F460166
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 531 | 353 | 510 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0074847|Ga0451577_0074847_2138_2683 |
| Length | 181 |
| Sequence | MRLKEKYQKEIVKQLEEKIGYKNDMLVPRLTKVVLNVGFGAHSKEKEYIASVTRGLVSISGQKPVMTLAKQSVSAFKIREGMVIGAKVTLRGNRMYDFVEKLVGITFPRVRDFRGISEKGIDNKGNMTIGFKEHVAFPEIRVEDIDNIYGLEVCLSTTAKTKEEGLELFRAFGFPFKKDSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 6 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 7 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 8 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 9 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 10 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 11 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 12 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 13 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 14 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 15 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 16 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 17 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 18 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 19 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 20 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 21 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 22 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 23 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 229 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 232 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 233 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 235 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 236 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 237 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 238 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 239 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 240 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 241 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 248 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 316 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 318 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 322 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 323 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 328 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 330 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 331 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 332 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 333 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 334 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 335 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 338 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 339 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 341 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 343 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 345 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 346 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.53 |
| Metatranscriptomes | 4.52 |
| Isolates | 3.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.68 |
| Nodule | 0 |
| Rhizoplane | 2.45 |
| Rhizosphere | 79.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNBas_1004576 | 3300000531 | Bacteria | 783 |
| 2 | Ga0006777J48905_1080577 | 3300003308 | Bacteria | 2583 |
| 3 | Ga0007427J51700_108234 | 3300003559 | Bacteria | 6325 |
| 4 | Ga0032354_1028809 | 3300003693 | Bacteria | 1476 |
| 5 | Ga0055526_1035022 | 3300003771 | Bacteria | 1361 |
| 6 | Ga0055537_1001243 | 3300003773 | Bacteria | 10661 |
| 7 | Ga0055524_1030115 | 3300003775 | Bacteria | 1588 |
| 8 | Ga0055534_1036957 | 3300003784 | Bacteria | 732 |
| 9 | Ga0055528_1008934 | 3300003790 | Bacteria | 4234 |
| 10 | Ga0055528_1029848 | 3300003790 | Bacteria | 1462 |
| 11 | Ga0055530_10021003 | 3300003791 | Bacteria | 1935 |
| 12 | Ga0055531_10018518 | 3300003794 | Bacteria | 2869 |
| 13 | Ga0055543_1012790 | 3300004625 | Bacteria | 1675 |
| 14 | Ga0055543_1026803 | 3300004625 | Bacteria | 1023 |
| 15 | Ga0058861_11906893 | 3300004800 | Bacteria | 992 |
| 16 | Ga0065165_1002762 | 3300005262 | Bacteria | 13954 |
| 17 | Ga0065714_10192749 | 3300005288 | Bacteria | 920 |
| 18 | Ga0065704_10522003 | 3300005289 | Bacteria | 653 |
| 19 | Ga0070658_10233633 | 3300005327 | Bacteria | 1557 |
| 20 | Ga0070683_100527371 | 3300005329 | Bacteria | 1129 |
| 21 | Ga0070670_100021899 | 3300005331 | Bacteria | 5499 |
| 22 | Ga0070677_10218795 | 3300005333 | Bacteria | 929 |
| 23 | Ga0068869_100545302 | 3300005334 | Bacteria | 973 |
| 24 | Ga0068869_100649286 | 3300005334 | Bacteria | 895 |
| 25 | Ga0070666_10124941 | 3300005335 | Bacteria | 1786 |
| 26 | Ga0070666_10233761 | 3300005335 | Bacteria | 1299 |
| 27 | Ga0070680_100006095 | 3300005336 | Bacteria | 9137 |
| 28 | Ga0070680_100116911 | 3300005336 | Bacteria | 2223 |
| 29 | Ga0070682_100479853 | 3300005337 | Bacteria | 959 |
| 30 | Ga0070660_100548371 | 3300005339 | Bacteria | 964 |
| 31 | Ga0070689_100248082 | 3300005340 | Bacteria | 1468 |
| 32 | Ga0070689_100614119 | 3300005340 | Bacteria | 943 |
| 33 | Ga0070689_101052835 | 3300005340 | Bacteria | 726 |
| 34 | Ga0070687_100199134 | 3300005343 | Bacteria | 1212 |
| 35 | Ga0070661_100120510 | 3300005344 | Bacteria | 1965 |
| 36 | Ga0070668_100023377 | 3300005347 | Bacteria | 4674 |
| 37 | Ga0070668_100025277 | 3300005347 | Bacteria | 4501 |
| 38 | Ga0070668_100237564 | 3300005347 | Bacteria | 1508 |
| 39 | Ga0070669_100051464 | 3300005353 | Bacteria | 3010 |
| 40 | Ga0070675_100597560 | 3300005354 | Bacteria | 1001 |
| 41 | Ga0070671_100184470 | 3300005355 | Bacteria | 1767 |
| 42 | Ga0070671_100313772 | 3300005355 | Bacteria | 1336 |
| 43 | Ga0070674_100404900 | 3300005356 | Bacteria | 1116 |
| 44 | Ga0070673_100258556 | 3300005364 | Bacteria | 1520 |
| 45 | Ga0070673_100590962 | 3300005364 | Bacteria | 1012 |
| 46 | Ga0070659_100018511 | 3300005366 | Bacteria | 5255 |
| 47 | Ga0070659_100131707 | 3300005366 | Bacteria | 2031 |
| 48 | Ga0070667_100015939 | 3300005367 | Bacteria | 6218 |
| 49 | Ga0070667_100214807 | 3300005367 | Bacteria | 1710 |
| 50 | Ga0070705_100208381 | 3300005440 | Bacteria | 1346 |
| 51 | Ga0070708_100056794 | 3300005445 | Bacteria | 3483 |
| 52 | Ga0070663_100067254 | 3300005455 | Bacteria | 2598 |
| 53 | Ga0070678_100258005 | 3300005456 | Bacteria | 1464 |
| 54 | Ga0070662_100014250 | 3300005457 | Bacteria | 5306 |
| 55 | Ga0070681_10040928 | 3300005458 | Bacteria | 4642 |
| 56 | Ga0070681_10042882 | 3300005458 | Bacteria | 4533 |
| 57 | Ga0070681_10571033 | 3300005458 | Bacteria | 1045 |
| 58 | Ga0070706_100156537 | 3300005467 | Bacteria | 2127 |
| 59 | Ga0070706_100257817 | 3300005467 | Bacteria | 1628 |
| 60 | Ga0070707_100012141 | 3300005468 | Bacteria | 8041 |
| 61 | Ga0070707_100142997 | 3300005468 | Bacteria | 2328 |
| 62 | Ga0070707_100932845 | 3300005468 | Bacteria | 833 |
| 63 | Ga0070698_100023930 | 3300005471 | Bacteria | 6377 |
| 64 | Ga0070698_100166769 | 3300005471 | Bacteria | 2145 |
| 65 | Ga0070679_100042115 | 3300005530 | Bacteria | 4547 |
| 66 | Ga0070679_100351539 | 3300005530 | Bacteria | 1421 |
| 67 | Ga0070679_100631932 | 3300005530 | Bacteria | 1014 |
| 68 | Ga0070697_100200597 | 3300005536 | Bacteria | 1696 |
| 69 | Ga0068853_100184845 | 3300005539 | Bacteria | 1891 |
| 70 | Ga0068853_100387108 | 3300005539 | Bacteria | 1307 |
| 71 | Ga0070672_100576323 | 3300005543 | Bacteria | 979 |
| 72 | Ga0070665_100000121 | 3300005548 | Bacteria | 147683 |
| 73 | Ga0070665_100071556 | 3300005548 | Bacteria | 3474 |
| 74 | Ga0070665_100166338 | 3300005548 | Bacteria | 2207 |
| 75 | Ga0070704_100022859 | 3300005549 | Bacteria | 4074 |
| 76 | Ga0068855_100018024 | 3300005563 | Bacteria | 8484 |
| 77 | Ga0068855_100067956 | 3300005563 | Bacteria | 4150 |
| 78 | Ga0068855_100073551 | 3300005563 | Bacteria | 3970 |
| 79 | Ga0068855_100074983 | 3300005563 | Bacteria | 3928 |
| 80 | Ga0068855_100134274 | 3300005563 | Bacteria | 2824 |
| 81 | Ga0068855_100261493 | 3300005563 | Bacteria | 1927 |
| 82 | Ga0068855_100684523 | 3300005563 | Bacteria | 1099 |
| 83 | Ga0070664_100064671 | 3300005564 | Bacteria | 3120 |
| 84 | Ga0070664_100274045 | 3300005564 | Bacteria | 1520 |
| 85 | Ga0070664_100636453 | 3300005564 | Bacteria | 991 |
| 86 | Ga0068857_100344175 | 3300005577 | Bacteria | 1380 |
| 87 | Ga0068854_100152680 | 3300005578 | Bacteria | 1782 |
| 88 | Ga0068852_100592161 | 3300005616 | Bacteria | 1112 |
| 89 | Ga0068852_100670611 | 3300005616 | Bacteria | 1045 |
| 90 | Ga0068859_100040039 | 3300005617 | Bacteria | 4703 |
| 91 | Ga0068864_100070364 | 3300005618 | Bacteria | 3044 |
| 92 | Ga0068864_101221920 | 3300005618 | Bacteria | 750 |
| 93 | Ga0068861_100649074 | 3300005719 | Bacteria | 975 |
| 94 | Ga0068863_100028125 | 3300005841 | Bacteria | 5367 |
| 95 | Ga0068863_100181671 | 3300005841 | Bacteria | 2019 |
| 96 | Ga0068863_100364710 | 3300005841 | Bacteria | 1409 |
| 97 | Ga0068858_100478536 | 3300005842 | Bacteria | 1202 |
| 98 | Ga0068860_100051208 | 3300005843 | Bacteria | 3929 |
| 99 | Ga0068862_100077983 | 3300005844 | Bacteria | 2870 |
