphere 79.85
Stem 0
Stem Tuber 0
Unclassified 6.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1004576 3300000531 Bacteria 783
2 Ga0006777J48905_1080577 3300003308 Bacteria 2583
3 Ga0007427J51700_108234 3300003559 Bacteria 6325
4 Ga0032354_1028809 3300003693 Bacteria 1476
5 Ga0055526_1035022 3300003771 Bacteria 1361
6 Ga0055537_1001243 3300003773 Bacteria 10661
7 Ga0055524_1030115 3300003775 Bacteria 1588
8 Ga0055534_1036957 3300003784 Bacteria 732
9 Ga0055528_1008934 3300003790 Bacteria 4234
10 Ga0055528_1029848 3300003790 Bacteria 1462
11 Ga0055530_10021003 3300003791 Bacteria 1935
12 Ga0055531_10018518 3300003794 Bacteria 2869
13 Ga0055543_1012790 3300004625 Bacteria 1675
14 Ga0055543_1026803 3300004625 Bacteria 1023
15 Ga0058861_11906893 3300004800 Bacteria 992
16 Ga0065165_1002762 3300005262 Bacteria 13954
17 Ga0065714_10192749 3300005288 Bacteria 920
18 Ga0065704_10522003 3300005289 Bacteria 653
19 Ga0070658_10233633 3300005327 Bacteria 1557
20 Ga0070683_100527371 3300005329 Bacteria 1129
21 Ga0070670_100021899 3300005331 Bacteria 5499
22 Ga0070677_10218795 3300005333 Bacteria 929
23 Ga0068869_100545302 3300005334 Bacteria 973
24 Ga0068869_100649286 3300005334 Bacteria 895
25 Ga0070666_10124941 3300005335 Bacteria 1786
26 Ga0070666_10233761 3300005335 Bacteria 1299
27 Ga0070680_100006095 3300005336 Bacteria 9137
28 Ga0070680_100116911 3300005336 Bacteria 2223
29 Ga0070682_100479853 3300005337 Bacteria 959
30 Ga0070660_100548371 3300005339 Bacteria 964
31 Ga0070689_100248082 3300005340 Bacteria 1468
32 Ga0070689_100614119 3300005340 Bacteria 943
33 Ga0070689_101052835 3300005340 Bacteria 726
34 Ga0070687_100199134 3300005343 Bacteria 1212
35 Ga0070661_100120510 3300005344 Bacteria 1965
36 Ga0070668_100023377 3300005347 Bacteria 4674
37 Ga0070668_100025277 3300005347 Bacteria 4501
38 Ga0070668_100237564 3300005347 Bacteria 1508
39 Ga0070669_100051464 3300005353 Bacteria 3010
40 Ga0070675_100597560 3300005354 Bacteria 1001
41 Ga0070671_100184470 3300005355 Bacteria 1767
42 Ga0070671_100313772 3300005355 Bacteria 1336
43 Ga0070674_100404900 3300005356 Bacteria 1116
44 Ga0070673_100258556 3300005364 Bacteria 1520
45 Ga0070673_100590962 3300005364 Bacteria 1012
46 Ga0070659_100018511 3300005366 Bacteria 5255
47 Ga0070659_100131707 3300005366 Bacteria 2031
48 Ga0070667_100015939 3300005367 Bacteria 6218
49 Ga0070667_100214807 3300005367 Bacteria 1710
50 Ga0070705_100208381 3300005440 Bacteria 1346
51 Ga0070708_100056794 3300005445 Bacteria 3483
52 Ga0070663_100067254 3300005455 Bacteria 2598
53 Ga0070678_100258005 3300005456 Bacteria 1464
54 Ga0070662_100014250 3300005457 Bacteria 5306
55 Ga0070681_10040928 3300005458 Bacteria 4642
56 Ga0070681_10042882 3300005458 Bacteria 4533
57 Ga0070681_10571033 3300005458 Bacteria 1045
58 Ga0070706_100156537 3300005467 Bacteria 2127
59 Ga0070706_100257817 3300005467 Bacteria 1628
60 Ga0070707_100012141 3300005468 Bacteria 8041
61 Ga0070707_100142997 3300005468 Bacteria 2328
62 Ga0070707_100932845 3300005468 Bacteria 833
63 Ga0070698_100023930 3300005471 Bacteria 6377
64 Ga0070698_100166769 3300005471 Bacteria 2145
65 Ga0070679_100042115 3300005530 Bacteria 4547
66 Ga0070679_100351539 3300005530 Bacteria 1421
67 Ga0070679_100631932 3300005530 Bacteria 1014
68 Ga0070697_100200597 3300005536 Bacteria 1696
69 Ga0068853_100184845 3300005539 Bacteria 1891
70 Ga0068853_100387108 3300005539 Bacteria 1307
71 Ga0070672_100576323 3300005543 Bacteria 979
72 Ga0070665_100000121 3300005548 Bacteria 147683
73 Ga0070665_100071556 3300005548 Bacteria 3474
74 Ga0070665_100166338 3300005548 Bacteria 2207
75 Ga0070704_100022859 3300005549 Bacteria 4074
76 Ga0068855_100018024 3300005563 Bacteria 8484
77 Ga0068855_100067956 3300005563 Bacteria 4150
78 Ga0068855_100073551 3300005563 Bacteria 3970
79 Ga0068855_100074983 3300005563 Bacteria 3928
80 Ga0068855_100134274 3300005563 Bacteria 2824
81 Ga0068855_100261493 3300005563 Bacteria 1927
82 Ga0068855_100684523 3300005563 Bacteria 1099
83 Ga0070664_100064671 3300005564 Bacteria 3120
84 Ga0070664_100274045 3300005564 Bacteria 1520
85 Ga0070664_100636453 3300005564 Bacteria 991
86 Ga0068857_100344175 3300005577 Bacteria 1380
87 Ga0068854_100152680 3300005578 Bacteria 1782
88 Ga0068852_100592161 3300005616 Bacteria 1112
89 Ga0068852_100670611 3300005616 Bacteria 1045
90 Ga0068859_100040039 3300005617 Bacteria 4703
91 Ga0068864_100070364 3300005618 Bacteria 3044
92 Ga0068864_101221920 3300005618 Bacteria 750
93 Ga0068861_100649074 3300005719 Bacteria 975
94 Ga0068863_100028125 3300005841 Bacteria 5367
95 Ga0068863_100181671 3300005841 Bacteria 2019
96 Ga0068863_100364710 3300005841 Bacteria 1409
97 Ga0068858_100478536 3300005842 Bacteria 1202
98 Ga0068860_100051208 3300005843 Bacteria 3929
99 Ga0068862_100077983 3300005844 Bacteria 2870
100 Ga0068862_100094860 3300005844 Bacteria 2602
101 Ga0068862_100260426 3300005844 Bacteria 1583
102 Ga0068862_101179497 3300005844 Bacteria 763
103 Ga0081540_1183551 3300005983 Bacteria 780
104 Ga0070717_10150923 3300006028 Bacteria 2010
105 Ga0075365_10006324 3300006038 Bacteria 6505
106 Ga0075363_100007657 3300006048 Bacteria 4981
107 Ga0075366_10086475 3300006195 Bacteria 1875
108 Ga0075370_10122046 3300006353 Bacteria 1517
109 Ga0075370_10470933 3300006353 Bacteria 757
110 Ga0068865_100031091 3300006881 Bacteria 3557
111 Ga0068865_100523855 3300006881 Bacteria 992
112 Ga0068865_100558066 3300006881 Bacteria 963
113 Ga0097620_100040040 3300006931 Bacteria 4703
114 Ga0099794_10000179 3300007265 Bacteria 23076
115 Ga0099794_10018500 3300007265 Bacteria 3125
116 Ga0105240_10000798 3300009093 Bacteria 57073
117 Ga0105240_10013835 3300009093 Bacteria 11052
118 Ga0105240_10162906 3300009093 Bacteria 2647
119 Ga0105240_10188429 3300009093 Bacteria 2427
120 Ga0105240_10458549 3300009093 Bacteria 1425
121 Ga0105240_10504234 3300009093 Bacteria 1345
122 Ga0111539_11155399 3300009094 Bacteria 899
123 Ga0105245_10505959 3300009098 Bacteria 1225
124 Ga0105245_10728966 3300009098 Bacteria 1026
125 Ga0105247_10405522 3300009101 Bacteria 972
126 Ga0105241_10163652 3300009174 Bacteria 1831
127 Ga0105242_10314107 3300009176 Bacteria 1435
128 Ga0105237_10155310 3300009545 Bacteria 2285
129 Ga0105237_11631492 3300009545 Bacteria 652
130 Ga0105238_10045873 3300009551 Bacteria 4414
131 Ga0105238_10526582 3300009551 Bacteria 1185
132 Ga0105238_10584308 3300009551 Bacteria 1124
133 Ga0105238_10605689 3300009551 Bacteria 1104
134 Ga0105249_10183418 3300009553 Bacteria 2038
135 Ga0105249_10183876 3300009553 Bacteria 2035
136 Ga0105239_10346341 3300010375 Bacteria 1677
137 Ga0105239_10544500 3300010375 Bacteria 1321
138 Ga0105239_10587410 3300010375 Bacteria 1270
139 Ga0105239_10834121 3300010375 Bacteria 1057
140 Ga0157371_10422907 3300013102 Bacteria 977
141 Ga0157370_10022671 3300013104 Bacteria 6248
142 Ga0157370_10162858 3300013104 Bacteria 2075
143 Ga0157369_10283134 3300013105 Bacteria 1726
144 Ga0157369_10931785 3300013105 Bacteria 890
145 Ga0157374_10564693 3300013296 Bacteria 1146
146 Ga0157378_10125170 3300013297 Bacteria 2373
147 Ga0157378_10772037 3300013297 Bacteria 985
148 Ga0163162_10143420 3300013306 Bacteria 2503
149 Ga0157372_10050145 3300013307 Bacteria 4644