| 100 | Ga0068862_100094860 | 3300005844 | Bacteria | 2602 |
| 101 | Ga0068862_100260426 | 3300005844 | Bacteria | 1583 |
| 102 | Ga0068862_101179497 | 3300005844 | Bacteria | 763 |
| 103 | Ga0081540_1183551 | 3300005983 | Bacteria | 780 |
| 104 | Ga0070717_10150923 | 3300006028 | Bacteria | 2010 |
| 105 | Ga0075365_10006324 | 3300006038 | Bacteria | 6505 |
| 106 | Ga0075363_100007657 | 3300006048 | Bacteria | 4981 |
| 107 | Ga0075366_10086475 | 3300006195 | Bacteria | 1875 |
| 108 | Ga0075370_10122046 | 3300006353 | Bacteria | 1517 |
| 109 | Ga0075370_10470933 | 3300006353 | Bacteria | 757 |
| 110 | Ga0068865_100031091 | 3300006881 | Bacteria | 3557 |
| 111 | Ga0068865_100523855 | 3300006881 | Bacteria | 992 |
| 112 | Ga0068865_100558066 | 3300006881 | Bacteria | 963 |
| 113 | Ga0097620_100040040 | 3300006931 | Bacteria | 4703 |
| 114 | Ga0099794_10000179 | 3300007265 | Bacteria | 23076 |
| 115 | Ga0099794_10018500 | 3300007265 | Bacteria | 3125 |
| 116 | Ga0105240_10000798 | 3300009093 | Bacteria | 57073 |
| 117 | Ga0105240_10013835 | 3300009093 | Bacteria | 11052 |
| 118 | Ga0105240_10162906 | 3300009093 | Bacteria | 2647 |
| 119 | Ga0105240_10188429 | 3300009093 | Bacteria | 2427 |
| 120 | Ga0105240_10458549 | 3300009093 | Bacteria | 1425 |
| 121 | Ga0105240_10504234 | 3300009093 | Bacteria | 1345 |
| 122 | Ga0111539_11155399 | 3300009094 | Bacteria | 899 |
| 123 | Ga0105245_10505959 | 3300009098 | Bacteria | 1225 |
| 124 | Ga0105245_10728966 | 3300009098 | Bacteria | 1026 |
| 125 | Ga0105247_10405522 | 3300009101 | Bacteria | 972 |
| 126 | Ga0105241_10163652 | 3300009174 | Bacteria | 1831 |
| 127 | Ga0105242_10314107 | 3300009176 | Bacteria | 1435 |
| 128 | Ga0105237_10155310 | 3300009545 | Bacteria | 2285 |
| 129 | Ga0105237_11631492 | 3300009545 | Bacteria | 652 |
| 130 | Ga0105238_10045873 | 3300009551 | Bacteria | 4414 |
| 131 | Ga0105238_10526582 | 3300009551 | Bacteria | 1185 |
| 132 | Ga0105238_10584308 | 3300009551 | Bacteria | 1124 |
| 133 | Ga0105238_10605689 | 3300009551 | Bacteria | 1104 |
| 134 | Ga0105249_10183418 | 3300009553 | Bacteria | 2038 |
| 135 | Ga0105249_10183876 | 3300009553 | Bacteria | 2035 |
| 136 | Ga0105239_10346341 | 3300010375 | Bacteria | 1677 |
| 137 | Ga0105239_10544500 | 3300010375 | Bacteria | 1321 |
| 138 | Ga0105239_10587410 | 3300010375 | Bacteria | 1270 |
| 139 | Ga0105239_10834121 | 3300010375 | Bacteria | 1057 |
| 140 | Ga0157371_10422907 | 3300013102 | Bacteria | 977 |
| 141 | Ga0157370_10022671 | 3300013104 | Bacteria | 6248 |
| 142 | Ga0157370_10162858 | 3300013104 | Bacteria | 2075 |
| 143 | Ga0157369_10283134 | 3300013105 | Bacteria | 1726 |
| 144 | Ga0157369_10931785 | 3300013105 | Bacteria | 890 |
| 145 | Ga0157374_10564693 | 3300013296 | Bacteria | 1146 |
| 146 | Ga0157378_10125170 | 3300013297 | Bacteria | 2373 |
| 147 | Ga0157378_10772037 | 3300013297 | Bacteria | 985 |
| 148 | Ga0163162_10143420 | 3300013306 | Bacteria | 2503 |
| 149 | Ga0157372_10050145 | 3300013307 | Bacteria | 4644 |
| 150 | Ga0157372_10708135 | 3300013307 | Bacteria | 1172 |
| 151 | Ga0157375_10502592 | 3300013308 | Bacteria | 1376 |
| 152 | Ga0163163_10377403 | 3300014325 | Bacteria | 1475 |
| 153 | Ga0163163_10385354 | 3300014325 | Bacteria | 1459 |
| 154 | Ga0163163_11290006 | 3300014325 | Bacteria | 792 |
| 155 | Ga0157380_10262147 | 3300014326 | Bacteria | 1570 |
| 156 | Ga0157380_10558028 | 3300014326 | Bacteria | 1125 |
| 157 | Ga0157377_10115144 | 3300014745 | Bacteria | 1622 |
| 158 | Ga0157379_10858339 | 3300014968 | Bacteria | 859 |
| 159 | Ga0157376_10262170 | 3300014969 | Bacteria | 1620 |
| 160 | Ga0157376_11420736 | 3300014969 | Bacteria | 726 |
| 161 | Ga0182006_1059895 | 3300015261 | Bacteria | 1440 |
| 162 | Ga0182007_10016882 | 3300015262 | Bacteria | 2682 |
| 163 | Ga0163161_10049692 | 3300017792 | Bacteria | 3032 |
| 164 | Ga0213872_10022498 | 3300021361 | Bacteria | 2903 |
| 165 | Ga0213874_10010369 | 3300021377 | Bacteria | 2332 |
| 166 | Ga0213876_10000244 | 3300021384 | Bacteria | 51875 |
| 167 | Ga0213875_10063678 | 3300021388 | Bacteria | 1724 |
| 168 | Ga0207425_1036708 | 3300025245 | Bacteria | 949 |
| 169 | Ga0209026_1003882 | 3300025250 | Bacteria | 4706 |
| 170 | Ga0209148_1007048 | 3300025254 | Bacteria | 2371 |
| 171 | Ga0209565_1000925 | 3300025263 | Bacteria | 15538 |
| 172 | Ga0209455_1022633 | 3300025272 | Bacteria | 1192 |
| 173 | Ga0209673_1002524 | 3300025273 | Bacteria | 12545 |
| 174 | Ga0209675_1002569 | 3300025291 | Bacteria | 9211 |
| 175 | Ga0209676_1005783 | 3300025292 | Bacteria | 6325 |
| 176 | Ga0209564_1029308 | 3300025295 | Bacteria | 1735 |
| 177 | Ga0209758_1002168 | 3300025297 | Bacteria | 20636 |
| 178 | Ga0209050_1000161 | 3300025298 | Bacteria | 155713 |
| 179 | Ga0209050_1011548 | 3300025298 | Bacteria | 4167 |
| 180 | Ga0209256_1003893 | 3300025299 | Bacteria | 9891 |
| 181 | Ga0209257_1000252 | 3300025304 | Bacteria | 123718 |
| 182 | Ga0209257_1000976 | 3300025304 | Bacteria | 38920 |
| 183 | Ga0209257_1001464 | 3300025304 | Bacteria | 27851 |
| 184 | Ga0209257_1018926 | 3300025304 | Bacteria | 2620 |
| 185 | Ga0207680_10115044 | 3300025903 | Bacteria | 1751 |
| 186 | Ga0207645_10298324 | 3300025907 | Bacteria | 1073 |
| 187 | Ga0207705_10011901 | 3300025909 | Bacteria | 6285 |
| 188 | Ga0207705_10349677 | 3300025909 | Bacteria | 1138 |
| 189 | Ga0207684_10018824 | 3300025910 | Bacteria | 5907 |
| 190 | Ga0207684_10189155 | 3300025910 | Bacteria | 1775 |
| 191 | Ga0207684_10253009 | 3300025910 | Bacteria | 1520 |
| 192 | Ga0207707_10087890 | 3300025912 | Bacteria | 2715 |
| 193 | Ga0207707_10091202 | 3300025912 | Bacteria | 2663 |
| 194 | Ga0207707_10093845 | 3300025912 | Bacteria | 2622 |
| 195 | Ga0207695_10000575 | 3300025913 | Bacteria | 74997 |
| 196 | Ga0207695_10002926 | 3300025913 | Bacteria | 24665 |
| 197 | Ga0207695_10010884 | 3300025913 | Bacteria | 11075 |
| 198 | Ga0207695_10261400 | 3300025913 | Bacteria | 1628 |
| 199 | Ga0207695_10278839 | 3300025913 | Bacteria | 1566 |
| 200 | Ga0207695_10405236 | 3300025913 | Bacteria | 1248 |
| 201 | Ga0207671_10429423 | 3300025914 | Bacteria | 1051 |
| 202 | Ga0207660_10000537 | 3300025917 | Bacteria | 25426 |
| 203 | Ga0207660_10020945 | 3300025917 | Bacteria | 4393 |
| 204 | Ga0207660_10057441 | 3300025917 | Bacteria | 2787 |
| 205 | Ga0207660_10306075 | 3300025917 | Bacteria | 1266 |
| 206 | Ga0207662_10137690 | 3300025918 | Bacteria | 1544 |
| 207 | Ga0207657_10062953 | 3300025919 | Bacteria | 3174 |
| 208 | Ga0207652_10002134 | 3300025921 | Bacteria | 16964 |
| 209 | Ga0207652_10172662 | 3300025921 | Bacteria | 1940 |
| 210 | Ga0207652_10209902 | 3300025921 | Bacteria | 1753 |
| 211 | Ga0207652_10848765 | 3300025921 | Bacteria | 809 |
| 212 | Ga0207646_10047921 | 3300025922 | Bacteria | 3831 |
| 213 | Ga0207646_10172454 | 3300025922 | Bacteria | 1953 |
| 214 | Ga0207681_10265954 | 3300025923 | Bacteria | 1344 |
| 215 | Ga0207694_10078132 | 3300025924 | Bacteria | 2594 |
| 216 | Ga0207694_10127710 | 3300025924 | Bacteria | 2035 |
| 217 | Ga0207694_10260913 | 3300025924 | Bacteria | 1419 |
| 218 | Ga0207694_10655797 | 3300025924 | Bacteria | 884 |
| 219 | Ga0207687_10295051 | 3300025927 | Bacteria | 1304 |
| 220 | Ga0207644_10077748 | 3300025931 | Bacteria | 2444 |
| 221 | Ga0207690_10008937 | 3300025932 | Bacteria | 5947 |
| 222 | Ga0207690_10020126 | 3300025932 | Bacteria | 4119 |
| 223 | Ga0207690_10171669 | 3300025932 | Bacteria | 1625 |
| 224 | Ga0207686_10287032 | 3300025934 | Bacteria | 1217 |
| 225 | Ga0207686_10828929 | 3300025934 | Bacteria | 743 |
| 226 | Ga0207670_10464272 | 3300025936 | Bacteria | 1023 |
| 227 | Ga0207704_10118865 | 3300025938 | Bacteria | 1804 |
| 228 | Ga0207704_10182039 | 3300025938 | Bacteria | 1519 |
| 229 | Ga0207665_10284491 | 3300025939 | Bacteria | 1231 |
| 230 | Ga0207691_10058461 | 3300025940 | Bacteria | 3507 |
| 231 | Ga0207711_10001469 | 3300025941 | Bacteria | 21980 |
| 232 | Ga0207711_10262862 | 3300025941 | Bacteria | 1586 |
| 233 | Ga0207689_10216223 | 3300025942 | Bacteria | 1583 |
| 234 | Ga0207689_10353606 | 3300025942 | Bacteria | 1221 |
| 235 | Ga0207689_10400152 | 3300025942 | Bacteria | 1145 |
| 236 | Ga0207679_10112251 | 3300025945 | Bacteria | 2154 |
| 237 | Ga0207667_10015066 | 3300025949 | Bacteria | 8794 |
| 238 | Ga0207667_10027885 | 3300025949 | Bacteria | 6139 |
| 239 | Ga0207667_10052476 | 3300025949 | Bacteria | 4294 |
| 240 | Ga0207667_10090996 | 3300025949 | Bacteria | 3153 |
| 241 | Ga0207667_10111834 | 3300025949 | Bacteria | 2817 |
| 242 | Ga0207667_10271660 | 3300025949 | Bacteria | 1733 |
| 243 | Ga0207667_10775951 | 3300025949 | Bacteria | 956 |
| 244 | Ga0207651_10115078 | 3300025960 | Bacteria | 2027 |
| 245 | Ga0207651_10737355 | 3300025960 | Bacteria | 870 |
| 246 | Ga0207712_10589183 | 3300025961 | Bacteria | 960 |
| 247 | Ga0207668_10007456 | 3300025972 | Bacteria | 6507 |
| 248 | Ga0207668_10009414 | 3300025972 | Bacteria | 5854 |
| 249 | Ga0207640_10336329 | 3300025981 | Bacteria | 1208 |
| 250 | Ga0207658_10156248 | 3300025986 | Bacteria | 1864 |
| 251 | Ga0207658_10481321 | 3300025986 | Bacteria | 1103 |
| 252 | Ga0207677_10372997 | 3300026023 | Bacteria | 1202 |