150 Ga0157372_10708135 3300013307 Bacteria 1172
151 Ga0157375_10502592 3300013308 Bacteria 1376
152 Ga0163163_10377403 3300014325 Bacteria 1475
153 Ga0163163_10385354 3300014325 Bacteria 1459
154 Ga0163163_11290006 3300014325 Bacteria 792
155 Ga0157380_10262147 3300014326 Bacteria 1570
156 Ga0157380_10558028 3300014326 Bacteria 1125
157 Ga0157377_10115144 3300014745 Bacteria 1622
158 Ga0157379_10858339 3300014968 Bacteria 859
159 Ga0157376_10262170 3300014969 Bacteria 1620
160 Ga0157376_11420736 3300014969 Bacteria 726
161 Ga0182006_1059895 3300015261 Bacteria 1440
162 Ga0182007_10016882 3300015262 Bacteria 2682
163 Ga0163161_10049692 3300017792 Bacteria 3032
164 Ga0213872_10022498 3300021361 Bacteria 2903
165 Ga0213874_10010369 3300021377 Bacteria 2332
166 Ga0213876_10000244 3300021384 Bacteria 51875
167 Ga0213875_10063678 3300021388 Bacteria 1724
168 Ga0207425_1036708 3300025245 Bacteria 949
169 Ga0209026_1003882 3300025250 Bacteria 4706
170 Ga0209148_1007048 3300025254 Bacteria 2371
171 Ga0209565_1000925 3300025263 Bacteria 15538
172 Ga0209455_1022633 3300025272 Bacteria 1192
173 Ga0209673_1002524 3300025273 Bacteria 12545
174 Ga0209675_1002569 3300025291 Bacteria 9211
175 Ga0209676_1005783 3300025292 Bacteria 6325
176 Ga0209564_1029308 3300025295 Bacteria 1735
177 Ga0209758_1002168 3300025297 Bacteria 20636
178 Ga0209050_1000161 3300025298 Bacteria 155713
179 Ga0209050_1011548 3300025298 Bacteria 4167
180 Ga0209256_1003893 3300025299 Bacteria 9891
181 Ga0209257_1000252 3300025304 Bacteria 123718
182 Ga0209257_1000976 3300025304 Bacteria 38920
183 Ga0209257_1001464 3300025304 Bacteria 27851
184 Ga0209257_1018926 3300025304 Bacteria 2620
185 Ga0207680_10115044 3300025903 Bacteria 1751
186 Ga0207645_10298324 3300025907 Bacteria 1073
187 Ga0207705_10011901 3300025909 Bacteria 6285
188 Ga0207705_10349677 3300025909 Bacteria 1138
189 Ga0207684_10018824 3300025910 Bacteria 5907
190 Ga0207684_10189155 3300025910 Bacteria 1775
191 Ga0207684_10253009 3300025910 Bacteria 1520
192 Ga0207707_10087890 3300025912 Bacteria 2715
193 Ga0207707_10091202 3300025912 Bacteria 2663
194 Ga0207707_10093845 3300025912 Bacteria 2622
195 Ga0207695_10000575 3300025913 Bacteria 74997
196 Ga0207695_10002926 3300025913 Bacteria 24665
197 Ga0207695_10010884 3300025913 Bacteria 11075
198 Ga0207695_10261400 3300025913 Bacteria 1628
199 Ga0207695_10278839 3300025913 Bacteria 1566
200 Ga0207695_10405236 3300025913 Bacteria 1248
201 Ga0207671_10429423 3300025914 Bacteria 1051
202 Ga0207660_10000537 3300025917 Bacteria 25426
203 Ga0207660_10020945 3300025917 Bacteria 4393
204 Ga0207660_10057441 3300025917 Bacteria 2787
205 Ga0207660_10306075 3300025917 Bacteria 1266
206 Ga0207662_10137690 3300025918 Bacteria 1544
207 Ga0207657_10062953 3300025919 Bacteria 3174
208 Ga0207652_10002134 3300025921 Bacteria 16964
209 Ga0207652_10172662 3300025921 Bacteria 1940
210 Ga0207652_10209902 3300025921 Bacteria 1753
211 Ga0207652_10848765 3300025921 Bacteria 809
212 Ga0207646_10047921 3300025922 Bacteria 3831
213 Ga0207646_10172454 3300025922 Bacteria 1953
214 Ga0207681_10265954 3300025923 Bacteria 1344
215 Ga0207694_10078132 3300025924 Bacteria 2594
216 Ga0207694_10127710 3300025924 Bacteria 2035
217 Ga0207694_10260913 3300025924 Bacteria 1419
218 Ga0207694_10655797 3300025924 Bacteria 884
219 Ga0207687_10295051 3300025927 Bacteria 1304
220 Ga0207644_10077748 3300025931 Bacteria 2444
221 Ga0207690_10008937 3300025932 Bacteria 5947
222 Ga0207690_10020126 3300025932 Bacteria 4119
223 Ga0207690_10171669 3300025932 Bacteria 1625
224 Ga0207686_10287032 3300025934 Bacteria 1217
225 Ga0207686_10828929 3300025934 Bacteria 743
226 Ga0207670_10464272 3300025936 Bacteria 1023
227 Ga0207704_10118865 3300025938 Bacteria 1804
228 Ga0207704_10182039 3300025938 Bacteria 1519
229 Ga0207665_10284491 3300025939 Bacteria 1231
230 Ga0207691_10058461 3300025940 Bacteria 3507
231 Ga0207711_10001469 3300025941 Bacteria 21980
232 Ga0207711_10262862 3300025941 Bacteria 1586
233 Ga0207689_10216223 3300025942 Bacteria 1583
234 Ga0207689_10353606 3300025942 Bacteria 1221
235 Ga0207689_10400152 3300025942 Bacteria 1145
236 Ga0207679_10112251 3300025945 Bacteria 2154
237 Ga0207667_10015066 3300025949 Bacteria 8794
238 Ga0207667_10027885 3300025949 Bacteria 6139
239 Ga0207667_10052476 3300025949 Bacteria 4294
240 Ga0207667_10090996 3300025949 Bacteria 3153
241 Ga0207667_10111834 3300025949 Bacteria 2817
242 Ga0207667_10271660 3300025949 Bacteria 1733
243 Ga0207667_10775951 3300025949 Bacteria 956
244 Ga0207651_10115078 3300025960 Bacteria 2027
245 Ga0207651_10737355 3300025960 Bacteria 870
246 Ga0207712_10589183 3300025961 Bacteria 960
247 Ga0207668_10007456 3300025972 Bacteria 6507
248 Ga0207668_10009414 3300025972 Bacteria 5854
249 Ga0207640_10336329 3300025981 Bacteria 1208
250 Ga0207658_10156248 3300025986 Bacteria 1864
251 Ga0207658_10481321 3300025986 Bacteria 1103
252 Ga0207677_10372997 3300026023 Bacteria 1202
253 Ga0207703_10345430 3300026035 Bacteria 1369
254 Ga0207639_10043283 3300026041 Bacteria 3379
255 Ga0207639_10668327 3300026041 Bacteria 962
256 Ga0207639_10779429 3300026041 Bacteria 890
257 Ga0207678_10344400 3300026067 Bacteria 1285
258 Ga0207641_10076518 3300026088 Bacteria 2893
259 Ga0207641_10338847 3300026088 Bacteria 1430
260 Ga0207641_10984954 3300026088 Bacteria 839
261 Ga0207648_10243841 3300026089 Bacteria 1600
262 Ga0207648_10290341 3300026089 Bacteria 1464
263 Ga0207648_10704366 3300026089 Bacteria 936
264 Ga0207676_10243784 3300026095 Bacteria 1614
265 Ga0207674_10030807 3300026116 Bacteria 5638
266 Ga0207674_10267714 3300026116 Bacteria 1656
267 Ga0207675_100156692 3300026118 Bacteria 2170
268 Ga0207683_10319561 3300026121 Bacteria 1422
269 Ga0207698_10868870 3300026142 Bacteria 908
270 Ga0207698_11415608 3300026142 Bacteria 710
271 Ga0209999_1001367 3300027543 Bacteria 4179
272 Ga0209983_1004172 3300027665 Bacteria 3047
273 Ga0209588_1020292 3300027671 Bacteria 2081
274 Ga0209966_1000144 3300027695 Bacteria 30303
275 Ga0209998_10004274 3300027717 Bacteria 3045
276 Ga0268266_10000106 3300028379 Bacteria 175109
277 Ga0268266_10084163 3300028379 Bacteria 2777
278 Ga0268266_10355576 3300028379 Bacteria 1377
279 Ga0268266_10854051 3300028379 Bacteria 880
280 Ga0268265_10019588 3300028380 Bacteria 4706
281 Ga0268265_10100736 3300028380 Bacteria 2332
282 Ga0268264_10002325 3300028381 Bacteria 16817
283 Ga0265337_1095959 3300028556 Bacteria 807
284 Ga0265323_10010371 3300028653 Bacteria 3779
285 Ga0307517_10029956 3300028786 Bacteria 6401
286 Ga0307515_10496074 3300028794 Bacteria 832
287 Ga0307515_10510219 3300028794 Bacteria 812
288 Ga0265324_10052753 3300029957 Bacteria 1397
289 Ga0307511_10006537 3300030521 Bacteria 11736
290 Ga0265330_10000448 3300031235 Bacteria 27585
291 Ga0265330_10000630 3300031235 Bacteria 22756
292 Ga0265330_10184817 3300031235 Bacteria 882
293 Ga0265328_10022952 3300031239 Bacteria 2369
294 Ga0265325_10002701 3300031241 Bacteria 11857
295 Ga0265329_10000002 3300031242 Bacteria 121896
296 Ga0265327_10000381 3300031251 Bacteria 83617
297 Ga0265316_10000017 3300031344 Bacteria 198446
298 Ga0265316_10016358 3300031344 Bacteria 6435
299 Ga0265316_10409607 3300031344 Bacteria 976
300 Ga0307513_10002446 3300031456 Bacteria 25748
301 Ga0307513_10430701 3300031456 Bacteria 1047
302 Ga0307408_101083653 3300031548 Bacteria 742
303 Ga0265313_10019566 3300031595 Bacteria 3763
304 Ga0265314_10000273 3300031711 Bacteria 75436
305 Ga0265314_10039085 3300031711 Bacteria 3421
306 Ga0265342_10001365 3300031712 Bacteria 22838
307 Ga0265342_10329002 3300031712 Bacteria 799
308 Ga0307516_10001565 3300031730 Bacteria 31484
309 Ga0307413_10002271 3300031824 Bacteria 7767
310 Ga0307413_10189895 3300031824 Bacteria 1474
311 Ga0307406_10161829 3300031901 Bacteria 1610
312 Ga0307407_10944313 3300031903 Bacteria 664
313 Ga0307409_100528370 3300031995 Bacteria 1154
314 Ga0307416_101432627 3300032002 Bacteria 797
315 Ga0307414_10065490 3300032004 Bacteria 2593
316 Ga0307414_10117659 3300032004 Bacteria 2036
317 Ga0307414_11186768 3300032004 Bacteria 706
318 Ga0307510_10013765 3300033180 Bacteria 9588
319 Ga0307510_10438279 3300033180 Bacteria 748
320 Ga0373936_0004112 3300035113 Bacteria 5483
321 Ga0373943_0107086 3300035170 Bacteria 1470
322 Ga0373946_0106332 3300035171 Bacteria 1264
323 Ga0373955_0304760 3300035172 Bacteria 961
324 Ga0373935_0264923 3300035692 Bacteria 1206
325 Ga0373935_0333273 3300035692 Bacteria 1079
326 Ga0373927_0000479 3300035695 Bacteria 30749
327 Ga0373927_0044490 3300035695 Bacteria 2873
328 Ga0373937_0040264 3300036401 Bacteria 4259
329 Ga0373937_0579078 3300036401 Bacteria 1066
330 Ga0373925_0000023 3300037068 Bacteria 158881
331 Ga0395899_0000105 3300037312 Bacteria 146163
332 Ga0395899_0001195 3300037312 Bacteria 22830
333 Ga0395899_0025758 3300037312 Bacteria 4439
334 Ga0395899_0143516 3300037312 Bacteria 1697
335 Ga0395900_0006999 3300037418 Bacteria 11682
336 Ga0395900_0058480 3300037418 Bacteria 3968
337 Ga0395900_0100801 3300037418 Bacteria 2966
338 Ga0395898_0004322 3300037466 Bacteria 15569
339 Ga0395898_0073715 3300037466 Bacteria 3298
340 Ga0395898_0118890 3300037466 Bacteria 2531
341 Ga0395898_0489457 3300037466 Bacteria 1170
342 Ga0395905_0006270 3300037471 Bacteria 12003
343 Ga0395905_0130813 3300037471 Bacteria 2360
344 Ga0395905_0173211 3300037471 Bacteria 2027
345 Ga0395905_0198482 3300037471 Bacteria 1881
346 Ga0316581_0001366 3300037588 Bacteria 5439
347 Ga0436364_1483493 3300037853 Bacteria 5443
348 Ga0395901_0000342 3300038443 Bacteria 56754
349 Ga0395901_0658043 3300038443 Bacteria 1050
350 Ga0436365_0376847 3300039437 Bacteria 89580
351 Ga0436360_0034851 3300039438 Bacteria 2025
352 Ga0436360_0523945 3300039438 Bacteria 1107
353 Ga0436361_0356944 3300039447 Bacteria 1001
354 Ga0436361_0953537 3300039447 Bacteria 44604
355 Ga0436363_0101867 3300039450 Bacteria 3467
356 Ga0436362_0403796 3300039453 Bacteria 710
357 Ga0439461_0004190 3300041410 Bacteria 2397
358 Ga0451795_1108070 3300041456 Bacteria 3240
359 Ga0451805_122127 3300041461 Bacteria 959
360 Ga0451833_1326391 3300041491 Bacteria 1489
361 Ga0439431_0031081 3300041997 Bacteria 1326
362 Ga0439448_0164523 3300042005 Bacteria 773
363 Ga0450890_015214 3300042127 Bacteria 1012
364 Ga0439446_0004827 3300042156 Bacteria 3436
365 Ga0439434_0073528 3300042435 Bacteria 1078
366 Ga0439435_0023237 3300042436 Bacteria 1626
367 Ga0451577_0074847 3300042876 Bacteria 3020
368 Ga0453683_0072457 3300044673 Bacteria 2156
369 Ga0453683_0198527 3300044673 Bacteria 1274
370 Ga0466965_0197136 3300044683 Bacteria 1067
371 Ga0466961_0161559 3300044693 Bacteria 1396
372 Ga0466961_0347676 3300044693 Bacteria 903
373 Ga0453684_0443333 3300044712 Bacteria 1446
374 Ga0453684_0464818 3300044712 Bacteria 1406
375 Ga0466970_0276276 3300044765 Bacteria 944
376 Ga0466957_0145584 3300044842 Bacteria 1529
377 Ga0466959_0036896 3300045049 Bacteria 3611
378 Ga0451576_0189778 3300045051 Bacteria 2146
379 Ga0451576_0223680 3300045051 Bacteria 1965
380 Ga0495627_000399 3300046453 Bacteria 38947
381 Ga0495638_0035321 3300046460 Bacteria 3187
382 Ga0495638_0247712 3300046460 Bacteria 983
383 Ga0495638_0349384 3300046460 Bacteria 781
384 Ga0495650_0001571 3300046471 Bacteria 21474
385 Ga0495580_0436143 3300046472 Bacteria 880
386 Ga0495605_0073285 3300046474 Bacteria 1613
387 Ga0495584_0103560 3300046491 Bacteria 1439
388 Ga0495584_0107787 3300046491 Bacteria 1409
389 Ga0495585_0186838 3300046492 Bacteria 1062
390 Ga0495607_0080713 3300046501 Bacteria 1788
391 Ga0495583_0000650 3300046506 Bacteria 45814
392 Ga0495620_0067424 3300046515 Bacteria 1472
393 Ga0495628_0109267 3300046516 Bacteria 2128
394 Ga0495632_0041761 3300046519 Bacteria 2302
395 Ga0495663_0008611 3300046525 Bacteria 2830
396 Ga0495642_0008396 3300046528 Bacteria 3952
397 Ga0495654_0006712 3300046530 Bacteria 6511
398 Ga0495621_0010211 3300046539 Bacteria 2867
399 Ga0495621_0041413 3300046539 Bacteria 1617
400 Ga0495597_0147433 3300046542 Bacteria 967
401 Ga0495645_0201028 3300046543 Bacteria 1352
402 Ga0495656_0202473 3300046615 Bacteria 986
403 Ga0495668_0001504 3300046616 Bacteria 22287
404 Ga0495668_0049463 3300046616 Bacteria 2331
405 Ga0495668_0064267 3300046616 Bacteria 2020
406 Ga0495668_0100670 3300046616 Bacteria 1581
407 Ga0495611_0005291 3300046648 Bacteria 5527
408 Ga0495625_0001925 3300046660 Bacteria 23466
409 Ga0495625_0052545 3300046660 Bacteria 2917
410 Ga0495625_0132573 3300046660 Bacteria 1687
411 Ga0495625_0167562 3300046660 Bacteria 1468
412 Ga0495659_0002869 3300046664 Bacteria 5535
413 Ga0495659_0025307 3300046664 Bacteria 2031
414 Ga0495588_0052430 3300046674 Bacteria 2103
415 Ga0495623_0209758 3300046679 Bacteria 1116
416 Ga0495658_0304985 3300046683 Bacteria 1008
417 Ga0495669_0000371 3300046684 Bacteria 22866
418 Ga0495669_0312870 3300046684 Bacteria 757
419 Ga0495670_0037453 3300046691 Bacteria 2417
420 Ga0495670_0445491 3300046691 Bacteria 701
421 Ga0495671_0240579 3300046692 Bacteria 874
422 Ga0495660_0154465 3300046810 Bacteria 1130
423 Ga0495636_0006624 3300047318 Bacteria 4554
424 Ga0495674_0099850 3300047319 Bacteria 2471
425 Ga0495674_0589126 3300047319 Bacteria 882
426 Ga0495672_0000439 3300047320 Bacteria 49666
427 Ga0495683_0065427 3300047323 Bacteria 1793
428 Ga0495677_0183390 3300047445 Bacteria 811
429 Ga0495679_029031 3300047446 Bacteria 1807
430 Ga0495685_063236 3300047447 Bacteria 1245
431 Ga0495673_0000189 3300047469 Bacteria 99018
432 Ga0495681_0056388 3300047470 Bacteria 1828
433 Ga0495681_0076275 3300047470 Bacteria 1507
434 Ga0495686_0007469 3300047472 Bacteria 8189
435 Ga0495686_0029450 3300047472 Bacteria 3571
436 Ga0495686_0098679 3300047472 Bacteria 1764
437 Ga0496101_0023677 3300048904 Bacteria 4244
438 Ga0496101_0127092 3300048904 Bacteria 1933
439 Ga0496102_0081834 3300048905 Bacteria 2978
440 Ga0496103_0050032 3300048906 Bacteria 2585
441 Ga0496104_0162799 3300048907 Bacteria 2140
442 Ga0496106_0014990 3300048909 Bacteria 5735
443 Ga0496107_0000073 3300048910 Bacteria 48489
444 Ga0496107_0049382 3300048910 Bacteria 3032
445 Ga0496109_0080902 3300048912 Bacteria 2993
446 Ga0496110_0276694 3300048913 Bacteria 1528
447 Ga0496112_0033003 3300048915 Bacteria 5027
448 Ga0496126_0067161 3300048929 Bacteria 3204
449 Ga0501306_017130 3300049127 Bacteria 980
450 Ga0501309_044877 3300049129 Bacteria 683
451 Ga0501310_005520 3300049130 Bacteria 1300
452 Ga0501304_020739 3300049160 Bacteria 649