| 253 | Ga0207703_10345430 | 3300026035 | Bacteria | 1369 |
| 254 | Ga0207639_10043283 | 3300026041 | Bacteria | 3379 |
| 255 | Ga0207639_10668327 | 3300026041 | Bacteria | 962 |
| 256 | Ga0207639_10779429 | 3300026041 | Bacteria | 890 |
| 257 | Ga0207678_10344400 | 3300026067 | Bacteria | 1285 |
| 258 | Ga0207641_10076518 | 3300026088 | Bacteria | 2893 |
| 259 | Ga0207641_10338847 | 3300026088 | Bacteria | 1430 |
| 260 | Ga0207641_10984954 | 3300026088 | Bacteria | 839 |
| 261 | Ga0207648_10243841 | 3300026089 | Bacteria | 1600 |
| 262 | Ga0207648_10290341 | 3300026089 | Bacteria | 1464 |
| 263 | Ga0207648_10704366 | 3300026089 | Bacteria | 936 |
| 264 | Ga0207676_10243784 | 3300026095 | Bacteria | 1614 |
| 265 | Ga0207674_10030807 | 3300026116 | Bacteria | 5638 |
| 266 | Ga0207674_10267714 | 3300026116 | Bacteria | 1656 |
| 267 | Ga0207675_100156692 | 3300026118 | Bacteria | 2170 |
| 268 | Ga0207683_10319561 | 3300026121 | Bacteria | 1422 |
| 269 | Ga0207698_10868870 | 3300026142 | Bacteria | 908 |
| 270 | Ga0207698_11415608 | 3300026142 | Bacteria | 710 |
| 271 | Ga0209999_1001367 | 3300027543 | Bacteria | 4179 |
| 272 | Ga0209983_1004172 | 3300027665 | Bacteria | 3047 |
| 273 | Ga0209588_1020292 | 3300027671 | Bacteria | 2081 |
| 274 | Ga0209966_1000144 | 3300027695 | Bacteria | 30303 |
| 275 | Ga0209998_10004274 | 3300027717 | Bacteria | 3045 |
| 276 | Ga0268266_10000106 | 3300028379 | Bacteria | 175109 |
| 277 | Ga0268266_10084163 | 3300028379 | Bacteria | 2777 |
| 278 | Ga0268266_10355576 | 3300028379 | Bacteria | 1377 |
| 279 | Ga0268266_10854051 | 3300028379 | Bacteria | 880 |
| 280 | Ga0268265_10019588 | 3300028380 | Bacteria | 4706 |
| 281 | Ga0268265_10100736 | 3300028380 | Bacteria | 2332 |
| 282 | Ga0268264_10002325 | 3300028381 | Bacteria | 16817 |
| 283 | Ga0265337_1095959 | 3300028556 | Bacteria | 807 |
| 284 | Ga0265323_10010371 | 3300028653 | Bacteria | 3779 |
| 285 | Ga0307517_10029956 | 3300028786 | Bacteria | 6401 |
| 286 | Ga0307515_10496074 | 3300028794 | Bacteria | 832 |
| 287 | Ga0307515_10510219 | 3300028794 | Bacteria | 812 |
| 288 | Ga0265324_10052753 | 3300029957 | Bacteria | 1397 |
| 289 | Ga0307511_10006537 | 3300030521 | Bacteria | 11736 |
| 290 | Ga0265330_10000448 | 3300031235 | Bacteria | 27585 |
| 291 | Ga0265330_10000630 | 3300031235 | Bacteria | 22756 |
| 292 | Ga0265330_10184817 | 3300031235 | Bacteria | 882 |
| 293 | Ga0265328_10022952 | 3300031239 | Bacteria | 2369 |
| 294 | Ga0265325_10002701 | 3300031241 | Bacteria | 11857 |
| 295 | Ga0265329_10000002 | 3300031242 | Bacteria | 121896 |
| 296 | Ga0265327_10000381 | 3300031251 | Bacteria | 83617 |
| 297 | Ga0265316_10000017 | 3300031344 | Bacteria | 198446 |
| 298 | Ga0265316_10016358 | 3300031344 | Bacteria | 6435 |
| 299 | Ga0265316_10409607 | 3300031344 | Bacteria | 976 |
| 300 | Ga0307513_10002446 | 3300031456 | Bacteria | 25748 |
| 301 | Ga0307513_10430701 | 3300031456 | Bacteria | 1047 |
| 302 | Ga0307408_101083653 | 3300031548 | Bacteria | 742 |
| 303 | Ga0265313_10019566 | 3300031595 | Bacteria | 3763 |
| 304 | Ga0265314_10000273 | 3300031711 | Bacteria | 75436 |
| 305 | Ga0265314_10039085 | 3300031711 | Bacteria | 3421 |
| 306 | Ga0265342_10001365 | 3300031712 | Bacteria | 22838 |
| 307 | Ga0265342_10329002 | 3300031712 | Bacteria | 799 |
| 308 | Ga0307516_10001565 | 3300031730 | Bacteria | 31484 |
| 309 | Ga0307413_10002271 | 3300031824 | Bacteria | 7767 |
| 310 | Ga0307413_10189895 | 3300031824 | Bacteria | 1474 |
| 311 | Ga0307406_10161829 | 3300031901 | Bacteria | 1610 |
| 312 | Ga0307407_10944313 | 3300031903 | Bacteria | 664 |
| 313 | Ga0307409_100528370 | 3300031995 | Bacteria | 1154 |
| 314 | Ga0307416_101432627 | 3300032002 | Bacteria | 797 |
| 315 | Ga0307414_10065490 | 3300032004 | Bacteria | 2593 |
| 316 | Ga0307414_10117659 | 3300032004 | Bacteria | 2036 |
| 317 | Ga0307414_11186768 | 3300032004 | Bacteria | 706 |
| 318 | Ga0307510_10013765 | 3300033180 | Bacteria | 9588 |
| 319 | Ga0307510_10438279 | 3300033180 | Bacteria | 748 |
| 320 | Ga0373936_0004112 | 3300035113 | Bacteria | 5483 |
| 321 | Ga0373943_0107086 | 3300035170 | Bacteria | 1470 |
| 322 | Ga0373946_0106332 | 3300035171 | Bacteria | 1264 |
| 323 | Ga0373955_0304760 | 3300035172 | Bacteria | 961 |
| 324 | Ga0373935_0264923 | 3300035692 | Bacteria | 1206 |
| 325 | Ga0373935_0333273 | 3300035692 | Bacteria | 1079 |
| 326 | Ga0373927_0000479 | 3300035695 | Bacteria | 30749 |
| 327 | Ga0373927_0044490 | 3300035695 | Bacteria | 2873 |
| 328 | Ga0373937_0040264 | 3300036401 | Bacteria | 4259 |
| 329 | Ga0373937_0579078 | 3300036401 | Bacteria | 1066 |
| 330 | Ga0373925_0000023 | 3300037068 | Bacteria | 158881 |
| 331 | Ga0395899_0000105 | 3300037312 | Bacteria | 146163 |
| 332 | Ga0395899_0001195 | 3300037312 | Bacteria | 22830 |
| 333 | Ga0395899_0025758 | 3300037312 | Bacteria | 4439 |
| 334 | Ga0395899_0143516 | 3300037312 | Bacteria | 1697 |
| 335 | Ga0395900_0006999 | 3300037418 | Bacteria | 11682 |
| 336 | Ga0395900_0058480 | 3300037418 | Bacteria | 3968 |
| 337 | Ga0395900_0100801 | 3300037418 | Bacteria | 2966 |
| 338 | Ga0395898_0004322 | 3300037466 | Bacteria | 15569 |
| 339 | Ga0395898_0073715 | 3300037466 | Bacteria | 3298 |
| 340 | Ga0395898_0118890 | 3300037466 | Bacteria | 2531 |
| 341 | Ga0395898_0489457 | 3300037466 | Bacteria | 1170 |
| 342 | Ga0395905_0006270 | 3300037471 | Bacteria | 12003 |
| 343 | Ga0395905_0130813 | 3300037471 | Bacteria | 2360 |
| 344 | Ga0395905_0173211 | 3300037471 | Bacteria | 2027 |
| 345 | Ga0395905_0198482 | 3300037471 | Bacteria | 1881 |
| 346 | Ga0316581_0001366 | 3300037588 | Bacteria | 5439 |
| 347 | Ga0436364_1483493 | 3300037853 | Bacteria | 5443 |
| 348 | Ga0395901_0000342 | 3300038443 | Bacteria | 56754 |
| 349 | Ga0395901_0658043 | 3300038443 | Bacteria | 1050 |
| 350 | Ga0436365_0376847 | 3300039437 | Bacteria | 89580 |
| 351 | Ga0436360_0034851 | 3300039438 | Bacteria | 2025 |
| 352 | Ga0436360_0523945 | 3300039438 | Bacteria | 1107 |
| 353 | Ga0436361_0356944 | 3300039447 | Bacteria | 1001 |
| 354 | Ga0436361_0953537 | 3300039447 | Bacteria | 44604 |
| 355 | Ga0436363_0101867 | 3300039450 | Bacteria | 3467 |
| 356 | Ga0436362_0403796 | 3300039453 | Bacteria | 710 |
| 357 | Ga0439461_0004190 | 3300041410 | Bacteria | 2397 |
| 358 | Ga0451795_1108070 | 3300041456 | Bacteria | 3240 |
| 359 | Ga0451805_122127 | 3300041461 | Bacteria | 959 |
| 360 | Ga0451833_1326391 | 3300041491 | Bacteria | 1489 |
| 361 | Ga0439431_0031081 | 3300041997 | Bacteria | 1326 |
| 362 | Ga0439448_0164523 | 3300042005 | Bacteria | 773 |
| 363 | Ga0450890_015214 | 3300042127 | Bacteria | 1012 |
| 364 | Ga0439446_0004827 | 3300042156 | Bacteria | 3436 |
| 365 | Ga0439434_0073528 | 3300042435 | Bacteria | 1078 |
| 366 | Ga0439435_0023237 | 3300042436 | Bacteria | 1626 |
| 367 | Ga0451577_0074847 | 3300042876 | Bacteria | 3020 |
| 368 | Ga0453683_0072457 | 3300044673 | Bacteria | 2156 |
| 369 | Ga0453683_0198527 | 3300044673 | Bacteria | 1274 |
| 370 | Ga0466965_0197136 | 3300044683 | Bacteria | 1067 |
| 371 | Ga0466961_0161559 | 3300044693 | Bacteria | 1396 |
| 372 | Ga0466961_0347676 | 3300044693 | Bacteria | 903 |
| 373 | Ga0453684_0443333 | 3300044712 | Bacteria | 1446 |
| 374 | Ga0453684_0464818 | 3300044712 | Bacteria | 1406 |
| 375 | Ga0466970_0276276 | 3300044765 | Bacteria | 944 |
| 376 | Ga0466957_0145584 | 3300044842 | Bacteria | 1529 |
| 377 | Ga0466959_0036896 | 3300045049 | Bacteria | 3611 |
| 378 | Ga0451576_0189778 | 3300045051 | Bacteria | 2146 |
| 379 | Ga0451576_0223680 | 3300045051 | Bacteria | 1965 |
| 380 | Ga0495627_000399 | 3300046453 | Bacteria | 38947 |
| 381 | Ga0495638_0035321 | 3300046460 | Bacteria | 3187 |
| 382 | Ga0495638_0247712 | 3300046460 | Bacteria | 983 |
| 383 | Ga0495638_0349384 | 3300046460 | Bacteria | 781 |
| 384 | Ga0495650_0001571 | 3300046471 | Bacteria | 21474 |
| 385 | Ga0495580_0436143 | 3300046472 | Bacteria | 880 |
| 386 | Ga0495605_0073285 | 3300046474 | Bacteria | 1613 |
| 387 | Ga0495584_0103560 | 3300046491 | Bacteria | 1439 |
| 388 | Ga0495584_0107787 | 3300046491 | Bacteria | 1409 |
| 389 | Ga0495585_0186838 | 3300046492 | Bacteria | 1062 |
| 390 | Ga0495607_0080713 | 3300046501 | Bacteria | 1788 |
| 391 | Ga0495583_0000650 | 3300046506 | Bacteria | 45814 |
| 392 | Ga0495620_0067424 | 3300046515 | Bacteria | 1472 |
| 393 | Ga0495628_0109267 | 3300046516 | Bacteria | 2128 |
| 394 | Ga0495632_0041761 | 3300046519 | Bacteria | 2302 |
| 395 | Ga0495663_0008611 | 3300046525 | Bacteria | 2830 |
| 396 | Ga0495642_0008396 | 3300046528 | Bacteria | 3952 |
| 397 | Ga0495654_0006712 | 3300046530 | Bacteria | 6511 |
| 398 | Ga0495621_0010211 | 3300046539 | Bacteria | 2867 |
| 399 | Ga0495621_0041413 | 3300046539 | Bacteria | 1617 |
| 400 | Ga0495597_0147433 | 3300046542 | Bacteria | 967 |
| 401 | Ga0495645_0201028 | 3300046543 | Bacteria | 1352 |
| 402 | Ga0495656_0202473 | 3300046615 | Bacteria | 986 |
| 403 | Ga0495668_0001504 | 3300046616 | Bacteria | 22287 |
| 404 | Ga0495668_0049463 | 3300046616 | Bacteria | 2331 |
| 405 | Ga0495668_0064267 | 3300046616 | Bacteria | 2020 |
| 406 | Ga0495668_0100670 | 3300046616 | Bacteria | 1581 |
| 407 | Ga0495611_0005291 | 3300046648 | Bacteria | 5527 |