453 Ga0501307_005954 3300049162 Bacteria 1301
454 Ga0495678_005077 3300049459 Bacteria 7394
455 Ga0501311_003804 3300049527 Bacteria 1571
456 Ga0501320_003371 3300049536 Bacteria 1350
457 Ga0501323_002040 3300049539 Bacteria 1907
458 Ga0501323_015869 3300049539 Bacteria 955
459 Ga0501324_011699 3300049540 Bacteria 814
460 Ga0501325_011787 3300049541 Bacteria 814
461 Ga0501032_0107042 3300049569 Bacteria 1852
462 Ga0501037_0035888 3300049573 Bacteria 3653
463 Ga0501047_0252100 3300049581 Bacteria 1613
464 Ga0501257_005035 3300049686 Bacteria 2899
465 Ga0501081_0363781 3300049743 Bacteria 1067
466 Ga0501241_027104 3300049758 Bacteria 1071
467 Ga0501274_010889 3300049771 Bacteria 844
468 Ga0501035_0118771 3300049822 Bacteria 2313
469 Ga0501044_0008183 3300049823 Bacteria 11476
470 Ga0501044_0130572 3300049823 Bacteria 2506
471 Ga0501044_0304517 3300049823 Bacteria 1521
472 nmdc:mga03n38_31920_c1 3300050490 Bacteria 2227
473 nmdc:mga0k408_11918_c1 3300050493 Bacteria 4743
474 nmdc:mga0k408_176476_c1 3300050493 Bacteria 1274
475 nmdc:mga07m45_86829_c1 3300050496 Bacteria 1790
476 Ga0495619_0362106 3300053085 Bacteria 1003
477 Ga0500578_0000459 3300053086 Bacteria 49572
478 Ga0500644_0000193 3300053088 Bacteria 37831
479 Ga0500646_0022126 3300053090 Bacteria 1699
480 Ga0500566_0065996 3300053094 Bacteria 2040
481 Ga0500641_0010127 3300053096 Bacteria 3400
482 Ga0500554_011267 3300053102 Bacteria 2209
483 Ga0500556_0001077 3300053104 Bacteria 13785
484 Ga0500562_000644 3300053108 Bacteria 8433
485 Ga0500562_004235 3300053108 Bacteria 3627
486 Ga0500594_0004036 3300053118 Bacteria 3230
487 Ga0500614_026739 3300053123 Bacteria 1381
488 Ga0500618_000703 3300053125 Bacteria 19670
489 Ga0500658_0000930 3300053134 Bacteria 11933
490 Ga0500559_0001398 3300053136 Bacteria 13721
491 Ga0500577_0005365 3300053142 Bacteria 3450
492 Ga0500616_0183125 3300053153 Bacteria 941
493 Ga0500622_0000771 3300053156 Bacteria 27846
494 Ga0500622_0011085 3300053156 Bacteria 4920
495 Ga0500622_0069509 3300053156 Bacteria 1783
496 Ga0500627_0001516 3300053158 Bacteria 6534
497 Ga0500627_0133540 3300053158 Bacteria 1121
498 Ga0500611_006082 3300053727 Bacteria 1738
499 Ga0500645_002894 3300053730 Bacteria 7334
500 Ga0500645_005668 3300053730 Bacteria 4561
501 Ga0500609_000093 3300053731 Bacteria 11592
502 Ga0500661_008301 3300055283 Bacteria 1910
503 Ga0587070_084895 3300059491 Bacteria 702
504 Ga0587077_046479 3300059493 Bacteria 892
505 Ga0587086_006705 3300059507 Bacteria 1296
506 Ga0587090_105505 3300059510 Bacteria 595
507 Ga0587079_018207 3300059647 Bacteria 1228
508 Ga0587107_070100 3300059652 Bacteria 638
509 Ga0587071_002314 3300060344 Bacteria 2569
510 Ga0587111_0051386 3300060346 Bacteria 911

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031235 Ga0265330_10000630 Ga0265330_1000063021 158
2 3300031711 Ga0265314_10039085 Ga0265314_100390854 158
3 3300031712 Ga0265342_10329002 Ga0265342_103290021 170
4 3300049539 Ga0501323_002040 Ga0501323_002040_714_1241 175
5 3300005563 Ga0068855_100134274 Ga0068855_1001342743 176
6 3300025949 Ga0207667_10111834 Ga0207667_101118346 176
7 3300035692 Ga0373935_0264923 Ga0373935_0264923_141_671 176
8 3300047319 Ga0495674_0589126 Ga0495674_0589126_203_733 176
9 3300027695 Ga0209966_1000144 Ga0209966_100014426 177
10 3300027717 Ga0209998_10004274 Ga0209998_100042744 177
11 3300049771 Ga0501274_010889 Ga0501274_010889_167_700 177
12 3300049686 Ga0501257_005035 Ga0501257_005035_944_1480 178
13 3300049823 Ga0501044_0304517 Ga0501044_0304517_204_740 178
14 3300005467 Ga0070706_100257817 Ga0070706_1002578172 179
15 3300005471 Ga0070698_100166769 Ga0070698_1001667694 179
16 3300041456 Ga0451795_1108070 Ga0451795_1108070_992_1531 179
17 3300046543 Ga0495645_0201028 Ga0495645_0201028_706_1245 179
18 3300046679 Ga0495623_0209758 Ga0495623_0209758_451_993 179
19 3300005289 Ga0065704_10522003 Ga0065704_105220031 180
20 3300005334 Ga0068869_100545302 Ga0068869_1005453022 180
21 3300005340 Ga0070689_100248082 Ga0070689_1002480821 180
22 3300005343 Ga0070687_100199134 Ga0070687_1001991341 180
23 3300005364 Ga0070673_100258556 Ga0070673_1002585562 180
24 3300005440 Ga0070705_100208381 Ga0070705_1002083811 180
25 3300005549 Ga0070704_100022859 Ga0070704_1000228597 180
26 3300005577 Ga0068857_100344175 Ga0068857_1003441753 180
27 3300005578 Ga0068854_100152680 Ga0068854_1001526803 180
28 3300005617 Ga0068859_100040039 Ga0068859_1000400396 180
29 3300005844 Ga0068862_100260426 Ga0068862_1002604262 180
30 3300006931 Ga0097620_100040040 Ga0097620_1000400407 180
31 3300007265 Ga0099794_10018500 Ga0099794_100185001 180
32 3300009553 Ga0105249_10183418 Ga0105249_101834182 180
33 3300025910 Ga0207684_10189155 Ga0207684_101891552 180
34 3300025918 Ga0207662_10137690 Ga0207662_101376902 180
35 3300025942 Ga0207689_10216223 Ga0207689_102162231 180
36 3300025960 Ga0207651_10737355 Ga0207651_107373552 180
37 3300025961 Ga0207712_10589183 Ga0207712_105891832 180
38 3300025981 Ga0207640_10336329 Ga0207640_103363291 180
39 3300026116 Ga0207674_10030807 Ga0207674_100308078 180
40 3300036401 Ga0373937_0040264 Ga0373937_0040264_2726_3268 180
41 3300036401 Ga0373937_0579078 Ga0373937_0579078_376_918 180
42 3300042876 Ga0451577_0074847 Ga0451577_0074847_2138_2683 180
43 3300044673 Ga0453683_0072457 Ga0453683_0072457_20_565 180
44 3300044712 Ga0453684_0443333 Ga0453684_0443333_646_1191 180
45 3300044712 Ga0453684_0464818 Ga0453684_0464818_43_588 180
46 3300045051 Ga0451576_0189778 Ga0451576_0189778_525_1070 180
47 3300045051 Ga0451576_0223680 Ga0451576_0223680_127_672 180
48 3300053085 Ga0495619_0362106 Ga0495619_0362106_291_833 180
49 3300005468 Ga0070707_100932845 Ga0070707_1009328452 181
50 3300044673 Ga0453683_0198527 Ga0453683_0198527_565_1110 181
51 iso_pu_bacteria 2510917020 2511120799 181
52 iso_pu_bacteria 2582581279 2585150061 181
53 iso_pu_bacteria 2582581280 2585155416 181
54 iso_pu_bacteria 2582581293 2585199200 181
55 iso_pu_bacteria 2643221552 2643781697 181
56 iso_pu_bacteria 2643221583 2643926346 181
57 iso_pu_bacteria 2643221584 2643931637 181
58 iso_pu_bacteria 2643221640 2644226553 181
59 iso_pu_bacteria 2643221642 2644236041 181
60 iso_pu_bacteria 2791355048 2792463722 181
61 iso_pu_bacteria 2818991435 2819536853 181
62 iso_pu_bacteria 2818991454 2819646014 181
63 iso_pu_bacteria 2843744320 2843747096 181
64 iso_pu_bacteria 2849560528 2849560635 181
65 iso_pu_bacteria 2849573788 2849578476 181
66 iso_pu_bacteria 2851153111 2851154281 181
67 iso_pu_bacteria 2898329390 2898331315 181
68 3300005445 Ga0070708_100056794 Ga0070708_1000567943 182
69 3300005467 Ga0070706_100156537 Ga0070706_1001565372 182
70 3300005468 Ga0070707_100012141 Ga0070707_10001214110 182
71 3300005468 Ga0070707_100142997 Ga0070707_1001429971 182
72 3300005471 Ga0070698_100023930 Ga0070698_1000239306 182
73 3300005536 Ga0070697_100200597 Ga0070697_1002005973 182
74 3300025910 Ga0207684_10018824 Ga0207684_100188246 182
75 3300025910 Ga0207684_10253009 Ga0207684_102530094 182
76 3300025922 Ga0207646_10047921 Ga0207646_100479212 182
77 3300025922 Ga0207646_10172454 Ga0207646_101724542 182
78 3300025939 Ga0207665_10284491 Ga0207665_102844912 182
79 3300028653 Ga0265323_10010371 Ga0265323_100103718 182
80 3300029957 Ga0265324_10052753 Ga0265324_100527533 182
81 3300031235 Ga0265330_10000448 Ga0265330_1000044823 182
82 3300031235 Ga0265330_10184817 Ga0265330_101848172 182
83 3300031239 Ga0265328_10022952 Ga0265328_100229524 182
84 3300031241 Ga0265325_10002701 Ga0265325_1000270116 182
85 3300031242 Ga0265329_10000002 Ga0265329_1000000230 182
86 3300031344 Ga0265316_10000017 Ga0265316_1000001796 182
87 3300031344 Ga0265316_10016358 Ga0265316_1001635810 182
88 3300031344 Ga0265316_10409607 Ga0265316_104096072 182
89 3300031595 Ga0265313_10019566 Ga0265313_100195665 182
90 3300031711 Ga0265314_10000273 Ga0265314_1000027310 182
91 3300031712 Ga0265342_10001365 Ga0265342_1000136523 182
92 3300049130 Ga0501310_005520 Ga0501310_005520_581_1135 182
93 iso_pu_bacteria 2643221598 2643997895 182
94 iso_pu_bacteria 2643221614 2644088889 182
95 iso_pu_bacteria 2643221661 2644342251 182
96 iso_pu_bacteria 2643221666 2644369634 182
97 3300037588 Ga0316581_0001366 Ga0316581_0001366_2460_3017 183
98 3300039438 Ga0436360_0523945 Ga0436360_0523945_156_713 184
99 3300060346 Ga0587111_0051386 Ga0587111_0051386_169_726 184
100 3300003308 Ga0006777J48905_1080577 Ga0006777J48905_10805777 185
101 3300003559 Ga0007427J51700_108234 Ga0007427J51700_10823410 185
102 3300003693 Ga0032354_1028809 Ga0032354_10288093 185
103 3300003771 Ga0055526_1035022 Ga0055526_10350222 185
104 3300003773 Ga0055537_1001243 Ga0055537_100124310 185
105 3300003775 Ga0055524_1030115 Ga0055524_10301152 185
106 3300003784 Ga0055534_1036957 Ga0055534_10369571 185
107 3300003790 Ga0055528_1008934 Ga0055528_10089348 185
108 3300003790 Ga0055528_1029848 Ga0055528_10298484 185
109 3300004625 Ga0055543_1026803 Ga0055543_10268032 185
110 3300004800 Ga0058861_11906893 Ga0058861_119068932 185
111 3300005262 Ga0065165_1002762 Ga0065165_100276218 185
112 3300005327 Ga0070658_10233633 Ga0070658_102336333 185
113 3300005366 Ga0070659_100018511 Ga0070659_1000185111 185
114 3300005455 Ga0070663_100067254 Ga0070663_1000672547 185
115 3300005458 Ga0070681_10571033 Ga0070681_105710332 185
116 3300005548 Ga0070665_100166338 Ga0070665_1001663385 185
117 3300005563 Ga0068855_100067956 Ga0068855_1000679565 185
118 3300005563 Ga0068855_100261493 Ga0068855_1002614932 185
119 3300005564 Ga0070664_100064671 Ga0070664_1000646713 185
120 3300005616 Ga0068852_100592161 Ga0068852_1005921613 185
121 3300009093 Ga0105240_10000798 Ga0105240_1000079816 185
122 3300009093 Ga0105240_10013835 Ga0105240_100138359 185
123 3300009093 Ga0105240_10188429 Ga0105240_101884293 185
124 3300010375 Ga0105239_10587410 Ga0105239_105874103 185
125 3300013104 Ga0157370_10022671 Ga0157370_100226719 185
126 3300013105 Ga0157369_10931785 Ga0157369_109317852 185
127 3300013307 Ga0157372_10050145 Ga0157372_1005014511 185
128 3300014326 Ga0157380_10558028 Ga0157380_105580282 185
129 3300015261 Ga0182006_1059895 Ga0182006_10598953 185
130 3300021377 Ga0213874_10010369 Ga0213874_100103693 185
131 3300021384 Ga0213876_10000244 Ga0213876_1000024415 185
132 3300021388 Ga0213875_10063678 Ga0213875_100636784 185
133 3300025254 Ga0209148_1007048 Ga0209148_10070481 185
134 3300025263 Ga0209565_1000925 Ga0209565_100092512 185
135 3300025272 Ga0209455_1022633 Ga0209455_10226333 185
136 3300025273 Ga0209673_1002524 Ga0209673_100252417 185
137 3300025291 Ga0209675_1002569 Ga0209675_100256914 185
138 3300025292 Ga0209676_1005783 Ga0209676_10057832 185
139 3300025295 Ga0209564_1029308 Ga0209564_10293083 185
140 3300025298 Ga0209050_1011548 Ga0209050_10115482 185
141 3300025299 Ga0209256_1003893 Ga0209256_100389315 185
142 3300025304 Ga0209257_1000976 Ga0209257_100097639 185
143 3300025304 Ga0209257_1001464 Ga0209257_100146438 185
144 3300025909 Ga0207705_10349677 Ga0207705_103496772 185
145 3300025912 Ga0207707_10093845 Ga0207707_100938457 185
146 3300025913 Ga0207695_10002926 Ga0207695_1000292624 185
147 3300025913 Ga0207695_10010884 Ga0207695_100108847 185
148 3300025913 Ga0207695_10405236 Ga0207695_104052362 185
149 3300025917 Ga0207660_10020945 Ga0207660_100209456 185
150 3300025917 Ga0207660_10306075 Ga0207660_103060752 185
151 3300025921 Ga0207652_10209902 Ga0207652_102099025 185
152 3300025921 Ga0207652_10848765 Ga0207652_108487652 185
153 3300025924 Ga0207694_10655797 Ga0207694_106557972 185
154 3300025932 Ga0207690_10020126 Ga0207690_100201261 185
155 3300025949 Ga0207667_10027885 Ga0207667_100278857 185
156 3300025949 Ga0207667_10271660 Ga0207667_102716603 185
157 3300025986 Ga0207658_10481321 Ga0207658_104813213 185
158 3300026067 Ga0207678_10344400 Ga0207678_103444003 185
159 3300028379 Ga0268266_10854051 Ga0268266_108540512 185
160 3300028794 Ga0307515_10510219 Ga0307515_105102192 185
161 3300031251 Ga0265327_10000381 Ga0265327_1000038165 185
162 3300031456 Ga0307513_10430701 Ga0307513_104307013 185
163 3300031730 Ga0307516_10001565 Ga0307516_1000156531 185
164 3300033180 Ga0307510_10438279 Ga0307510_104382792 185
165 3300035172 Ga0373955_0304760 Ga0373955_0304760_232_789 185
166 3300035692 Ga0373935_0333273 Ga0373935_0333273_137_709 185
167 3300035695 Ga0373927_0044490 Ga0373927_0044490_136_693 185
168 3300037312 Ga0395899_0000105 Ga0395899_0000105_137523_138083 185
169 3300037312 Ga0395899_0025758 Ga0395899_0025758_2691_3248 185
170 3300037312 Ga0395899_0143516 Ga0395899_0143516_84_641 185
171 3300037418 Ga0395900_0058480 Ga0395900_0058480_1320_1877 185
172 3300037418 Ga0395900_0100801 Ga0395900_0100801_977_1534 185
173 3300037466 Ga0395898_0073715 Ga0395898_0073715_818_1375 185
174 3300037466 Ga0395898_0118890 Ga0395898_0118890_75_632 185
175 3300037466 Ga0395898_0489457 Ga0395898_0489457_459_1019 185
176 3300037471 Ga0395905_0130813 Ga0395905_0130813_561_1118 185
177 3300037853 Ga0436364_1483493 Ga0436364_1483493_3528_4088 185
178 3300038443 Ga0395901_0658043 Ga0395901_0658043_336_896 185
179 3300039437 Ga0436365_0376847 Ga0436365_0376847_13469_14029 185
180 3300039438 Ga0436360_0034851 Ga0436360_0034851_272_922 185
181 3300039447 Ga0436361_0356944 Ga0436361_0356944_99_656 185
182 3300039450 Ga0436363_0101867 Ga0436363_0101867_1719_2279 185
183 3300041410 Ga0439461_0004190 Ga0439461_0004190_755_1312 185
184 3300041461 Ga0451805_122127 Ga0451805_122127_269_826 185
185 3300041491 Ga0451833_1326391 Ga0451833_1326391_62_619 185
186 3300042127 Ga0450890_015214 Ga0450890_015214_163_720 185
187 3300042156 Ga0439446_0004827 Ga0439446_0004827_2273_2830 185
188 3300042436 Ga0439435_0023237 Ga0439435_0023237_981_1538 185
189 3300044683 Ga0466965_0197136 Ga0466965_0197136_185_742 185
190 3300044693 Ga0466961_0161559 Ga0466961_0161559_416_973 185
191 3300044693 Ga0466961_0347676 Ga0466961_0347676_304_861 185
192 3300044765 Ga0466970_0276276 Ga0466970_0276276_325_882 185
193 3300044842 Ga0466957_0145584 Ga0466957_0145584_456_1013 185
194 3300045049 Ga0466959_0036896 Ga0466959_0036896_2637_3197 185
195 3300046453 Ga0495627_000399 Ga0495627_000399_8025_8582 185
196 3300046460 Ga0495638_0035321 Ga0495638_0035321_2209_2766 185
197 3300046460 Ga0495638_0247712 Ga0495638_0247712_49_606 185
198 3300046471 Ga0495650_0001571 Ga0495650_0001571_20168_20725 185
199 3300046491 Ga0495584_0107787 Ga0495584_0107787_769_1326 185
200 3300046492 Ga0495585_0186838 Ga0495585_0186838_171_728 185
201 3300046501 Ga0495607_0080713 Ga0495607_0080713_895_1452 185