| 408 | Ga0495625_0001925 | 3300046660 | Bacteria | 23466 |
| 409 | Ga0495625_0052545 | 3300046660 | Bacteria | 2917 |
| 410 | Ga0495625_0132573 | 3300046660 | Bacteria | 1687 |
| 411 | Ga0495625_0167562 | 3300046660 | Bacteria | 1468 |
| 412 | Ga0495659_0002869 | 3300046664 | Bacteria | 5535 |
| 413 | Ga0495659_0025307 | 3300046664 | Bacteria | 2031 |
| 414 | Ga0495588_0052430 | 3300046674 | Bacteria | 2103 |
| 415 | Ga0495623_0209758 | 3300046679 | Bacteria | 1116 |
| 416 | Ga0495658_0304985 | 3300046683 | Bacteria | 1008 |
| 417 | Ga0495669_0000371 | 3300046684 | Bacteria | 22866 |
| 418 | Ga0495669_0312870 | 3300046684 | Bacteria | 757 |
| 419 | Ga0495670_0037453 | 3300046691 | Bacteria | 2417 |
| 420 | Ga0495670_0445491 | 3300046691 | Bacteria | 701 |
| 421 | Ga0495671_0240579 | 3300046692 | Bacteria | 874 |
| 422 | Ga0495660_0154465 | 3300046810 | Bacteria | 1130 |
| 423 | Ga0495636_0006624 | 3300047318 | Bacteria | 4554 |
| 424 | Ga0495674_0099850 | 3300047319 | Bacteria | 2471 |
| 425 | Ga0495674_0589126 | 3300047319 | Bacteria | 882 |
| 426 | Ga0495672_0000439 | 3300047320 | Bacteria | 49666 |
| 427 | Ga0495683_0065427 | 3300047323 | Bacteria | 1793 |
| 428 | Ga0495677_0183390 | 3300047445 | Bacteria | 811 |
| 429 | Ga0495679_029031 | 3300047446 | Bacteria | 1807 |
| 430 | Ga0495685_063236 | 3300047447 | Bacteria | 1245 |
| 431 | Ga0495673_0000189 | 3300047469 | Bacteria | 99018 |
| 432 | Ga0495681_0056388 | 3300047470 | Bacteria | 1828 |
| 433 | Ga0495681_0076275 | 3300047470 | Bacteria | 1507 |
| 434 | Ga0495686_0007469 | 3300047472 | Bacteria | 8189 |
| 435 | Ga0495686_0029450 | 3300047472 | Bacteria | 3571 |
| 436 | Ga0495686_0098679 | 3300047472 | Bacteria | 1764 |
| 437 | Ga0496101_0023677 | 3300048904 | Bacteria | 4244 |
| 438 | Ga0496101_0127092 | 3300048904 | Bacteria | 1933 |
| 439 | Ga0496102_0081834 | 3300048905 | Bacteria | 2978 |
| 440 | Ga0496103_0050032 | 3300048906 | Bacteria | 2585 |
| 441 | Ga0496104_0162799 | 3300048907 | Bacteria | 2140 |
| 442 | Ga0496106_0014990 | 3300048909 | Bacteria | 5735 |
| 443 | Ga0496107_0000073 | 3300048910 | Bacteria | 48489 |
| 444 | Ga0496107_0049382 | 3300048910 | Bacteria | 3032 |
| 445 | Ga0496109_0080902 | 3300048912 | Bacteria | 2993 |
| 446 | Ga0496110_0276694 | 3300048913 | Bacteria | 1528 |
| 447 | Ga0496112_0033003 | 3300048915 | Bacteria | 5027 |
| 448 | Ga0496126_0067161 | 3300048929 | Bacteria | 3204 |
| 449 | Ga0501306_017130 | 3300049127 | Bacteria | 980 |
| 450 | Ga0501309_044877 | 3300049129 | Bacteria | 683 |
| 451 | Ga0501310_005520 | 3300049130 | Bacteria | 1300 |
| 452 | Ga0501304_020739 | 3300049160 | Bacteria | 649 |
| 453 | Ga0501307_005954 | 3300049162 | Bacteria | 1301 |
| 454 | Ga0495678_005077 | 3300049459 | Bacteria | 7394 |
| 455 | Ga0501311_003804 | 3300049527 | Bacteria | 1571 |
| 456 | Ga0501320_003371 | 3300049536 | Bacteria | 1350 |
| 457 | Ga0501323_002040 | 3300049539 | Bacteria | 1907 |
| 458 | Ga0501323_015869 | 3300049539 | Bacteria | 955 |
| 459 | Ga0501324_011699 | 3300049540 | Bacteria | 814 |
| 460 | Ga0501325_011787 | 3300049541 | Bacteria | 814 |
| 461 | Ga0501032_0107042 | 3300049569 | Bacteria | 1852 |
| 462 | Ga0501037_0035888 | 3300049573 | Bacteria | 3653 |
| 463 | Ga0501047_0252100 | 3300049581 | Bacteria | 1613 |
| 464 | Ga0501257_005035 | 3300049686 | Bacteria | 2899 |
| 465 | Ga0501081_0363781 | 3300049743 | Bacteria | 1067 |
| 466 | Ga0501241_027104 | 3300049758 | Bacteria | 1071 |
| 467 | Ga0501274_010889 | 3300049771 | Bacteria | 844 |
| 468 | Ga0501035_0118771 | 3300049822 | Bacteria | 2313 |
| 469 | Ga0501044_0008183 | 3300049823 | Bacteria | 11476 |
| 470 | Ga0501044_0130572 | 3300049823 | Bacteria | 2506 |
| 471 | Ga0501044_0304517 | 3300049823 | Bacteria | 1521 |
| 472 | nmdc:mga03n38_31920_c1 | 3300050490 | Bacteria | 2227 |
| 473 | nmdc:mga0k408_11918_c1 | 3300050493 | Bacteria | 4743 |
| 474 | nmdc:mga0k408_176476_c1 | 3300050493 | Bacteria | 1274 |
| 475 | nmdc:mga07m45_86829_c1 | 3300050496 | Bacteria | 1790 |
| 476 | Ga0495619_0362106 | 3300053085 | Bacteria | 1003 |
| 477 | Ga0500578_0000459 | 3300053086 | Bacteria | 49572 |
| 478 | Ga0500644_0000193 | 3300053088 | Bacteria | 37831 |
| 479 | Ga0500646_0022126 | 3300053090 | Bacteria | 1699 |
| 480 | Ga0500566_0065996 | 3300053094 | Bacteria | 2040 |
| 481 | Ga0500641_0010127 | 3300053096 | Bacteria | 3400 |
| 482 | Ga0500554_011267 | 3300053102 | Bacteria | 2209 |
| 483 | Ga0500556_0001077 | 3300053104 | Bacteria | 13785 |
| 484 | Ga0500562_000644 | 3300053108 | Bacteria | 8433 |
| 485 | Ga0500562_004235 | 3300053108 | Bacteria | 3627 |
| 486 | Ga0500594_0004036 | 3300053118 | Bacteria | 3230 |
| 487 | Ga0500614_026739 | 3300053123 | Bacteria | 1381 |
| 488 | Ga0500618_000703 | 3300053125 | Bacteria | 19670 |
| 489 | Ga0500658_0000930 | 3300053134 | Bacteria | 11933 |
| 490 | Ga0500559_0001398 | 3300053136 | Bacteria | 13721 |
| 491 | Ga0500577_0005365 | 3300053142 | Bacteria | 3450 |
| 492 | Ga0500616_0183125 | 3300053153 | Bacteria | 941 |
| 493 | Ga0500622_0000771 | 3300053156 | Bacteria | 27846 |
| 494 | Ga0500622_0011085 | 3300053156 | Bacteria | 4920 |
| 495 | Ga0500622_0069509 | 3300053156 | Bacteria | 1783 |
| 496 | Ga0500627_0001516 | 3300053158 | Bacteria | 6534 |
| 497 | Ga0500627_0133540 | 3300053158 | Bacteria | 1121 |
| 498 | Ga0500611_006082 | 3300053727 | Bacteria | 1738 |
| 499 | Ga0500645_002894 | 3300053730 | Bacteria | 7334 |
| 500 | Ga0500645_005668 | 3300053730 | Bacteria | 4561 |
| 501 | Ga0500609_000093 | 3300053731 | Bacteria | 11592 |
| 502 | Ga0500661_008301 | 3300055283 | Bacteria | 1910 |
| 503 | Ga0587070_084895 | 3300059491 | Bacteria | 702 |
| 504 | Ga0587077_046479 | 3300059493 | Bacteria | 892 |
| 505 | Ga0587086_006705 | 3300059507 | Bacteria | 1296 |
| 506 | Ga0587090_105505 | 3300059510 | Bacteria | 595 |
| 507 | Ga0587079_018207 | 3300059647 | Bacteria | 1228 |
| 508 | Ga0587107_070100 | 3300059652 | Bacteria | 638 |
| 509 | Ga0587071_002314 | 3300060344 | Bacteria | 2569 |
| 510 | Ga0587111_0051386 | 3300060346 | Bacteria | 911 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031235 | Ga0265330_10000630 | Ga0265330_1000063021 | 158 |
| 2 | 3300031711 | Ga0265314_10039085 | Ga0265314_100390854 | 158 |
| 3 | 3300031712 | Ga0265342_10329002 | Ga0265342_103290021 | 170 |
| 4 | 3300049539 | Ga0501323_002040 | Ga0501323_002040_714_1241 | 175 |
| 5 | 3300005563 | Ga0068855_100134274 | Ga0068855_1001342743 | 176 |
| 6 | 3300025949 | Ga0207667_10111834 | Ga0207667_101118346 | 176 |
| 7 | 3300035692 | Ga0373935_0264923 | Ga0373935_0264923_141_671 | 176 |
| 8 | 3300047319 | Ga0495674_0589126 | Ga0495674_0589126_203_733 | 176 |
| 9 | 3300027695 | Ga0209966_1000144 | Ga0209966_100014426 | 177 |
| 10 | 3300027717 | Ga0209998_10004274 | Ga0209998_100042744 | 177 |
| 11 | 3300049771 | Ga0501274_010889 | Ga0501274_010889_167_700 | 177 |
| 12 | 3300049686 | Ga0501257_005035 | Ga0501257_005035_944_1480 | 178 |
| 13 | 3300049823 | Ga0501044_0304517 | Ga0501044_0304517_204_740 | 178 |
| 14 | 3300005467 | Ga0070706_100257817 | Ga0070706_1002578172 | 179 |
| 15 | 3300005471 | Ga0070698_100166769 | Ga0070698_1001667694 | 179 |
| 16 | 3300041456 | Ga0451795_1108070 | Ga0451795_1108070_992_1531 | 179 |
| 17 | 3300046543 | Ga0495645_0201028 | Ga0495645_0201028_706_1245 | 179 |
| 18 | 3300046679 | Ga0495623_0209758 | Ga0495623_0209758_451_993 | 179 |
| 19 | 3300005289 | Ga0065704_10522003 | Ga0065704_105220031 | 180 |
| 20 | 3300005334 | Ga0068869_100545302 | Ga0068869_1005453022 | 180 |
| 21 | 3300005340 | Ga0070689_100248082 | Ga0070689_1002480821 | 180 |
| 22 | 3300005343 | Ga0070687_100199134 | Ga0070687_1001991341 | 180 |
| 23 | 3300005364 | Ga0070673_100258556 | Ga0070673_1002585562 | 180 |
| 24 | 3300005440 | Ga0070705_100208381 | Ga0070705_1002083811 | 180 |
| 25 | 3300005549 | Ga0070704_100022859 | Ga0070704_1000228597 | 180 |
| 26 | 3300005577 | Ga0068857_100344175 | Ga0068857_1003441753 | 180 |
| 27 | 3300005578 | Ga0068854_100152680 | Ga0068854_1001526803 | 180 |
| 28 | 3300005617 | Ga0068859_100040039 | Ga0068859_1000400396 | 180 |
| 29 | 3300005844 | Ga0068862_100260426 | Ga0068862_1002604262 | 180 |
| 30 | 3300006931 | Ga0097620_100040040 | Ga0097620_1000400407 | 180 |
| 31 | 3300007265 | Ga0099794_10018500 | Ga0099794_100185001 | 180 |
| 32 | 3300009553 | Ga0105249_10183418 | Ga0105249_101834182 | 180 |
| 33 | 3300025910 | Ga0207684_10189155 | Ga0207684_101891552 | 180 |
| 34 | 3300025918 | Ga0207662_10137690 | Ga0207662_101376902 | 180 |
| 35 | 3300025942 | Ga0207689_10216223 | Ga0207689_102162231 | 180 |
| 36 | 3300025960 | Ga0207651_10737355 | Ga0207651_107373552 | 180 |
| 37 | 3300025961 | Ga0207712_10589183 | Ga0207712_105891832 | 180 |
| 38 | 3300025981 | Ga0207640_10336329 | Ga0207640_103363291 | 180 |
| 39 | 3300026116 | Ga0207674_10030807 | Ga0207674_100308078 | 180 |
| 40 | 3300036401 | Ga0373937_0040264 | Ga0373937_0040264_2726_3268 | 180 |
| 41 | 3300036401 | Ga0373937_0579078 | Ga0373937_0579078_376_918 | 180 |
| 42 | 3300042876 | Ga0451577_0074847 | Ga0451577_0074847_2138_2683 | 180 |
| 43 | 3300044673 | Ga0453683_0072457 | Ga0453683_0072457_20_565 | 180 |