202 3300046506 Ga0495583_0000650 Ga0495583_0000650_16981_17538 185
203 3300046515 Ga0495620_0067424 Ga0495620_0067424_682_1239 185
204 3300046519 Ga0495632_0041761 Ga0495632_0041761_107_664 185
205 3300046530 Ga0495654_0006712 Ga0495654_0006712_1091_1648 185
206 3300046616 Ga0495668_0001504 Ga0495668_0001504_2267_2824 185
207 3300046616 Ga0495668_0049463 Ga0495668_0049463_1538_2095 185
208 3300046660 Ga0495625_0001925 Ga0495625_0001925_6206_6763 185
209 3300046660 Ga0495625_0167562 Ga0495625_0167562_569_1126 185
210 3300046664 Ga0495659_0025307 Ga0495659_0025307_1039_1596 185
211 3300046674 Ga0495588_0052430 Ga0495588_0052430_437_994 185
212 3300046683 Ga0495658_0304985 Ga0495658_0304985_242_799 185
213 3300046684 Ga0495669_0000371 Ga0495669_0000371_1754_2311 185
214 3300046691 Ga0495670_0037453 Ga0495670_0037453_1105_1662 185
215 3300046810 Ga0495660_0154465 Ga0495660_0154465_224_781 185
216 3300047320 Ga0495672_0000439 Ga0495672_0000439_40123_40680 185
217 3300047323 Ga0495683_0065427 Ga0495683_0065427_578_1135 185
218 3300047446 Ga0495679_029031 Ga0495679_029031_920_1477 185
219 3300047469 Ga0495673_0000189 Ga0495673_0000189_93658_94215 185
220 3300047470 Ga0495681_0056388 Ga0495681_0056388_544_1101 185
221 3300047472 Ga0495686_0029450 Ga0495686_0029450_1344_1901 185
222 3300047472 Ga0495686_0098679 Ga0495686_0098679_546_1103 185
223 3300048904 Ga0496101_0127092 Ga0496101_0127092_1115_1672 185
224 3300048909 Ga0496106_0014990 Ga0496106_0014990_3733_4290 185
225 3300048910 Ga0496107_0000073 Ga0496107_0000073_43064_43621 185
226 3300048929 Ga0496126_0067161 Ga0496126_0067161_495_1052 185
227 3300049459 Ga0495678_005077 Ga0495678_005077_5075_5632 185
228 3300049527 Ga0501311_003804 Ga0501311_003804_514_1095 185
229 3300049540 Ga0501324_011699 Ga0501324_011699_193_750 185
230 3300049758 Ga0501241_027104 Ga0501241_027104_182_739 185
231 3300050493 nmdc:mga0k408_11918_c1 nmdc:mga0k408_11918_c1_2150_2707 185
232 3300050496 nmdc:mga07m45_86829_c1 nmdc:mga07m45_86829_c1_732_1289 185
233 3300053086 Ga0500578_0000459 Ga0500578_0000459_30763_31320 185
234 3300053088 Ga0500644_0000193 Ga0500644_0000193_18053_18610 185
235 3300053090 Ga0500646_0022126 Ga0500646_0022126_65_622 185
236 3300053094 Ga0500566_0065996 Ga0500566_0065996_1237_1794 185
237 3300053096 Ga0500641_0010127 Ga0500641_0010127_556_1113 185
238 3300053102 Ga0500554_011267 Ga0500554_011267_399_956 185
239 3300053104 Ga0500556_0001077 Ga0500556_0001077_10444_11001 185
240 3300053108 Ga0500562_004235 Ga0500562_004235_980_1537 185
241 3300053118 Ga0500594_0004036 Ga0500594_0004036_177_734 185
242 3300053123 Ga0500614_026739 Ga0500614_026739_234_791 185
243 3300053125 Ga0500618_000703 Ga0500618_000703_1620_2177 185
244 3300053134 Ga0500658_0000930 Ga0500658_0000930_9597_10154 185
245 3300053136 Ga0500559_0001398 Ga0500559_0001398_5934_6491 185
246 3300053142 Ga0500577_0005365 Ga0500577_0005365_824_1381 185
247 3300053156 Ga0500622_0000771 Ga0500622_0000771_5237_5794 185
248 3300053156 Ga0500622_0011085 Ga0500622_0011085_3798_4355 185
249 3300053156 Ga0500622_0069509 Ga0500622_0069509_608_1165 185
250 3300053158 Ga0500627_0001516 Ga0500627_0001516_639_1196 185
251 3300053727 Ga0500611_006082 Ga0500611_006082_575_1132 185
252 3300053730 Ga0500645_002894 Ga0500645_002894_2850_3407 185
253 3300053731 Ga0500609_000093 Ga0500609_000093_8559_9116 185
254 3300055283 Ga0500661_008301 Ga0500661_008301_970_1527 185
255 3300059507 Ga0587086_006705 Ga0587086_006705_10_570 185
256 3300059510 Ga0587090_105505 Ga0587090_105505_22_579 185
257 3300059647 Ga0587079_018207 Ga0587079_018207_277_834 185
258 3300060344 Ga0587071_002314 Ga0587071_002314_1386_1943 185
259 3300003791 Ga0055530_10021003 Ga0055530_100210032 186
260 3300003794 Ga0055531_10018518 Ga0055531_100185187 186
261 3300004625 Ga0055543_1012790 Ga0055543_10127902 186
262 3300005329 Ga0070683_100527371 Ga0070683_1005273712 186
263 3300005331 Ga0070670_100021899 Ga0070670_10002189910 186
264 3300005335 Ga0070666_10124941 Ga0070666_101249413 186
265 3300005335 Ga0070666_10233761 Ga0070666_102337612 186
266 3300005337 Ga0070682_100479853 Ga0070682_1004798532 186
267 3300005344 Ga0070661_100120510 Ga0070661_1001205104 186
268 3300005347 Ga0070668_100023377 Ga0070668_1000233775 186
269 3300005347 Ga0070668_100025277 Ga0070668_1000252775 186
270 3300005353 Ga0070669_100051464 Ga0070669_1000514647 186
271 3300005355 Ga0070671_100313772 Ga0070671_1003137723 186
272 3300005367 Ga0070667_100015939 Ga0070667_1000159396 186
273 3300005530 Ga0070679_100631932 Ga0070679_1006319321 186
274 3300005548 Ga0070665_100071556 Ga0070665_1000715567 186
275 3300005563 Ga0068855_100684523 Ga0068855_1006845232 186
276 3300005841 Ga0068863_100028125 Ga0068863_1000281258 186
277 3300005842 Ga0068858_100478536 Ga0068858_1004785362 186
278 3300005844 Ga0068862_100077983 Ga0068862_1000779834 186
279 3300005983 Ga0081540_1183551 Ga0081540_11835512 186
280 3300009101 Ga0105247_10405522 Ga0105247_104055222 186
281 3300009176 Ga0105242_10314107 Ga0105242_103141072 186
282 3300010375 Ga0105239_10544500 Ga0105239_105445003 186
283 3300014745 Ga0157377_10115144 Ga0157377_101151442 186
284 3300014968 Ga0157379_10858339 Ga0157379_108583392 186
285 3300014969 Ga0157376_11420736 Ga0157376_114207361 186
286 3300015262 Ga0182007_10016882 Ga0182007_100168825 186
287 3300025245 Ga0207425_1036708 Ga0207425_10367082 186
288 3300025297 Ga0209758_1002168 Ga0209758_100216817 186
289 3300025298 Ga0209050_1000161 Ga0209050_100016199 186
290 3300025304 Ga0209257_1000252 Ga0209257_100025277 186
291 3300025923 Ga0207681_10265954 Ga0207681_102659543 186
292 3300025934 Ga0207686_10287032 Ga0207686_102870323 186
293 3300025949 Ga0207667_10775951 Ga0207667_107759512 186
294 3300025972 Ga0207668_10007456 Ga0207668_100074566 186
295 3300026035 Ga0207703_10345430 Ga0207703_103454302 186
296 3300026041 Ga0207639_10043283 Ga0207639_100432837 186
297 3300026088 Ga0207641_10076518 Ga0207641_100765187 186
298 3300026089 Ga0207648_10243841 Ga0207648_102438412 186
299 3300026089 Ga0207648_10704366 Ga0207648_107043661 186
300 3300028379 Ga0268266_10355576 Ga0268266_103555763 186
301 3300028380 Ga0268265_10100736 Ga0268265_101007361 186
302 3300028556 Ga0265337_1095959 Ga0265337_10959592 186
303 3300031824 Ga0307413_10002271 Ga0307413_1000227115 186
304 3300031901 Ga0307406_10161829 Ga0307406_101618292 186
305 3300032004 Ga0307414_10117659 Ga0307414_101176594 186
306 3300037471 Ga0395905_0173211 Ga0395905_0173211_477_1037 186
307 3300037471 Ga0395905_0198482 Ga0395905_0198482_1019_1579 186
308 3300039453 Ga0436362_0403796 Ga0436362_0403796_70_630 186
309 3300046615 Ga0495656_0202473 Ga0495656_0202473_111_671 186
310 3300048907 Ga0496104_0162799 Ga0496104_0162799_1239_1799 186
311 3300049127 Ga0501306_017130 Ga0501306_017130_350_910 186
312 3300049129 Ga0501309_044877 Ga0501309_044877_79_639 186
313 3300049536 Ga0501320_003371 Ga0501320_003371_27_587 186
314 3300049541 Ga0501325_011787 Ga0501325_011787_154_714 186
315 3300049569 Ga0501032_0107042 Ga0501032_0107042_799_1359 186
316 3300049573 Ga0501037_0035888 Ga0501037_0035888_663_1223 186
317 3300049823 Ga0501044_0008183 Ga0501044_0008183_1663_2223 186