| 44 | 3300044712 | Ga0453684_0443333 | Ga0453684_0443333_646_1191 | 180 |
| 45 | 3300044712 | Ga0453684_0464818 | Ga0453684_0464818_43_588 | 180 |
| 46 | 3300045051 | Ga0451576_0189778 | Ga0451576_0189778_525_1070 | 180 |
| 47 | 3300045051 | Ga0451576_0223680 | Ga0451576_0223680_127_672 | 180 |
| 48 | 3300053085 | Ga0495619_0362106 | Ga0495619_0362106_291_833 | 180 |
| 49 | 3300005468 | Ga0070707_100932845 | Ga0070707_1009328452 | 181 |
| 50 | 3300044673 | Ga0453683_0198527 | Ga0453683_0198527_565_1110 | 181 |
| 51 | iso_pu_bacteria | 2510917020 | 2511120799 | 181 |
| 52 | iso_pu_bacteria | 2582581279 | 2585150061 | 181 |
| 53 | iso_pu_bacteria | 2582581280 | 2585155416 | 181 |
| 54 | iso_pu_bacteria | 2582581293 | 2585199200 | 181 |
| 55 | iso_pu_bacteria | 2643221552 | 2643781697 | 181 |
| 56 | iso_pu_bacteria | 2643221583 | 2643926346 | 181 |
| 57 | iso_pu_bacteria | 2643221584 | 2643931637 | 181 |
| 58 | iso_pu_bacteria | 2643221640 | 2644226553 | 181 |
| 59 | iso_pu_bacteria | 2643221642 | 2644236041 | 181 |
| 60 | iso_pu_bacteria | 2791355048 | 2792463722 | 181 |
| 61 | iso_pu_bacteria | 2818991435 | 2819536853 | 181 |
| 62 | iso_pu_bacteria | 2818991454 | 2819646014 | 181 |
| 63 | iso_pu_bacteria | 2843744320 | 2843747096 | 181 |
| 64 | iso_pu_bacteria | 2849560528 | 2849560635 | 181 |
| 65 | iso_pu_bacteria | 2849573788 | 2849578476 | 181 |
| 66 | iso_pu_bacteria | 2851153111 | 2851154281 | 181 |
| 67 | iso_pu_bacteria | 2898329390 | 2898331315 | 181 |
| 68 | 3300005445 | Ga0070708_100056794 | Ga0070708_1000567943 | 182 |
| 69 | 3300005467 | Ga0070706_100156537 | Ga0070706_1001565372 | 182 |
| 70 | 3300005468 | Ga0070707_100012141 | Ga0070707_10001214110 | 182 |
| 71 | 3300005468 | Ga0070707_100142997 | Ga0070707_1001429971 | 182 |
| 72 | 3300005471 | Ga0070698_100023930 | Ga0070698_1000239306 | 182 |
| 73 | 3300005536 | Ga0070697_100200597 | Ga0070697_1002005973 | 182 |
| 74 | 3300025910 | Ga0207684_10018824 | Ga0207684_100188246 | 182 |
| 75 | 3300025910 | Ga0207684_10253009 | Ga0207684_102530094 | 182 |
| 76 | 3300025922 | Ga0207646_10047921 | Ga0207646_100479212 | 182 |
| 77 | 3300025922 | Ga0207646_10172454 | Ga0207646_101724542 | 182 |
| 78 | 3300025939 | Ga0207665_10284491 | Ga0207665_102844912 | 182 |
| 79 | 3300028653 | Ga0265323_10010371 | Ga0265323_100103718 | 182 |
| 80 | 3300029957 | Ga0265324_10052753 | Ga0265324_100527533 | 182 |
| 81 | 3300031235 | Ga0265330_10000448 | Ga0265330_1000044823 | 182 |
| 82 | 3300031235 | Ga0265330_10184817 | Ga0265330_101848172 | 182 |
| 83 | 3300031239 | Ga0265328_10022952 | Ga0265328_100229524 | 182 |
| 84 | 3300031241 | Ga0265325_10002701 | Ga0265325_1000270116 | 182 |
| 85 | 3300031242 | Ga0265329_10000002 | Ga0265329_1000000230 | 182 |
| 86 | 3300031344 | Ga0265316_10000017 | Ga0265316_1000001796 | 182 |
| 87 | 3300031344 | Ga0265316_10016358 | Ga0265316_1001635810 | 182 |
| 88 | 3300031344 | Ga0265316_10409607 | Ga0265316_104096072 | 182 |
| 89 | 3300031595 | Ga0265313_10019566 | Ga0265313_100195665 | 182 |
| 90 | 3300031711 | Ga0265314_10000273 | Ga0265314_1000027310 | 182 |
| 91 | 3300031712 | Ga0265342_10001365 | Ga0265342_1000136523 | 182 |
| 92 | 3300049130 | Ga0501310_005520 | Ga0501310_005520_581_1135 | 182 |
| 93 | iso_pu_bacteria | 2643221598 | 2643997895 | 182 |
| 94 | iso_pu_bacteria | 2643221614 | 2644088889 | 182 |
| 95 | iso_pu_bacteria | 2643221661 | 2644342251 | 182 |
| 96 | iso_pu_bacteria | 2643221666 | 2644369634 | 182 |
| 97 | 3300037588 | Ga0316581_0001366 | Ga0316581_0001366_2460_3017 | 183 |
| 98 | 3300039438 | Ga0436360_0523945 | Ga0436360_0523945_156_713 | 184 |
| 99 | 3300060346 | Ga0587111_0051386 | Ga0587111_0051386_169_726 | 184 |
| 100 | 3300003308 | Ga0006777J48905_1080577 | Ga0006777J48905_10805777 | 185 |
| 101 | 3300003559 | Ga0007427J51700_108234 | Ga0007427J51700_10823410 | 185 |
| 102 | 3300003693 | Ga0032354_1028809 | Ga0032354_10288093 | 185 |
| 103 | 3300003771 | Ga0055526_1035022 | Ga0055526_10350222 | 185 |
| 104 | 3300003773 | Ga0055537_1001243 | Ga0055537_100124310 | 185 |
| 105 | 3300003775 | Ga0055524_1030115 | Ga0055524_10301152 | 185 |
| 106 | 3300003784 | Ga0055534_1036957 | Ga0055534_10369571 | 185 |
| 107 | 3300003790 | Ga0055528_1008934 | Ga0055528_10089348 | 185 |
| 108 | 3300003790 | Ga0055528_1029848 | Ga0055528_10298484 | 185 |
| 109 | 3300004625 | Ga0055543_1026803 | Ga0055543_10268032 | 185 |
| 110 | 3300004800 | Ga0058861_11906893 | Ga0058861_119068932 | 185 |
| 111 | 3300005262 | Ga0065165_1002762 | Ga0065165_100276218 | 185 |
| 112 | 3300005327 | Ga0070658_10233633 | Ga0070658_102336333 | 185 |
| 113 | 3300005366 | Ga0070659_100018511 | Ga0070659_1000185111 | 185 |
| 114 | 3300005455 | Ga0070663_100067254 | Ga0070663_1000672547 | 185 |
| 115 | 3300005458 | Ga0070681_10571033 | Ga0070681_105710332 | 185 |
| 116 | 3300005548 | Ga0070665_100166338 | Ga0070665_1001663385 | 185 |
| 117 | 3300005563 | Ga0068855_100067956 | Ga0068855_1000679565 | 185 |
| 118 | 3300005563 | Ga0068855_100261493 | Ga0068855_1002614932 | 185 |
| 119 | 3300005564 | Ga0070664_100064671 | Ga0070664_1000646713 | 185 |
| 120 | 3300005616 | Ga0068852_100592161 | Ga0068852_1005921613 | 185 |
| 121 | 3300009093 | Ga0105240_10000798 | Ga0105240_1000079816 | 185 |
| 122 | 3300009093 | Ga0105240_10013835 | Ga0105240_100138359 | 185 |
| 123 | 3300009093 | Ga0105240_10188429 | Ga0105240_101884293 | 185 |
| 124 | 3300010375 | Ga0105239_10587410 | Ga0105239_105874103 | 185 |
| 125 | 3300013104 | Ga0157370_10022671 | Ga0157370_100226719 | 185 |
| 126 | 3300013105 | Ga0157369_10931785 | Ga0157369_109317852 | 185 |
| 127 | 3300013307 | Ga0157372_10050145 | Ga0157372_1005014511 | 185 |
| 128 | 3300014326 | Ga0157380_10558028 | Ga0157380_105580282 | 185 |
| 129 | 3300015261 | Ga0182006_1059895 | Ga0182006_10598953 | 185 |
| 130 | 3300021377 | Ga0213874_10010369 | Ga0213874_100103693 | 185 |
| 131 | 3300021384 | Ga0213876_10000244 | Ga0213876_1000024415 | 185 |
| 132 | 3300021388 | Ga0213875_10063678 | Ga0213875_100636784 | 185 |
| 133 | 3300025254 | Ga0209148_1007048 | Ga0209148_10070481 | 185 |
| 134 | 3300025263 | Ga0209565_1000925 | Ga0209565_100092512 | 185 |
| 135 | 3300025272 | Ga0209455_1022633 | Ga0209455_10226333 | 185 |
| 136 | 3300025273 | Ga0209673_1002524 | Ga0209673_100252417 | 185 |
| 137 | 3300025291 | Ga0209675_1002569 | Ga0209675_100256914 | 185 |
| 138 | 3300025292 | Ga0209676_1005783 | Ga0209676_10057832 | 185 |
| 139 | 3300025295 | Ga0209564_1029308 | Ga0209564_10293083 | 185 |
| 140 | 3300025298 | Ga0209050_1011548 | Ga0209050_10115482 | 185 |
| 141 | 3300025299 | Ga0209256_1003893 | Ga0209256_100389315 | 185 |
| 142 | 3300025304 | Ga0209257_1000976 | Ga0209257_100097639 | 185 |
| 143 | 3300025304 | Ga0209257_1001464 | Ga0209257_100146438 | 185 |
| 144 | 3300025909 | Ga0207705_10349677 | Ga0207705_103496772 | 185 |
| 145 | 3300025912 | Ga0207707_10093845 | Ga0207707_100938457 | 185 |
| 146 | 3300025913 | Ga0207695_10002926 | Ga0207695_1000292624 | 185 |
| 147 | 3300025913 | Ga0207695_10010884 | Ga0207695_100108847 | 185 |
| 148 | 3300025913 | Ga0207695_10405236 | Ga0207695_104052362 | 185 |
| 149 | 3300025917 | Ga0207660_10020945 | Ga0207660_100209456 | 185 |
| 150 | 3300025917 | Ga0207660_10306075 | Ga0207660_103060752 | 185 |
| 151 | 3300025921 | Ga0207652_10209902 | Ga0207652_102099025 | 185 |
| 152 | 3300025921 | Ga0207652_10848765 | Ga0207652_108487652 | 185 |
| 153 | 3300025924 | Ga0207694_10655797 | Ga0207694_106557972 | 185 |
| 154 | 3300025932 | Ga0207690_10020126 | Ga0207690_100201261 | 185 |
| 155 | 3300025949 | Ga0207667_10027885 | Ga0207667_100278857 | 185 |
| 156 | 3300025949 | Ga0207667_10271660 | Ga0207667_102716603 | 185 |
| 157 | 3300025986 | Ga0207658_10481321 | Ga0207658_104813213 | 185 |
| 158 | 3300026067 | Ga0207678_10344400 | Ga0207678_103444003 | 185 |
| 159 | 3300028379 | Ga0268266_10854051 | Ga0268266_108540512 | 185 |
| 160 | 3300028794 | Ga0307515_10510219 | Ga0307515_105102192 | 185 |
| 161 | 3300031251 | Ga0265327_10000381 | Ga0265327_1000038165 | 185 |
| 162 | 3300031456 | Ga0307513_10430701 | Ga0307513_104307013 | 185 |
| 163 | 3300031730 | Ga0307516_10001565 | Ga0307516_1000156531 | 185 |
| 164 | 3300033180 | Ga0307510_10438279 | Ga0307510_104382792 | 185 |
| 165 | 3300035172 | Ga0373955_0304760 | Ga0373955_0304760_232_789 | 185 |
| 166 | 3300035692 | Ga0373935_0333273 | Ga0373935_0333273_137_709 | 185 |
| 167 | 3300035695 | Ga0373927_0044490 | Ga0373927_0044490_136_693 | 185 |
| 168 | 3300037312 | Ga0395899_0000105 | Ga0395899_0000105_137523_138083 | 185 |
| 169 | 3300037312 | Ga0395899_0025758 | Ga0395899_0025758_2691_3248 | 185 |
| 170 | 3300037312 | Ga0395899_0143516 | Ga0395899_0143516_84_641 | 185 |
| 171 | 3300037418 | Ga0395900_0058480 | Ga0395900_0058480_1320_1877 | 185 |
| 172 | 3300037418 | Ga0395900_0100801 | Ga0395900_0100801_977_1534 | 185 |
| 173 | 3300037466 | Ga0395898_0073715 | Ga0395898_0073715_818_1375 | 185 |
| 174 | 3300037466 | Ga0395898_0118890 | Ga0395898_0118890_75_632 | 185 |
| 175 | 3300037466 | Ga0395898_0489457 | Ga0395898_0489457_459_1019 | 185 |
| 176 | 3300037471 | Ga0395905_0130813 | Ga0395905_0130813_561_1118 | 185 |
| 177 | 3300037853 | Ga0436364_1483493 | Ga0436364_1483493_3528_4088 | 185 |