318 3300053153 Ga0500616_0183125 Ga0500616_0183125_149_709 186
319 3300059491 Ga0587070_084895 Ga0587070_084895_19_579 186
320 3300005333 Ga0070677_10218795 Ga0070677_102187952 187
321 3300005347 Ga0070668_100237564 Ga0070668_1002375642 187
322 3300005364 Ga0070673_100590962 Ga0070673_1005909621 187
323 3300005543 Ga0070672_100576323 Ga0070672_1005763232 187
324 3300005841 Ga0068863_100364710 Ga0068863_1003647103 187
325 3300005843 Ga0068860_100051208 Ga0068860_1000512088 187
326 3300005844 Ga0068862_100094860 Ga0068862_1000948602 187
327 3300006881 Ga0068865_100523855 Ga0068865_1005238552 187
328 3300014969 Ga0157376_10262170 Ga0157376_102621703 187
329 3300025934 Ga0207686_10828929 Ga0207686_108289292 187
330 3300025940 Ga0207691_10058461 Ga0207691_100584617 187
331 3300025942 Ga0207689_10400152 Ga0207689_104001522 187
332 3300025972 Ga0207668_10009414 Ga0207668_100094146 187
333 3300026088 Ga0207641_10984954 Ga0207641_109849542 187
334 3300026089 Ga0207648_10290341 Ga0207648_102903413 187
335 3300026118 Ga0207675_100156692 Ga0207675_1001566922 187
336 3300028380 Ga0268265_10019588 Ga0268265_1001958810 187
337 3300028381 Ga0268264_10002325 Ga0268264_1000232517 187
338 3300046516 Ga0495628_0109267 Ga0495628_0109267_376_942 187
339 3300046539 Ga0495621_0041413 Ga0495621_0041413_272_835 187
340 3300047319 Ga0495674_0099850 Ga0495674_0099850_1654_2220 187
341 3300049160 Ga0501304_020739 Ga0501304_020739_10_573 187
342 3300000531 CNBas_1004576 CNBas_10045761 188
343 3300005288 Ga0065714_10192749 Ga0065714_101927492 188
344 3300005334 Ga0068869_100649286 Ga0068869_1006492861 188
345 3300005336 Ga0070680_100006095 Ga0070680_1000060956 188
346 3300005336 Ga0070680_100116911 Ga0070680_1001169112 188
347 3300005339 Ga0070660_100548371 Ga0070660_1005483712 188
348 3300005340 Ga0070689_100614119 Ga0070689_1006141192 188
349 3300005340 Ga0070689_101052835 Ga0070689_1010528351 188
350 3300005354 Ga0070675_100597560 Ga0070675_1005975601 188
351 3300005355 Ga0070671_100184470 Ga0070671_1001844703 188
352 3300005356 Ga0070674_100404900 Ga0070674_1004049001 188
353 3300005366 Ga0070659_100131707 Ga0070659_1001317073 188
354 3300005367 Ga0070667_100214807 Ga0070667_1002148074 188
355 3300005456 Ga0070678_100258005 Ga0070678_1002580052 188
356 3300005457 Ga0070662_100014250 Ga0070662_1000142506 188
357 3300005458 Ga0070681_10040928 Ga0070681_100409287 188
358 3300005458 Ga0070681_10042882 Ga0070681_100428828 188
359 3300005530 Ga0070679_100042115 Ga0070679_1000421157 188
360 3300005530 Ga0070679_100351539 Ga0070679_1003515393 188
361 3300005539 Ga0068853_100184845 Ga0068853_1001848452 188
362 3300005539 Ga0068853_100387108 Ga0068853_1003871083 188
363 3300005548 Ga0070665_100000121 Ga0070665_100000121157 188
364 3300005563 Ga0068855_100018024 Ga0068855_10001802410 188
365 3300005563 Ga0068855_100073551 Ga0068855_1000735517 188
366 3300005563 Ga0068855_100074983 Ga0068855_1000749837 188
367 3300005564 Ga0070664_100274045 Ga0070664_1002740452 188
368 3300005564 Ga0070664_100636453 Ga0070664_1006364532 188
369 3300005616 Ga0068852_100670611 Ga0068852_1006706112 188
370 3300005618 Ga0068864_100070364 Ga0068864_1000703647 188
371 3300005618 Ga0068864_101221920 Ga0068864_1012219201 188
372 3300005719 Ga0068861_100649074 Ga0068861_1006490742 188
373 3300005841 Ga0068863_100181671 Ga0068863_1001816714 188
374 3300005844 Ga0068862_101179497 Ga0068862_1011794971 188
375 3300006028 Ga0070717_10150923 Ga0070717_101509234 188
376 3300006038 Ga0075365_10006324 Ga0075365_100063249 188
377 3300006048 Ga0075363_100007657 Ga0075363_1000076574 188
378 3300006195 Ga0075366_10086475 Ga0075366_100864752 188
379 3300006353 Ga0075370_10122046 Ga0075370_101220462 188
380 3300006353 Ga0075370_10470933 Ga0075370_104709332 188
381 3300006881 Ga0068865_100031091 Ga0068865_1000310917 188
382 3300006881 Ga0068865_100558066 Ga0068865_1005580662 188
383 3300007265 Ga0099794_10000179 Ga0099794_1000017915 188
384 3300009093 Ga0105240_10162906 Ga0105240_101629063 188
385 3300009093 Ga0105240_10458549 Ga0105240_104585492 188
386 3300009093 Ga0105240_10504234 Ga0105240_105042343 188
387 3300009094 Ga0111539_11155399 Ga0111539_111553992 188
388 3300009098 Ga0105245_10505959 Ga0105245_105059592 188
389 3300009098 Ga0105245_10728966 Ga0105245_107289662 188
390 3300009174 Ga0105241_10163652 Ga0105241_101636523 188
391 3300009545 Ga0105237_10155310 Ga0105237_101553102 188
392 3300009545 Ga0105237_11631492 Ga0105237_116314921 188
393 3300009551 Ga0105238_10045873 Ga0105238_100458737 188
394 3300009551 Ga0105238_10526582 Ga0105238_105265822 188
395 3300009551 Ga0105238_10584308 Ga0105238_105843082 188
396 3300009551 Ga0105238_10605689 Ga0105238_106056893 188
397 3300009553 Ga0105249_10183876 Ga0105249_101838763 188
398 3300010375 Ga0105239_10346341 Ga0105239_103463413 188
399 3300010375 Ga0105239_10834121 Ga0105239_108341212 188
400 3300013102 Ga0157371_10422907 Ga0157371_104229071 188
401 3300013104 Ga0157370_10162858 Ga0157370_101628586 188
402 3300013105 Ga0157369_10283134 Ga0157369_102831343 188
403 3300013296 Ga0157374_10564693 Ga0157374_105646931 188
404 3300013297 Ga0157378_10125170 Ga0157378_101251703 188
405 3300013297 Ga0157378_10772037 Ga0157378_107720372 188
406 3300013306 Ga0163162_10143420 Ga0163162_101434206 188
407 3300013307 Ga0157372_10708135 Ga0157372_107081353 188
408 3300013308 Ga0157375_10502592 Ga0157375_105025923 188
409 3300014325 Ga0163163_10377403 Ga0163163_103774034 188
410 3300014325 Ga0163163_10385354 Ga0163163_103853542 188
411 3300014325 Ga0163163_11290006 Ga0163163_112900062 188
412 3300014326 Ga0157380_10262147 Ga0157380_102621473 188
413 3300017792 Ga0163161_10049692 Ga0163161_100496923 188
414 3300021361 Ga0213872_10022498 Ga0213872_100224982 188
415 3300025250 Ga0209026_1003882 Ga0209026_10038828 188
416 3300025304 Ga0209257_1018926 Ga0209257_10189264 188
417 3300025903 Ga0207680_10115044 Ga0207680_101150442 188
418 3300025907 Ga0207645_10298324 Ga0207645_102983242 188
419 3300025909 Ga0207705_10011901 Ga0207705_1001190110 188
420 3300025912 Ga0207707_10087890 Ga0207707_100878906 188
421 3300025912 Ga0207707_10091202 Ga0207707_100912022 188
422 3300025913 Ga0207695_10000575 Ga0207695_1000057517 188
423 3300025913 Ga0207695_10261400 Ga0207695_102614004 188
424 3300025913 Ga0207695_10278839 Ga0207695_102788394 188
425 3300025914 Ga0207671_10429423 Ga0207671_104294231 188
426 3300025917 Ga0207660_10000537 Ga0207660_1000053717 188
427 3300025917 Ga0207660_10057441 Ga0207660_100574412 188
428 3300025919 Ga0207657_10062953 Ga0207657_100629537 188
429 3300025921 Ga0207652_10002134 Ga0207652_1000213414 188
430 3300025921 Ga0207652_10172662 Ga0207652_101726625 188
431 3300025924 Ga0207694_10078132 Ga0207694_100781322 188
432 3300025924 Ga0207694_10127710 Ga0207694_101277103 188
433 3300025924 Ga0207694_10260913 Ga0207694_102609132 188
434 3300025927 Ga0207687_10295051 Ga0207687_102950513 188
435 3300025931 Ga0207644_10077748 Ga0207644_100777483 188
436 3300025932 Ga0207690_10008937 Ga0207690_1000893710 188
437 3300025932 Ga0207690_10171669 Ga0207690_101716693 188
438 3300025936 Ga0207670_10464272 Ga0207670_104642722 188
439 3300025938 Ga0207704_10118865 Ga0207704_101188653 188
440 3300025938 Ga0207704_10182039 Ga0207704_101820393 188
441 3300025941 Ga0207711_10001469 Ga0207711_1000146918 188
442 3300025941 Ga0207711_10262862 Ga0207711_102628623 188
443 3300025942 Ga0207689_10353606 Ga0207689_103536063 188
444 3300025945 Ga0207679_10112251 Ga0207679_101122514 188
445 3300025949 Ga0207667_10015066 Ga0207667_100150667 188
446 3300025949 Ga0207667_10052476 Ga0207667_100524762 188
447 3300025949 Ga0207667_10090996 Ga0207667_100909963 188
448 3300025960 Ga0207651_10115078 Ga0207651_101150785 188
449 3300025986 Ga0207658_10156248 Ga0207658_101562482 188
450 3300026023 Ga0207677_10372997 Ga0207677_103729973 188
451 3300026041 Ga0207639_10668327 Ga0207639_106683272 188
452 3300026041 Ga0207639_10779429 Ga0207639_107794292 188
453 3300026088 Ga0207641_10338847 Ga0207641_103388472 188
454 3300026095 Ga0207676_10243784 Ga0207676_102437843 188
455 3300026116 Ga0207674_10267714 Ga0207674_102677142 188
456 3300026121 Ga0207683_10319561 Ga0207683_103195613 188
457 3300026142 Ga0207698_10868870 Ga0207698_108688701 188
458 3300026142 Ga0207698_11415608 Ga0207698_114156081 188
459 3300027543 Ga0209999_1001367 Ga0209999_10013675 188
460 3300027665 Ga0209983_1004172 Ga0209983_10041725 188
461 3300027671 Ga0209588_1020292 Ga0209588_10202923 188
462 3300028379 Ga0268266_10000106 Ga0268266_100001067 188
463 3300028379 Ga0268266_10084163 Ga0268266_100841632 188
464 3300028786 Ga0307517_10029956 Ga0307517_1002995612 188
465 3300028794 Ga0307515_10496074 Ga0307515_104960742 188
466 3300030521 Ga0307511_10006537 Ga0307511_1000653716 188
467 3300031456 Ga0307513_10002446 Ga0307513_1000244631 188
468 3300031548 Ga0307408_101083653 Ga0307408_1010836532 188
469 3300031824 Ga0307413_10189895 Ga0307413_101898954 188
470 3300031903 Ga0307407_10944313 Ga0307407_109443131 188
471 3300031995 Ga0307409_100528370 Ga0307409_1005283702 188
472 3300032002 Ga0307416_101432627 Ga0307416_1014326271 188
473 3300032004 Ga0307414_10065490 Ga0307414_100654903 188
474 3300032004 Ga0307414_11186768 Ga0307414_111867681 188
475 3300033180 Ga0307510_10013765 Ga0307510_100137659 188
476 3300035113 Ga0373936_0004112 Ga0373936_0004112_918_1484 188
477 3300035170 Ga0373943_0107086 Ga0373943_0107086_78_644 188
478 3300035171 Ga0373946_0106332 Ga0373946_0106332_376_942 188
479 3300035695 Ga0373927_0000479 Ga0373927_0000479_24038_24604 188
480 3300037068 Ga0373925_0000023 Ga0373925_0000023_10133_10699 188
481 3300037312 Ga0395899_0001195 Ga0395899_0001195_8200_8769 188
482 3300037418 Ga0395900_0006999 Ga0395900_0006999_2914_3483 188
483 3300037466 Ga0395898_0004322 Ga0395898_0004322_8201_8770 188
484 3300037471 Ga0395905_0006270 Ga0395905_0006270_2474_3043 188
485 3300038443 Ga0395901_0000342 Ga0395901_0000342_47986_48555 188
486 3300039447 Ga0436361_0953537 Ga0436361_0953537_24148_24720 188
487 3300041997 Ga0439431_0031081 Ga0439431_0031081_476_1042 188
488 3300042005 Ga0439448_0164523 Ga0439448_0164523_36_602 188
489 3300042435 Ga0439434_0073528 Ga0439434_0073528_349_915 188
490 3300046460 Ga0495638_0349384 Ga0495638_0349384_124_690 188
491 3300046472 Ga0495580_0436143 Ga0495580_0436143_111_680 188
492 3300046474 Ga0495605_0073285 Ga0495605_0073285_253_819 188
493 3300046491 Ga0495584_0103560 Ga0495584_0103560_551_1117 188
494 3300046525 Ga0495663_0008611 Ga0495663_0008611_887_1453 188
495 3300046528 Ga0495642_0008396 Ga0495642_0008396_2037_2603 188
496 3300046539 Ga0495621_0010211 Ga0495621_0010211_269_835 188
497 3300046542 Ga0495597_0147433 Ga0495597_0147433_222_788 188
498 3300046616 Ga0495668_0064267 Ga0495668_0064267_1332_1898 188
499 3300046616 Ga0495668_0100670 Ga0495668_0100670_413_979 188
500 3300046648 Ga0495611_0005291 Ga0495611_0005291_3564_4130 188
501 3300046660 Ga0495625_0052545 Ga0495625_0052545_1610_2176 188
502 3300046660 Ga0495625_0132573 Ga0495625_0132573_402_968 188
503 3300046664 Ga0495659_0002869 Ga0495659_0002869_490_1056 188
504 3300046684 Ga0495669_0312870 Ga0495669_0312870_80_646 188
505 3300046691 Ga0495670_0445491 Ga0495670_0445491_32_598 188
506 3300046692 Ga0495671_0240579 Ga0495671_0240579_222_788 188
507 3300047318 Ga0495636_0006624 Ga0495636_0006624_2066_2632 188
508 3300047445 Ga0495677_0183390 Ga0495677_0183390_93_659 188
509 3300047447 Ga0495685_063236 Ga0495685_063236_293_859 188
510 3300047470 Ga0495681_0076275 Ga0495681_0076275_122_688 188
511 3300047472 Ga0495686_0007469 Ga0495686_0007469_5270_5836 188
512 3300048904 Ga0496101_0023677 Ga0496101_0023677_412_978 188
513 3300048905 Ga0496102_0081834 Ga0496102_0081834_1125_1691 188
514 3300048906 Ga0496103_0050032 Ga0496103_0050032_1223_1789 188
515 3300048910 Ga0496107_0049382 Ga0496107_0049382_261_827 188
516 3300048912 Ga0496109_0080902 Ga0496109_0080902_461_1027 188
517 3300048913 Ga0496110_0276694 Ga0496110_0276694_369_935 188
518 3300048915 Ga0496112_0033003 Ga0496112_0033003_346_912 188
519 3300049162 Ga0501307_005954 Ga0501307_005954_50_616 188
520 3300049539 Ga0501323_015869 Ga0501323_015869_22_588 188
521 3300049581 Ga0501047_0252100 Ga0501047_0252100_182_751 188
522 3300049743 Ga0501081_0363781 Ga0501081_0363781_35_859 188
523 3300049822 Ga0501035_0118771 Ga0501035_0118771_212_781 188
524 3300049823 Ga0501044_0130572 Ga0501044_0130572_1172_1741 188
525 3300050490 nmdc:mga03n38_31920_c1 nmdc:mga03n38_31920_c1_1438_2004 188
526 3300050493 nmdc:mga0k408_176476_c1 nmdc:mga0k408_176476_c1_377_943 188
527 3300053108 Ga0500562_000644 Ga0500562_000644_5161_5727 188
528 3300053158 Ga0500627_0133540 Ga0500627_0133540_431_997 188
529 3300053730 Ga0500645_005668 Ga0500645_005668_3489_4055 188
530 3300059493 Ga0587077_046479 Ga0587077_046479_87_653 188
531 3300059652 Ga0587107_070100 Ga0587107_070100_44_610 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

23

79

0.99

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

83

176

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9779 10 183
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9705 10 183
5ns4-assembly2.cif.gz_B crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9688 10 183
5ns3-assembly1.cif.gz_A crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9584 10 183
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9502 10 183
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9369 9 183 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9218 9 183 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8975 28 183 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8971 28 185 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8618 28 184 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A7W1RDG4-F1-model_v4 Large ribosomal subunit protein uL5 0.9592 8 187 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A845S4K3-F1-model_v4 Large ribosomal subunit protein uL5 0.9587 6 186 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2W5Y1Q8-F1-model_v4 Large ribosomal subunit protein uL5 0.9574 9 187 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E4WGS1-F1-model_v4 Large ribosomal subunit protein uL5 0.9568 6 186 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2A5GTL4-F1-model_v4 Large ribosomal subunit protein uL5 0.9567 6 185 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
82.65 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map