| 178 | 3300038443 | Ga0395901_0658043 | Ga0395901_0658043_336_896 | 185 |
| 179 | 3300039437 | Ga0436365_0376847 | Ga0436365_0376847_13469_14029 | 185 |
| 180 | 3300039438 | Ga0436360_0034851 | Ga0436360_0034851_272_922 | 185 |
| 181 | 3300039447 | Ga0436361_0356944 | Ga0436361_0356944_99_656 | 185 |
| 182 | 3300039450 | Ga0436363_0101867 | Ga0436363_0101867_1719_2279 | 185 |
| 183 | 3300041410 | Ga0439461_0004190 | Ga0439461_0004190_755_1312 | 185 |
| 184 | 3300041461 | Ga0451805_122127 | Ga0451805_122127_269_826 | 185 |
| 185 | 3300041491 | Ga0451833_1326391 | Ga0451833_1326391_62_619 | 185 |
| 186 | 3300042127 | Ga0450890_015214 | Ga0450890_015214_163_720 | 185 |
| 187 | 3300042156 | Ga0439446_0004827 | Ga0439446_0004827_2273_2830 | 185 |
| 188 | 3300042436 | Ga0439435_0023237 | Ga0439435_0023237_981_1538 | 185 |
| 189 | 3300044683 | Ga0466965_0197136 | Ga0466965_0197136_185_742 | 185 |
| 190 | 3300044693 | Ga0466961_0161559 | Ga0466961_0161559_416_973 | 185 |
| 191 | 3300044693 | Ga0466961_0347676 | Ga0466961_0347676_304_861 | 185 |
| 192 | 3300044765 | Ga0466970_0276276 | Ga0466970_0276276_325_882 | 185 |
| 193 | 3300044842 | Ga0466957_0145584 | Ga0466957_0145584_456_1013 | 185 |
| 194 | 3300045049 | Ga0466959_0036896 | Ga0466959_0036896_2637_3197 | 185 |
| 195 | 3300046453 | Ga0495627_000399 | Ga0495627_000399_8025_8582 | 185 |
| 196 | 3300046460 | Ga0495638_0035321 | Ga0495638_0035321_2209_2766 | 185 |
| 197 | 3300046460 | Ga0495638_0247712 | Ga0495638_0247712_49_606 | 185 |
| 198 | 3300046471 | Ga0495650_0001571 | Ga0495650_0001571_20168_20725 | 185 |
| 199 | 3300046491 | Ga0495584_0107787 | Ga0495584_0107787_769_1326 | 185 |
| 200 | 3300046492 | Ga0495585_0186838 | Ga0495585_0186838_171_728 | 185 |
| 201 | 3300046501 | Ga0495607_0080713 | Ga0495607_0080713_895_1452 | 185 |
| 202 | 3300046506 | Ga0495583_0000650 | Ga0495583_0000650_16981_17538 | 185 |
| 203 | 3300046515 | Ga0495620_0067424 | Ga0495620_0067424_682_1239 | 185 |
| 204 | 3300046519 | Ga0495632_0041761 | Ga0495632_0041761_107_664 | 185 |
| 205 | 3300046530 | Ga0495654_0006712 | Ga0495654_0006712_1091_1648 | 185 |
| 206 | 3300046616 | Ga0495668_0001504 | Ga0495668_0001504_2267_2824 | 185 |
| 207 | 3300046616 | Ga0495668_0049463 | Ga0495668_0049463_1538_2095 | 185 |
| 208 | 3300046660 | Ga0495625_0001925 | Ga0495625_0001925_6206_6763 | 185 |
| 209 | 3300046660 | Ga0495625_0167562 | Ga0495625_0167562_569_1126 | 185 |
| 210 | 3300046664 | Ga0495659_0025307 | Ga0495659_0025307_1039_1596 | 185 |
| 211 | 3300046674 | Ga0495588_0052430 | Ga0495588_0052430_437_994 | 185 |
| 212 | 3300046683 | Ga0495658_0304985 | Ga0495658_0304985_242_799 | 185 |
| 213 | 3300046684 | Ga0495669_0000371 | Ga0495669_0000371_1754_2311 | 185 |
| 214 | 3300046691 | Ga0495670_0037453 | Ga0495670_0037453_1105_1662 | 185 |
| 215 | 3300046810 | Ga0495660_0154465 | Ga0495660_0154465_224_781 | 185 |
| 216 | 3300047320 | Ga0495672_0000439 | Ga0495672_0000439_40123_40680 | 185 |
| 217 | 3300047323 | Ga0495683_0065427 | Ga0495683_0065427_578_1135 | 185 |
| 218 | 3300047446 | Ga0495679_029031 | Ga0495679_029031_920_1477 | 185 |
| 219 | 3300047469 | Ga0495673_0000189 | Ga0495673_0000189_93658_94215 | 185 |
| 220 | 3300047470 | Ga0495681_0056388 | Ga0495681_0056388_544_1101 | 185 |
| 221 | 3300047472 | Ga0495686_0029450 | Ga0495686_0029450_1344_1901 | 185 |
| 222 | 3300047472 | Ga0495686_0098679 | Ga0495686_0098679_546_1103 | 185 |
| 223 | 3300048904 | Ga0496101_0127092 | Ga0496101_0127092_1115_1672 | 185 |
| 224 | 3300048909 | Ga0496106_0014990 | Ga0496106_0014990_3733_4290 | 185 |
| 225 | 3300048910 | Ga0496107_0000073 | Ga0496107_0000073_43064_43621 | 185 |
| 226 | 3300048929 | Ga0496126_0067161 | Ga0496126_0067161_495_1052 | 185 |
| 227 | 3300049459 | Ga0495678_005077 | Ga0495678_005077_5075_5632 | 185 |
| 228 | 3300049527 | Ga0501311_003804 | Ga0501311_003804_514_1095 | 185 |
| 229 | 3300049540 | Ga0501324_011699 | Ga0501324_011699_193_750 | 185 |
| 230 | 3300049758 | Ga0501241_027104 | Ga0501241_027104_182_739 | 185 |
| 231 | 3300050493 | nmdc:mga0k408_11918_c1 | nmdc:mga0k408_11918_c1_2150_2707 | 185 |
| 232 | 3300050496 | nmdc:mga07m45_86829_c1 | nmdc:mga07m45_86829_c1_732_1289 | 185 |
| 233 | 3300053086 | Ga0500578_0000459 | Ga0500578_0000459_30763_31320 | 185 |
| 234 | 3300053088 | Ga0500644_0000193 | Ga0500644_0000193_18053_18610 | 185 |
| 235 | 3300053090 | Ga0500646_0022126 | Ga0500646_0022126_65_622 | 185 |
| 236 | 3300053094 | Ga0500566_0065996 | Ga0500566_0065996_1237_1794 | 185 |
| 237 | 3300053096 | Ga0500641_0010127 | Ga0500641_0010127_556_1113 | 185 |
| 238 | 3300053102 | Ga0500554_011267 | Ga0500554_011267_399_956 | 185 |
| 239 | 3300053104 | Ga0500556_0001077 | Ga0500556_0001077_10444_11001 | 185 |
| 240 | 3300053108 | Ga0500562_004235 | Ga0500562_004235_980_1537 | 185 |
| 241 | 3300053118 | Ga0500594_0004036 | Ga0500594_0004036_177_734 | 185 |
| 242 | 3300053123 | Ga0500614_026739 | Ga0500614_026739_234_791 | 185 |
| 243 | 3300053125 | Ga0500618_000703 | Ga0500618_000703_1620_2177 | 185 |
| 244 | 3300053134 | Ga0500658_0000930 | Ga0500658_0000930_9597_10154 | 185 |
| 245 | 3300053136 | Ga0500559_0001398 | Ga0500559_0001398_5934_6491 | 185 |
| 246 | 3300053142 | Ga0500577_0005365 | Ga0500577_0005365_824_1381 | 185 |
| 247 | 3300053156 | Ga0500622_0000771 | Ga0500622_0000771_5237_5794 | 185 |
| 248 | 3300053156 | Ga0500622_0011085 | Ga0500622_0011085_3798_4355 | 185 |
| 249 | 3300053156 | Ga0500622_0069509 | Ga0500622_0069509_608_1165 | 185 |
| 250 | 3300053158 | Ga0500627_0001516 | Ga0500627_0001516_639_1196 | 185 |
| 251 | 3300053727 | Ga0500611_006082 | Ga0500611_006082_575_1132 | 185 |
| 252 | 3300053730 | Ga0500645_002894 | Ga0500645_002894_2850_3407 | 185 |
| 253 | 3300053731 | Ga0500609_000093 | Ga0500609_000093_8559_9116 | 185 |
| 254 | 3300055283 | Ga0500661_008301 | Ga0500661_008301_970_1527 | 185 |
| 255 | 3300059507 | Ga0587086_006705 | Ga0587086_006705_10_570 | 185 |
| 256 | 3300059510 | Ga0587090_105505 | Ga0587090_105505_22_579 | 185 |
| 257 | 3300059647 | Ga0587079_018207 | Ga0587079_018207_277_834 | 185 |
| 258 | 3300060344 | Ga0587071_002314 | Ga0587071_002314_1386_1943 | 185 |
| 259 | 3300003791 | Ga0055530_10021003 | Ga0055530_100210032 | 186 |
| 260 | 3300003794 | Ga0055531_10018518 | Ga0055531_100185187 | 186 |
| 261 | 3300004625 | Ga0055543_1012790 | Ga0055543_10127902 | 186 |
| 262 | 3300005329 | Ga0070683_100527371 | Ga0070683_1005273712 | 186 |
| 263 | 3300005331 | Ga0070670_100021899 | Ga0070670_10002189910 | 186 |
| 264 | 3300005335 | Ga0070666_10124941 | Ga0070666_101249413 | 186 |
| 265 | 3300005335 | Ga0070666_10233761 | Ga0070666_102337612 | 186 |
| 266 | 3300005337 | Ga0070682_100479853 | Ga0070682_1004798532 | 186 |
| 267 | 3300005344 | Ga0070661_100120510 | Ga0070661_1001205104 | 186 |
| 268 | 3300005347 | Ga0070668_100023377 | Ga0070668_1000233775 | 186 |
| 269 | 3300005347 | Ga0070668_100025277 | Ga0070668_1000252775 | 186 |
| 270 | 3300005353 | Ga0070669_100051464 | Ga0070669_1000514647 | 186 |
| 271 | 3300005355 | Ga0070671_100313772 | Ga0070671_1003137723 | 186 |
| 272 | 3300005367 | Ga0070667_100015939 | Ga0070667_1000159396 | 186 |
| 273 | 3300005530 | Ga0070679_100631932 | Ga0070679_1006319321 | 186 |
| 274 | 3300005548 | Ga0070665_100071556 | Ga0070665_1000715567 | 186 |
| 275 | 3300005563 | Ga0068855_100684523 | Ga0068855_1006845232 | 186 |
| 276 | 3300005841 | Ga0068863_100028125 | Ga0068863_1000281258 | 186 |
| 277 | 3300005842 | Ga0068858_100478536 | Ga0068858_1004785362 | 186 |
| 278 | 3300005844 | Ga0068862_100077983 | Ga0068862_1000779834 | 186 |
| 279 | 3300005983 | Ga0081540_1183551 | Ga0081540_11835512 | 186 |
| 280 | 3300009101 | Ga0105247_10405522 | Ga0105247_104055222 | 186 |
| 281 | 3300009176 | Ga0105242_10314107 | Ga0105242_103141072 | 186 |
| 282 | 3300010375 | Ga0105239_10544500 | Ga0105239_105445003 | 186 |
| 283 | 3300014745 | Ga0157377_10115144 | Ga0157377_101151442 | 186 |
| 284 | 3300014968 | Ga0157379_10858339 | Ga0157379_108583392 | 186 |
| 285 | 3300014969 | Ga0157376_11420736 | Ga0157376_114207361 | 186 |
| 286 | 3300015262 | Ga0182007_10016882 | Ga0182007_100168825 | 186 |
| 287 | 3300025245 | Ga0207425_1036708 | Ga0207425_10367082 | 186 |
| 288 | 3300025297 | Ga0209758_1002168 | Ga0209758_100216817 | 186 |
| 289 | 3300025298 | Ga0209050_1000161 | Ga0209050_100016199 | 186 |
| 290 | 3300025304 | Ga0209257_1000252 | Ga0209257_100025277 | 186 |
| 291 | 3300025923 | Ga0207681_10265954 | Ga0207681_102659543 | 186 |
| 292 | 3300025934 | Ga0207686_10287032 | Ga0207686_102870323 | 186 |
| 293 | 3300025949 | Ga0207667_10775951 | Ga0207667_107759512 | 186 |
| 294 | 3300025972 | Ga0207668_10007456 | Ga0207668_100074566 | 186 |
| 295 | 3300026035 | Ga0207703_10345430 | Ga0207703_103454302 | 186 |
| 296 | 3300026041 | Ga0207639_10043283 | Ga0207639_100432837 | 186 |
| 297 | 3300026088 | Ga0207641_10076518 | Ga0207641_100765187 | 186 |
| 298 | 3300026089 | Ga0207648_10243841 | Ga0207648_102438412 | 186 |
| 299 | 3300026089 | Ga0207648_10704366 | Ga0207648_107043661 | 186 |
| 300 | 3300028379 | Ga0268266_10355576 | Ga0268266_103555763 | 186 |
| 301 | 3300028380 | Ga0268265_10100736 | Ga0268265_101007361 | 186 |
| 302 | 3300028556 | Ga0265337_1095959 | Ga0265337_10959592 | 186 |
| 303 | 3300031824 | Ga0307413_10002271 | Ga0307413_1000227115 | 186 |
| 304 | 3300031901 | Ga0307406_10161829 | Ga0307406_101618292 | 186 |
| 305 | 3300032004 | Ga0307414_10117659 | Ga0307414_101176594 | 186 |
| 306 | 3300037471 | Ga0395905_0173211 | Ga0395905_0173211_477_1037 | 186 |
| 307 | 3300037471 | Ga0395905_0198482 | Ga0395905_0198482_1019_1579 | 186 |
| 308 | 3300039453 | Ga0436362_0403796 | Ga0436362_0403796_70_630 | 186 |
| 309 | 3300046615 | Ga0495656_0202473 | Ga0495656_0202473_111_671 | 186 |
| 310 | 3300048907 | Ga0496104_0162799 | Ga0496104_0162799_1239_1799 | 186 |
| 311 | 3300049127 | Ga0501306_017130 | Ga0501306_017130_350_910 | 186 |
| 312 | 3300049129 | Ga0501309_044877 | Ga0501309_044877_79_639 | 186 |
| 313 | 3300049536 | Ga0501320_003371 | Ga0501320_003371_27_587 | 186 |
| 314 | 3300049541 | Ga0501325_011787 | Ga0501325_011787_154_714 | 186 |
| 315 | 3300049569 | Ga0501032_0107042 | Ga0501032_0107042_799_1359 | 186 |
| 316 | 3300049573 | Ga0501037_0035888 | Ga0501037_0035888_663_1223 | 186 |
| 317 | 3300049823 | Ga0501044_0008183 | Ga0501044_0008183_1663_2223 | 186 |
| 318 | 3300053153 | Ga0500616_0183125 | Ga0500616_0183125_149_709 | 186 |
| 319 | 3300059491 | Ga0587070_084895 | Ga0587070_084895_19_579 | 186 |
| 320 | 3300005333 | Ga0070677_10218795 | Ga0070677_102187952 | 187 |
| 321 | 3300005347 | Ga0070668_100237564 | Ga0070668_1002375642 | 187 |
| 322 | 3300005364 | Ga0070673_100590962 | Ga0070673_1005909621 | 187 |
| 323 | 3300005543 | Ga0070672_100576323 | Ga0070672_1005763232 | 187 |
| 324 | 3300005841 | Ga0068863_100364710 | Ga0068863_1003647103 | 187 |
| 325 | 3300005843 | Ga0068860_100051208 | Ga0068860_1000512088 | 187 |
| 326 | 3300005844 | Ga0068862_100094860 | Ga0068862_1000948602 | 187 |
| 327 | 3300006881 | Ga0068865_100523855 | Ga0068865_1005238552 | 187 |
| 328 | 3300014969 | Ga0157376_10262170 | Ga0157376_102621703 | 187 |
| 329 | 3300025934 | Ga0207686_10828929 | Ga0207686_108289292 | 187 |
| 330 | 3300025940 | Ga0207691_10058461 | Ga0207691_100584617 | 187 |
| 331 | 3300025942 | Ga0207689_10400152 | Ga0207689_104001522 | 187 |
| 332 | 3300025972 | Ga0207668_10009414 | Ga0207668_100094146 | 187 |
| 333 | 3300026088 | Ga0207641_10984954 | Ga0207641_109849542 | 187 |
| 334 | 3300026089 | Ga0207648_10290341 | Ga0207648_102903413 | 187 |
| 335 | 3300026118 | Ga0207675_100156692 | Ga0207675_1001566922 | 187 |
| 336 | 3300028380 | Ga0268265_10019588 | Ga0268265_1001958810 | 187 |
| 337 | 3300028381 | Ga0268264_10002325 | Ga0268264_1000232517 | 187 |
| 338 | 3300046516 | Ga0495628_0109267 | Ga0495628_0109267_376_942 | 187 |
| 339 | 3300046539 | Ga0495621_0041413 | Ga0495621_0041413_272_835 | 187 |
| 340 | 3300047319 | Ga0495674_0099850 | Ga0495674_0099850_1654_2220 | 187 |
| 341 | 3300049160 | Ga0501304_020739 | Ga0501304_020739_10_573 | 187 |
| 342 | 3300000531 | CNBas_1004576 | CNBas_10045761 | 188 |
| 343 | 3300005288 | Ga0065714_10192749 | Ga0065714_101927492 | 188 |
| 344 | 3300005334 | Ga0068869_100649286 | Ga0068869_1006492861 | 188 |
| 345 | 3300005336 | Ga0070680_100006095 | Ga0070680_1000060956 | 188 |
| 346 | 3300005336 | Ga0070680_100116911 | Ga0070680_1001169112 | 188 |
| 347 | 3300005339 | Ga0070660_100548371 | Ga0070660_1005483712 | 188 |
| 348 | 3300005340 | Ga0070689_100614119 | Ga0070689_1006141192 | 188 |
| 349 | 3300005340 | Ga0070689_101052835 | Ga0070689_1010528351 | 188 |
| 350 | 3300005354 | Ga0070675_100597560 | Ga0070675_1005975601 | 188 |
| 351 | 3300005355 | Ga0070671_100184470 | Ga0070671_1001844703 | 188 |
| 352 | 3300005356 | Ga0070674_100404900 | Ga0070674_1004049001 | 188 |
| 353 | 3300005366 | Ga0070659_100131707 | Ga0070659_1001317073 | 188 |
| 354 | 3300005367 | Ga0070667_100214807 | Ga0070667_1002148074 | 188 |
| 355 | 3300005456 | Ga0070678_100258005 | Ga0070678_1002580052 | 188 |
| 356 | 3300005457 | Ga0070662_100014250 | Ga0070662_1000142506 | 188 |
| 357 | 3300005458 | Ga0070681_10040928 | Ga0070681_100409287 | 188 |
| 358 | 3300005458 | Ga0070681_10042882 | Ga0070681_100428828 | 188 |
| 359 | 3300005530 | Ga0070679_100042115 | Ga0070679_1000421157 | 188 |
| 360 | 3300005530 | Ga0070679_100351539 | Ga0070679_1003515393 | 188 |
| 361 | 3300005539 | Ga0068853_100184845 | Ga0068853_1001848452 | 188 |
| 362 | 3300005539 | Ga0068853_100387108 | Ga0068853_1003871083 | 188 |
| 363 | 3300005548 | Ga0070665_100000121 | Ga0070665_100000121157 | 188 |
| 364 | 3300005563 | Ga0068855_100018024 | Ga0068855_10001802410 | 188 |
| 365 | 3300005563 | Ga0068855_100073551 | Ga0068855_1000735517 | 188 |
| 366 | 3300005563 | Ga0068855_100074983 | Ga0068855_1000749837 | 188 |
| 367 | 3300005564 | Ga0070664_100274045 | Ga0070664_1002740452 | 188 |
| 368 | 3300005564 | Ga0070664_100636453 | Ga0070664_1006364532 | 188 |
| 369 | 3300005616 | Ga0068852_100670611 | Ga0068852_1006706112 | 188 |
| 370 | 3300005618 | Ga0068864_100070364 | Ga0068864_1000703647 | 188 |
| 371 | 3300005618 | Ga0068864_101221920 | Ga0068864_1012219201 | 188 |
| 372 | 3300005719 | Ga0068861_100649074 | Ga0068861_1006490742 | 188 |
| 373 | 3300005841 | Ga0068863_100181671 | Ga0068863_1001816714 | 188 |
| 374 | 3300005844 | Ga0068862_101179497 | Ga0068862_1011794971 | 188 |
| 375 | 3300006028 | Ga0070717_10150923 | Ga0070717_101509234 | 188 |
| 376 | 3300006038 | Ga0075365_10006324 | Ga0075365_100063249 | 188 |
| 377 | 3300006048 | Ga0075363_100007657 | Ga0075363_1000076574 | 188 |
| 378 | 3300006195 | Ga0075366_10086475 | Ga0075366_100864752 | 188 |
| 379 | 3300006353 | Ga0075370_10122046 | Ga0075370_101220462 | 188 |
| 380 | 3300006353 | Ga0075370_10470933 | Ga0075370_104709332 | 188 |
| 381 | 3300006881 | Ga0068865_100031091 | Ga0068865_1000310917 | 188 |
| 382 | 3300006881 | Ga0068865_100558066 | Ga0068865_1005580662 | 188 |
| 383 | 3300007265 | Ga0099794_10000179 | Ga0099794_1000017915 | 188 |
| 384 | 3300009093 | Ga0105240_10162906 | Ga0105240_101629063 | 188 |
| 385 | 3300009093 | Ga0105240_10458549 | Ga0105240_104585492 | 188 |
| 386 | 3300009093 | Ga0105240_10504234 | Ga0105240_105042343 | 188 |
| 387 | 3300009094 | Ga0111539_11155399 | Ga0111539_111553992 | 188 |
| 388 | 3300009098 | Ga0105245_10505959 | Ga0105245_105059592 | 188 |
| 389 | 3300009098 | Ga0105245_10728966 | Ga0105245_107289662 | 188 |
| 390 | 3300009174 | Ga0105241_10163652 | Ga0105241_101636523 | 188 |
| 391 | 3300009545 | Ga0105237_10155310 | Ga0105237_101553102 | 188 |
| 392 | 3300009545 | Ga0105237_11631492 | Ga0105237_116314921 | 188 |
| 393 | 3300009551 | Ga0105238_10045873 | Ga0105238_100458737 | 188 |
| 394 | 3300009551 | Ga0105238_10526582 | Ga0105238_105265822 | 188 |
| 395 | 3300009551 | Ga0105238_10584308 | Ga0105238_105843082 | 188 |
| 396 | 3300009551 | Ga0105238_10605689 | Ga0105238_106056893 | 188 |
| 397 | 3300009553 | Ga0105249_10183876 | Ga0105249_101838763 | 188 |
| 398 | 3300010375 | Ga0105239_10346341 | Ga0105239_103463413 | 188 |
| 399 | 3300010375 | Ga0105239_10834121 | Ga0105239_108341212 | 188 |
| 400 | 3300013102 | Ga0157371_10422907 | Ga0157371_104229071 | 188 |
| 401 | 3300013104 | Ga0157370_10162858 | Ga0157370_101628586 | 188 |
| 402 | 3300013105 | Ga0157369_10283134 | Ga0157369_102831343 | 188 |
| 403 | 3300013296 | Ga0157374_10564693 | Ga0157374_105646931 | 188 |
| 404 | 3300013297 | Ga0157378_10125170 | Ga0157378_101251703 | 188 |
| 405 | 3300013297 | Ga0157378_10772037 | Ga0157378_107720372 | 188 |
| 406 | 3300013306 | Ga0163162_10143420 | Ga0163162_101434206 | 188 |
| 407 | 3300013307 | Ga0157372_10708135 | Ga0157372_107081353 | 188 |
| 408 | 3300013308 | Ga0157375_10502592 | Ga0157375_105025923 | 188 |
| 409 | 3300014325 | Ga0163163_10377403 | Ga0163163_103774034 | 188 |
| 410 | 3300014325 | Ga0163163_10385354 | Ga0163163_103853542 | 188 |
| 411 | 3300014325 | Ga0163163_11290006 | Ga0163163_112900062 | 188 |
| 412 | 3300014326 | Ga0157380_10262147 | Ga0157380_102621473 | 188 |
| 413 | 3300017792 | Ga0163161_10049692 | Ga0163161_100496923 | 188 |
| 414 | 3300021361 | Ga0213872_10022498 | Ga0213872_100224982 | 188 |
| 415 | 3300025250 | Ga0209026_1003882 | Ga0209026_10038828 | 188 |
| 416 | 3300025304 | Ga0209257_1018926 | Ga0209257_10189264 | 188 |
| 417 | 3300025903 | Ga0207680_10115044 | Ga0207680_101150442 | 188 |
| 418 | 3300025907 | Ga0207645_10298324 | Ga0207645_102983242 | 188 |
| 419 | 3300025909 | Ga0207705_10011901 | Ga0207705_1001190110 | 188 |
| 420 | 3300025912 | Ga0207707_10087890 | Ga0207707_100878906 | 188 |
| 421 | 3300025912 | Ga0207707_10091202 | Ga0207707_100912022 | 188 |
| 422 | 3300025913 | Ga0207695_10000575 | Ga0207695_1000057517 | 188 |
| 423 | 3300025913 | Ga0207695_10261400 | Ga0207695_102614004 | 188 |
| 424 | 3300025913 | Ga0207695_10278839 | Ga0207695_102788394 | 188 |
| 425 | 3300025914 | Ga0207671_10429423 | Ga0207671_104294231 | 188 |
| 426 | 3300025917 | Ga0207660_10000537 | Ga0207660_1000053717 | 188 |
| 427 | 3300025917 | Ga0207660_10057441 | Ga0207660_100574412 | 188 |
| 428 | 3300025919 | Ga0207657_10062953 | Ga0207657_100629537 | 188 |
| 429 | 3300025921 | Ga0207652_10002134 | Ga0207652_1000213414 | 188 |
| 430 | 3300025921 | Ga0207652_10172662 | Ga0207652_101726625 | 188 |
| 431 | 3300025924 | Ga0207694_10078132 | Ga0207694_100781322 | 188 |
| 432 | 3300025924 | Ga0207694_10127710 | Ga0207694_101277103 | 188 |
| 433 | 3300025924 | Ga0207694_10260913 | Ga0207694_102609132 | 188 |
| 434 | 3300025927 | Ga0207687_10295051 | Ga0207687_102950513 | 188 |
| 435 | 3300025931 | Ga0207644_10077748 | Ga0207644_100777483 | 188 |
| 436 | 3300025932 | Ga0207690_10008937 | Ga0207690_1000893710 | 188 |
| 437 | 3300025932 | Ga0207690_10171669 | Ga0207690_101716693 | 188 |
| 438 | 3300025936 | Ga0207670_10464272 | Ga0207670_104642722 | 188 |
| 439 | 3300025938 | Ga0207704_10118865 | Ga0207704_101188653 | 188 |
| 440 | 3300025938 | Ga0207704_10182039 | Ga0207704_101820393 | 188 |
| 441 | 3300025941 | Ga0207711_10001469 | Ga0207711_1000146918 | 188 |
| 442 | 3300025941 | Ga0207711_10262862 | Ga0207711_102628623 | 188 |
| 443 | 3300025942 | Ga0207689_10353606 | Ga0207689_103536063 | 188 |
| 444 | 3300025945 | Ga0207679_10112251 | Ga0207679_101122514 | 188 |
| 445 | 3300025949 | Ga0207667_10015066 | Ga0207667_100150667 | 188 |
| 446 | 3300025949 | Ga0207667_10052476 | Ga0207667_100524762 | 188 |
| 447 | 3300025949 | Ga0207667_10090996 | Ga0207667_100909963 | 188 |
| 448 | 3300025960 | Ga0207651_10115078 | Ga0207651_101150785 | 188 |
| 449 | 3300025986 | Ga0207658_10156248 | Ga0207658_101562482 | 188 |
| 450 | 3300026023 | Ga0207677_10372997 | Ga0207677_103729973 | 188 |
| 451 | 3300026041 | Ga0207639_10668327 | Ga0207639_106683272 | 188 |
| 452 | 3300026041 | Ga0207639_10779429 | Ga0207639_107794292 | 188 |
| 453 | 3300026088 | Ga0207641_10338847 | Ga0207641_103388472 | 188 |
| 454 | 3300026095 | Ga0207676_10243784 | Ga0207676_102437843 | 188 |
| 455 | 3300026116 | Ga0207674_10267714 | Ga0207674_102677142 | 188 |
| 456 | 3300026121 | Ga0207683_10319561 | Ga0207683_103195613 | 188 |
| 457 | 3300026142 | Ga0207698_10868870 | Ga0207698_108688701 | 188 |
| 458 | 3300026142 | Ga0207698_11415608 | Ga0207698_114156081 | 188 |
| 459 | 3300027543 | Ga0209999_1001367 | Ga0209999_10013675 | 188 |
| 460 | 3300027665 | Ga0209983_1004172 | Ga0209983_10041725 | 188 |
| 461 | 3300027671 | Ga0209588_1020292 | Ga0209588_10202923 | 188 |
| 462 | 3300028379 | Ga0268266_10000106 | Ga0268266_100001067 | 188 |
| 463 | 3300028379 | Ga0268266_10084163 | Ga0268266_100841632 | 188 |
| 464 | 3300028786 | Ga0307517_10029956 | Ga0307517_1002995612 | 188 |
| 465 | 3300028794 | Ga0307515_10496074 | Ga0307515_104960742 | 188 |
| 466 | 3300030521 | Ga0307511_10006537 | Ga0307511_1000653716 | 188 |
| 467 | 3300031456 | Ga0307513_10002446 | Ga0307513_1000244631 | 188 |
| 468 | 3300031548 | Ga0307408_101083653 | Ga0307408_1010836532 | 188 |
| 469 | 3300031824 | Ga0307413_10189895 | Ga0307413_101898954 | 188 |
| 470 | 3300031903 | Ga0307407_10944313 | Ga0307407_109443131 | 188 |
| 471 | 3300031995 | Ga0307409_100528370 | Ga0307409_1005283702 | 188 |
| 472 | 3300032002 | Ga0307416_101432627 | Ga0307416_1014326271 | 188 |
| 473 | 3300032004 | Ga0307414_10065490 | Ga0307414_100654903 | 188 |
| 474 | 3300032004 | Ga0307414_11186768 | Ga0307414_111867681 | 188 |
| 475 | 3300033180 | Ga0307510_10013765 | Ga0307510_100137659 | 188 |
| 476 | 3300035113 | Ga0373936_0004112 | Ga0373936_0004112_918_1484 | 188 |
| 477 | 3300035170 | Ga0373943_0107086 | Ga0373943_0107086_78_644 | 188 |
| 478 | 3300035171 | Ga0373946_0106332 | Ga0373946_0106332_376_942 | 188 |
| 479 | 3300035695 | Ga0373927_0000479 | Ga0373927_0000479_24038_24604 | 188 |
| 480 | 3300037068 | Ga0373925_0000023 | Ga0373925_0000023_10133_10699 | 188 |
| 481 | 3300037312 | Ga0395899_0001195 | Ga0395899_0001195_8200_8769 | 188 |
| 482 | 3300037418 | Ga0395900_0006999 | Ga0395900_0006999_2914_3483 | 188 |
| 483 | 3300037466 | Ga0395898_0004322 | Ga0395898_0004322_8201_8770 | 188 |
| 484 | 3300037471 | Ga0395905_0006270 | Ga0395905_0006270_2474_3043 | 188 |
| 485 | 3300038443 | Ga0395901_0000342 | Ga0395901_0000342_47986_48555 | 188 |
| 486 | 3300039447 | Ga0436361_0953537 | Ga0436361_0953537_24148_24720 | 188 |
| 487 | 3300041997 | Ga0439431_0031081 | Ga0439431_0031081_476_1042 | 188 |
| 488 | 3300042005 | Ga0439448_0164523 | Ga0439448_0164523_36_602 | 188 |
| 489 | 3300042435 | Ga0439434_0073528 | Ga0439434_0073528_349_915 | 188 |
| 490 | 3300046460 | Ga0495638_0349384 | Ga0495638_0349384_124_690 | 188 |
| 491 | 3300046472 | Ga0495580_0436143 | Ga0495580_0436143_111_680 | 188 |
| 492 | 3300046474 | Ga0495605_0073285 | Ga0495605_0073285_253_819 | 188 |
| 493 | 3300046491 | Ga0495584_0103560 | Ga0495584_0103560_551_1117 | 188 |
| 494 | 3300046525 | Ga0495663_0008611 | Ga0495663_0008611_887_1453 | 188 |
| 495 | 3300046528 | Ga0495642_0008396 | Ga0495642_0008396_2037_2603 | 188 |
| 496 | 3300046539 | Ga0495621_0010211 | Ga0495621_0010211_269_835 | 188 |
| 497 | 3300046542 | Ga0495597_0147433 | Ga0495597_0147433_222_788 | 188 |
| 498 | 3300046616 | Ga0495668_0064267 | Ga0495668_0064267_1332_1898 | 188 |
| 499 | 3300046616 | Ga0495668_0100670 | Ga0495668_0100670_413_979 | 188 |
| 500 | 3300046648 | Ga0495611_0005291 | Ga0495611_0005291_3564_4130 | 188 |
| 501 | 3300046660 | Ga0495625_0052545 | Ga0495625_0052545_1610_2176 | 188 |
| 502 | 3300046660 | Ga0495625_0132573 | Ga0495625_0132573_402_968 | 188 |
| 503 | 3300046664 | Ga0495659_0002869 | Ga0495659_0002869_490_1056 | 188 |
| 504 | 3300046684 | Ga0495669_0312870 | Ga0495669_0312870_80_646 | 188 |
| 505 | 3300046691 | Ga0495670_0445491 | Ga0495670_0445491_32_598 | 188 |
| 506 | 3300046692 | Ga0495671_0240579 | Ga0495671_0240579_222_788 | 188 |
| 507 | 3300047318 | Ga0495636_0006624 | Ga0495636_0006624_2066_2632 | 188 |
| 508 | 3300047445 | Ga0495677_0183390 | Ga0495677_0183390_93_659 | 188 |
| 509 | 3300047447 | Ga0495685_063236 | Ga0495685_063236_293_859 | 188 |
| 510 | 3300047470 | Ga0495681_0076275 | Ga0495681_0076275_122_688 | 188 |
| 511 | 3300047472 | Ga0495686_0007469 | Ga0495686_0007469_5270_5836 | 188 |
| 512 | 3300048904 | Ga0496101_0023677 | Ga0496101_0023677_412_978 | 188 |
| 513 | 3300048905 | Ga0496102_0081834 | Ga0496102_0081834_1125_1691 | 188 |
| 514 | 3300048906 | Ga0496103_0050032 | Ga0496103_0050032_1223_1789 | 188 |
| 515 | 3300048910 | Ga0496107_0049382 | Ga0496107_0049382_261_827 | 188 |
| 516 | 3300048912 | Ga0496109_0080902 | Ga0496109_0080902_461_1027 | 188 |
| 517 | 3300048913 | Ga0496110_0276694 | Ga0496110_0276694_369_935 | 188 |
| 518 | 3300048915 | Ga0496112_0033003 | Ga0496112_0033003_346_912 | 188 |
| 519 | 3300049162 | Ga0501307_005954 | Ga0501307_005954_50_616 | 188 |
| 520 | 3300049539 | Ga0501323_015869 | Ga0501323_015869_22_588 | 188 |
| 521 | 3300049581 | Ga0501047_0252100 | Ga0501047_0252100_182_751 | 188 |
| 522 | 3300049743 | Ga0501081_0363781 | Ga0501081_0363781_35_859 | 188 |
| 523 | 3300049822 | Ga0501035_0118771 | Ga0501035_0118771_212_781 | 188 |
| 524 | 3300049823 | Ga0501044_0130572 | Ga0501044_0130572_1172_1741 | 188 |
| 525 | 3300050490 | nmdc:mga03n38_31920_c1 | nmdc:mga03n38_31920_c1_1438_2004 | 188 |
| 526 | 3300050493 | nmdc:mga0k408_176476_c1 | nmdc:mga0k408_176476_c1_377_943 | 188 |
| 527 | 3300053108 | Ga0500562_000644 | Ga0500562_000644_5161_5727 | 188 |
| 528 | 3300053158 | Ga0500627_0133540 | Ga0500627_0133540_431_997 | 188 |
| 529 | 3300053730 | Ga0500645_005668 | Ga0500645_005668_3489_4055 | 188 |
| 530 | 3300059493 | Ga0587077_046479 | Ga0587077_046479_87_653 | 188 |
| 531 | 3300059652 | Ga0587107_070100 | Ga0587107_070100_44_610 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ns3-assembly1.cif.gz_B | crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9779 | 10 | 183 |
| 5ns4-assembly1.cif.gz_A | crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9705 | 10 | 183 |
| 5ns4-assembly2.cif.gz_B | crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9688 | 10 | 183 |
| 5ns3-assembly1.cif.gz_A | crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9584 | 10 | 183 |
| 5ns3-assembly1.cif.gz_B | crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9502 | 10 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9369 | 9 | 183 | 3.30.1440.10 |
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9218 | 9 | 183 | 3.30.1440.10 |
| af_P36519_120_288_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8975 | 28 | 183 | 3.30.1440.10 |
| af_A0A1D8PHY2_119_286_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8971 | 28 | 185 | 3.30.1440.10 |
| af_O14337_108_278_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8618 | 28 | 184 | 3.30.1440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1RDG4-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9592 | 8 | 187 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A845S4K3-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9587 | 6 | 186 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2W5Y1Q8-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9574 | 9 | 187 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2E4WGS1-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9568 | 6 | 186 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2A5GTL4-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9567 | 6 | 185 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar