F459999

General Info

Members Datasets Scaffolds Average Seq Length
530 400 370 254

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0004119|Ga0495650_0004119_2322_3209
Length 295
Sequence VHDTKVTTARIVTIFCIVTIRSGNCGAEPARSNDKDDIMELQGKTALITGGNSGIGLATARLMLAQGARVAITGRDRAKLDEAVAELGPDVLALQADLNRSDDLVAVARAVGEAFGTLDIVFANAGISGPTPLGSTTYEAFRNIVDTNLTSVFFTVQSVLPLLRQGSAIVLNGSVMRELAVGGTAAYSATKAGITGMAKVFATELAPRGIRVNTVIPGATRTPIWTRGARAGATLDATEAHLAPRIPLGRLAEAEEVANAVVFLASPRASGMTAAEIVVDGGTLGAPSGGAIFRG

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
11 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
12 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
13 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
18 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
19 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
20 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
21 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
22 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
23 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
24 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
25 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
26 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
27 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
28 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
29 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
30 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
31 2718217882 Rhizobium sp. N741 Isolate Nodule
32 2718217927 Rhizobium sp. N324 Isolate Nodule
33 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
34 2718218009 Rhizobium sp. N561 Isolate Nodule
35 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
36 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
37 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
38 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
39 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
40 2718218363 Rhizobium sp. N113 Isolate Nodule
41 2718218365 Rhizobium sp. N731 Isolate Nodule
42 2718218366 Rhizobium sp. N621 Isolate Nodule
43 2718218423 Rhizobium sp. N941 Isolate Nodule
44 2721755514 Rhizobium sp. N6212 Isolate Nodule
45 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
46 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
47 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
48 2721755809 Rhizobium sp. N541 Isolate Nodule
49 2721755810 Rhizobium sp. N871 Isolate Nodule
50 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
51 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
52 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
53 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
54 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
55 2728369365 Rhizobium sp. N1341 Isolate Nodule
56 2728369397 Rhizobium sp. N1314 Isolate Nodule
57 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
58 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
59 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
60 2791355256 Rhizobium sp. M10 Isolate Nodule
61 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
62 2791355260 Rhizobium sp. L9 Isolate Nodule
63 2791355261 Rhizobium sp. J15 Isolate Nodule
64 2791355262 Rhizobium sp. M1 Isolate Nodule
65 2791355263 Rhizobium chutanense C5 Isolate Nodule
66 2791355264 Rhizobium sp. S9 Isolate Nodule
67 2791355265 Rhizobium sp. H4 Isolate Nodule
68 2791355266 Rhizobium sp. L43 Isolate Nodule
69 2791355267 Rhizobium sp. L18 Isolate Nodule
70 2802429633 Rhizobium anhuiense J3 Isolate Nodule
71 2802429634 Rhizobium anhuiense S10 Isolate Nodule
72 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
73 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
74 2802429637 Rhizobium anhuiense C15 Isolate Nodule
75 2818991459 Paenibacillus sp. 597 Isolate Unclassified
76 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
77 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
78 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
79 2838048938 Rhizobium pisi 27/80 Isolate Nodule
80 2838061910 Rhizobium phaseoli L15 Isolate Nodule
81 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
82 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
83 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
84 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
85 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
86 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
87 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
88 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
89 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
90 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
91 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
92 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
93 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
94 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
95 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
96 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
97 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
98 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
99 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
100 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
101 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
102 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
103 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
104 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
105 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
106 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
107 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
108 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
109 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
110 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
111 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
112 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
113 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
114 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
115 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
116 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
117 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
118 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
119 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
120 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
121 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
122 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
123 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
124 2933599457 Rhizobium phaseoli M3 Isolate Nodule
125 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
126 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
127 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
128 2936381700 Rhizobium chutanense C16 Isolate Unclassified
129 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
130 2996887358 Rhizobium sp. R711 Isolate Nodule
131 2996893221 Rhizobium sp. R635 Isolate Nodule
132 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
133 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
134 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
135 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
136 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
137 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
138 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
139 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
140 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
141 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
142 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
143 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
144 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
145 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
146 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
147 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
148 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
149 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
150 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
151 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
152 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
153 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
154 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
155 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
156 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
157 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
158 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
159 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
160 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
161 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
162 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
163 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
164 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
165 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
166 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
167 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
168 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
169 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
170 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
171 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
172 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
173 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
174 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
175 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
176 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
177 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
178 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
179 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
180 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
181 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
182 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
183 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
184 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
185 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
186 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
187 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
188 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
189 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
190 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
191 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
192 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
193 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
194 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
195 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
196 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
197 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
198 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
199 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
200 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
201 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
202 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
203 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
204 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
205 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
206 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
207 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
208 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
209 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
210 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
211 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
214 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
217 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
218 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
219 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
222 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
224 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
226 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
229 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
252 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
253 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
254 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
257 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
260 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
261 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
262 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
263 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
264 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
265 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
266 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
267 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
268 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
269 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
270 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
271 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
272 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
275 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
281 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
282 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
283 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
290 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
300 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
301 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
302 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
303 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
312 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
313 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
314 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
320 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
346 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
349 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
355 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
356 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
357 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
358 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
359 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
360 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
361 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
362 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
363 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
366 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
367 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
373 8005258706 Rhizobium sp. R693 Isolate Nodule
374 8005275841 Rhizobium sp. N4311 Isolate Nodule
375 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
376 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
377 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
378 8005321885 Rhizobium sp. R72 Isolate Nodule
379 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
380 8005382845 Rhizobium sp. R634 Isolate Nodule
381 8005395548 Rhizobium sp. R339 Isolate Nodule
382 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
383 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
384 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
385 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
386 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
387 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
388 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
389 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
390 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
391 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
392 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
393 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
394 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
395 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
396 8018176218 Rhizobium sp. N122 Isolate Nodule
397 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
398 8056382006 Rhizobium croatiense 13T Isolate Nodule
399 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
400 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.43
Metatranscriptomes 0
Isolates 30.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.91
Nodule 24.34
Rhizoplane 1.7
Rhizosphere 36.79
Stem 0
Stem Tuber 0
Unclassified 12.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1003026 3300002739 Bacteria 2643
2 JGI25152J39213_1003247 3300002773 Bacteria 5642
3 JGI25152J39213_1005508 3300002773 Bacteria 3668
4 JGI25159J45721_1000289 3300002987 Bacteria 23616
5 JGI25159J45721_1001613 3300002987 Bacteria 9224
6 JGI25151J46595_10000506 3300003187 Bacteria 36556
7 JGI25153J46596_10005211 3300003215 Bacteria 6841
8 JGI25153J46596_10005668 3300003215 Bacteria 6518
9 rootH1_10029736 3300003316 Bacteria 3250
10 rootH1_10068274 3300003316 Bacteria 3003
11 rootH2_10042848 3300003320 Bacteria 3091
12 rootH2_10059413 3300003320 Bacteria 5550
13 rootH1_10031533 3300003316 Bacteria 9861
14 rootH1_10031533 3300003323 Bacteria 6090
15 rootH1_10125278 3300003316 Eukaryota 1356
16 rootH1_10125278 3300003323 Bacteria 2387
17 rootH1_10149944 3300003323 Bacteria 1132
18 rootH1_10157081 3300003323 Bacteria 1938
19 JGI25160J50197_1000004 3300003354 Bacteria 419797
20 JGI25160J50197_1002391 3300003354 Bacteria 8751
21 JGI25160J50197_1004081 3300003354 Bacteria 6358
22 JGI25160J50197_1011479 3300003354 Bacteria 3139
23 JGI25161J50226_1000003 3300003374 Bacteria 413345
24 JGI25161J50226_1000126 3300003374 Bacteria 54396
25 JGI25161J50226_1000372 3300003374 Bacteria 22540
26 JGI25161J50226_1005931 3300003374 Bacteria 2282
27 Ga0055539_1000280 3300003752 Bacteria 29407
28 Ga0055533_1000043 3300003756 Bacteria 229262
29 Ga0055525_1000981 3300003759 Bacteria 7709
30 Ga0055526_1000377 3300003771 Bacteria 36137
31 Ga0055526_1001577 3300003771 Bacteria 16040
32 Ga0055526_1004949 3300003771 Bacteria 7824
33 Ga0055526_1009362 3300003771 Bacteria 4724
34 Ga0055526_1014689 3300003771 Bacteria 3200
35 Ga0055524_1003719 3300003775 Bacteria 7292
36 Ga0055524_1004405 3300003775 Bacteria 6494
37 Ga0055524_1004442 3300003775 Bacteria 6470
38 Ga0055524_1009384 3300003775 Bacteria 3986
39 Ga0055536_1006211 3300003781 Bacteria 5641
40 Ga0055528_1000067 3300003790 Bacteria 83853
41 Ga0055528_1000890 3300003790 Bacteria 20167
42 Ga0055528_1001085 3300003790 Bacteria 17923
43 Ga0055528_1011409 3300003790 Bacteria 3531
44 Ga0055528_1014375 3300003790 Bacteria 2931
45 Ga0055530_10030293 3300003791 Bacteria 1435
46 Ga0055540_1000613 3300003792 Bacteria 25435
47 Ga0055540_1001575 3300003792 Bacteria 13294
48 Ga0055540_1004063 3300003792 Bacteria 6789
49 Ga0055540_1007015 3300003792 Bacteria 4344
50 Ga0055540_1015524 3300003792 Bacteria 2211
51 Ga0055531_10004951 3300003794 Bacteria 7914
52 Ga0055541_1006854 3300003841 Unclassified 1907
53 Ga0055543_1000001 3300004625 Bacteria 419949
54 Ga0055543_1000156 3300004625 Bacteria 57199
55 Ga0055543_1000622 3300004625 Bacteria 19097
56 Ga0055543_1007345 3300004625 Bacteria 2559
57 Ga0065165_1000675 3300005262 Bacteria 49121
58 Ga0065165_1000736 3300005262 Bacteria 45533
59 Ga0065165_1032052 3300005262 Bacteria 1652
60 Ga0065714_10066554 3300005288 Bacteria 6662
61 Ga0065707_10082114 3300005295 Bacteria 21501
62 Ga0070658_10016510 3300005327 Bacteria 5909
63 Ga0070658_10065242 3300005327 Bacteria 2971
64 Ga0070658_10529010 3300005327 Bacteria 1020
65 Ga0070690_100008323 3300005330 Bacteria 5969
66 Ga0068869_100086100 3300005334 Bacteria 2355
67 Ga0070682_100302494 3300005337 Bacteria 1174
68 Ga0070671_100024430 3300005355 Bacteria 4946
69 Ga0070659_100034270 3300005366 Bacteria 3948
70 Ga0070714_100010304 3300005435 Bacteria 7385
71 Ga0070713_100174867 3300005436 Bacteria 1926
72 Ga0070663_100217892 3300005455 Bacteria 1497
73 Ga0070663_100228413 3300005455 Bacteria 1464
74 Ga0070681_10141978 3300005458 Bacteria 2331
75 Ga0070679_100025377 3300005530 Bacteria 5815
76 Ga0070679_100437166 3300005530 Unclassified 1253
77 Ga0070672_100264865 3300005543 Bacteria 1450
78 Ga0070665_100400681 3300005548 Bacteria 1380
79 Ga0068855_100031798 3300005563 Bacteria 6300
80 Ga0068855_100065397 3300005563 Bacteria 4240
81 Ga0068856_100167113 3300005614 Bacteria 2211
82 Ga0068861_100004819 3300005719 Bacteria 9072
83 Ga0081540_1052772 3300005983 Bacteria 1999
84 Ga0081540_1090622 3300005983 Bacteria 1346
85 Ga0070717_10213264 3300006028 Bacteria 1695
86 Ga0075365_10003061 3300006038 Bacteria 8485
87 Ga0075365_10027593 3300006038 Bacteria 3614
88 Ga0075365_10295039 3300006038 Bacteria 1141
89 Ga0075363_100151443 3300006048 Bacteria 1309
90 Ga0075362_10074826 3300006177 Bacteria 1552
91 Ga0075367_10001548 3300006178 Bacteria 9947
92 Ga0075369_10028673 3300006186 Bacteria 2334
93 Ga0075370_10381938 3300006353 Bacteria 844
94 Ga0075428_100106598 3300006844 Bacteria 3055
95 Ga0075430_100037838 3300006846 Bacteria 4090
96 Ga0075431_100080500 3300006847 Bacteria 3363
97 Ga0075433_10008069 3300006852 Bacteria 8382
98 Ga0075434_100002979 3300006871 Bacteria 15067
99 Ga0068865_100498240 3300006881 Bacteria 1015
100 Ga0075435_100001787 3300007076 Bacteria 13994
101 Ga0099794_10010276 3300007265 Bacteria 3967
102 Ga0105250_10006700 3300009092 Bacteria 5006
103 Ga0105240_10024884 3300009093 Bacteria 7881
104 Ga0105240_10066371 3300009093 Bacteria 4477
105 Ga0111539_10035256 3300009094 Bacteria 6059
106 Ga0105247_10081457 3300009101 Bacteria 2041
107 Ga0114129_10007097 3300009147 Bacteria 15942
108 Ga0114129_10042922 3300009147 Bacteria 6364
109 Ga0114129_10130812 3300009147 Bacteria 3447
110 Ga0105243_10279568 3300009148 Bacteria 1503
111 Ga0105242_10205025 3300009176 Bacteria 1753
112 Ga0105248_10019813 3300009177 Bacteria 7451
113 Ga0105237_10346183 3300009545 Bacteria 1490
114 Ga0105237_10611459 3300009545 Bacteria 1097
115 Ga0105249_10201227 3300009553 Bacteria 1949
116 Ga0123341_1000001 3300009765 Bacteria 314908
117 Ga0123342_1014705 3300009766 Bacteria 7379
118 Ga0099796_10022005 3300010159 Bacteria 1972
119 Ga0099796_10038215 3300010159 Bacteria 1609
120 Ga0105239_10226497 3300010375 Bacteria 2097
121 Ga0157370_10019096 3300013104 Bacteria 6890
122 Ga0157374_10194314 3300013296 Unclassified 1986
123 Ga0157380_10000342 3300014326 Bacteria 27911
124 Ga0182008_10052298 3300014497 Bacteria 2025
125 Ga0157376_10192925 3300014969 Bacteria 1869
126 Ga0213872_10011509 3300021361 Bacteria 4184
127 Ga0209436_100361 3300025208 Bacteria 20593
128 Ga0209674_100067 3300025226 Bacteria 253824
129 Ga0209563_100068 3300025230 Bacteria 254802
130 Ga0207425_1008731 3300025245 Bacteria 2568
131 Ga0207425_1009115 3300025245 Bacteria 2490
132 Ga0207425_1013189 3300025245 Bacteria 1916
133 Ga0209677_100049 3300025253 Bacteria 180721
134 Ga0209677_101808 3300025253 Bacteria 8758
135 Ga0209148_1009593 3300025254 Bacteria 1876
136 Ga0209759_1000978 3300025256 Bacteria 19762
137 Ga0209129_1001535 3300025258 Bacteria 12746
138 Ga0209129_1002325 3300025258 Bacteria 9409
139 Ga0209129_1003783 3300025258 Bacteria 6357
140 Ga0209129_1012809 3300025258 Bacteria 1890
141 Ga0209233_1013804 3300025261 Bacteria 2298
142 Ga0209455_1003249 3300025272 Bacteria 5855
143 Ga0209673_1000068 3300025273 Bacteria 245891
144 Ga0209673_1000310 3300025273 Bacteria 89821
145 Ga0209673_1000348 3300025273 Bacteria 84966
146 Ga0209673_1002113 3300025273 Bacteria 14887
147 Ga0209673_1006019 3300025273 Bacteria 5964
148 Ga0209673_1008798 3300025273 Bacteria 4452
149 Ga0209130_1000006 3300025284 Bacteria 596528
150 Ga0209130_1000012 3300025284 Bacteria 421329
151 Ga0209676_1011024 3300025292 Bacteria 3693
152 Ga0209025_1000097 3300025294 Bacteria 236632
153 Ga0209025_1004704 3300025294 Bacteria 11653
154 Ga0209025_1008093 3300025294 Bacteria 7647
155 Ga0209025_1023600 3300025294 Bacteria 3206
156 Ga0209564_1000137 3300025295 Bacteria 183874
157 Ga0209564_1000739 3300025295 Bacteria 46443
158 Ga0209564_1000966 3300025295 Bacteria 36349
159 Ga0209564_1004497 3300025295 Bacteria 8505
160 Ga0209564_1009101 3300025295 Bacteria 4781
161 Ga0209758_1000714 3300025297 Bacteria 49025
162 Ga0209758_1001743 3300025297 Bacteria 24215
163 Ga0209758_1002296 3300025297 Bacteria 19769
164 Ga0209758_1008924 3300025297 Bacteria 6361
165 Ga0209758_1008929 3300025297 Bacteria 6358
166 Ga0209050_1001715 3300025298 Bacteria 21877
167 Ga0209256_1000397 3300025299 Bacteria 68947
168 Ga0209256_1001022 3300025299 Bacteria 32877
169 Ga0209256_1005212 3300025299 Bacteria 7633
170 Ga0209256_1006066 3300025299 Bacteria 6589
171 Ga0207426_1000003 3300025302 Bacteria 1063212
172 Ga0207426_1000010 3300025302 Bacteria 796003
173 Ga0207426_1000094 3300025302 Bacteria 275293
174 Ga0207426_1003738 3300025302 Bacteria 7948
175 Ga0209051_1000201 3300025303 Bacteria 106123
176 Ga0209051_1001312 3300025303 Bacteria 21851
177 Ga0209051_1019336 3300025303 Bacteria 2976
178 Ga0209051_1030961 3300025303 Bacteria 2067
179 Ga0209257_1001768 3300025304 Bacteria 23940
180 Ga0209257_1002387 3300025304 Bacteria 18814
181 Ga0209257_1014345 3300025304 Bacteria 3409
182 Ga0207710_10018041 3300025900 Bacteria 2998
183 Ga0207705_10017565 3300025909 Bacteria 5121
184 Ga0207705_10108138 3300025909 Bacteria 2052
185 Ga0207707_10015378 3300025912 Bacteria 6664
186 Ga0207707_10361657 3300025912 Bacteria 1249
187 Ga0207695_10007496 3300025913 Bacteria 13854
188 Ga0207695_10063748 3300025913 Bacteria 3798
189 Ga0207671_10136072 3300025914 Bacteria 1889
190 Ga0207660_10072909 3300025917 Bacteria 2502
191 Ga0207652_10511802 3300025921 Unclassified 1080
192 Ga0207700_10126716 3300025928 Bacteria 2078
193 Ga0207644_10088264 3300025931 Bacteria 2306
194 Ga0207690_10039999 3300025932 Bacteria 3062
195 Ga0207709_10013955 3300025935 Bacteria 4436
196 Ga0207691_10475069 3300025940 Bacteria 1063
197 Ga0207711_10372648 3300025941 Bacteria 1324
198 Ga0207667_10013254 3300025949 Bacteria 9449
199 Ga0207667_10124317 3300025949 Bacteria 2658
200 Ga0207712_10237192 3300025961 Bacteria 1467
201 Ga0207702_10239045 3300026078 Bacteria 1701
202 Ga0207676_10399010 3300026095 Bacteria 1285
203 Ga0207675_100057149 3300026118 Bacteria 3640
204 Ga0207675_100140082 3300026118 Bacteria 2297
205 Ga0207683_10377205 3300026121 Bacteria 1303
206 Ga0209588_1012102 3300027671 Bacteria 2616
207 Ga0307515_10056344 3300028794 Bacteria 5715
208 Ga0307511_10000036 3300030521 Bacteria 103249
209 Ga0307513_10047444 3300031456 Bacteria 4673
210 Ga0307509_10511758 3300031507 Bacteria 883
211 Ga0307408_100041831 3300031548 Bacteria 3251
212 Ga0307410_10043234 3300031852 Bacteria 2984
213 Ga0307407_10046698 3300031903 Bacteria 2453
214 Ga0307416_100425356 3300032002 Bacteria 1374
215 Ga0436361_0151558 3300039447 Bacteria 5864
216 Ga0436361_0191516 3300039447 Bacteria 4168
217 Ga0439436_0027971 3300041404 Bacteria 1647
218 Ga0439465_0009331 3300041413 Bacteria 3092
219 Ga0439465_0010918 3300041413 Bacteria 2849
220 Ga0451787_130413 3300041441 Bacteria 2673
221 Ga0451791_0487884 3300041451 Bacteria 1812
222 Ga0451791_0954775 3300041451 Bacteria 4129
223 Ga0451793_1076619 3300041452 Bacteria 3465
224 Ga0451833_0887560 3300041491 Bacteria 3077
225 Ga0451837_0082266 3300041494 Bacteria 2458
226 Ga0451839_0865257 3300041496 Bacteria 856
227 Ga0451841_0194129 3300041498 Bacteria 5957
228 Ga0451841_1431128 3300041498 Bacteria 2696
229 Ga0451845_0835782 3300041501 Bacteria 1399
230 Ga0451855_0695010 3300041511 Bacteria 1317
231 Ga0451853_0201273 3300041512 Bacteria 4533
232 Ga0439431_0062065 3300041997 Bacteria 985
233 Ga0439449_0044246 3300042007 Bacteria 1651
234 Ga0466969_0004885 3300044656 Bacteria 7142
235 Ga0466972_0035303 3300044658 Bacteria 2447
236 Ga0466965_0024538 3300044683 Bacteria 2917
237 Ga0466966_0006267 3300044684 Bacteria 7868
238 Ga0466961_0020199 3300044693 Bacteria 4286
239 Ga0466963_0080204 3300044694 Bacteria 2209
240 Ga0466964_0002940 3300044706 Bacteria 6151
241 Ga0466971_0041909 3300044719 Bacteria 2056
242 Ga0466968_0007141 3300044735 Bacteria 4241
243 Ga0466970_0154108 3300044765 Bacteria 1269
244 Ga0466957_0002121 3300044842 Bacteria 10623
245 Ga0466957_0140921 3300044842 Bacteria 1553
246 Ga0466960_0087813 3300044901 Bacteria 1580
247 Ga0466959_0012969 3300045049 Bacteria 6034
248 Ga0466958_0029411 3300045836 Bacteria 3260
249 Ga0466967_0018645 3300045976 Bacteria 5554
250 Ga0495617_077242 3300046452 Bacteria 1092
251 Ga0495629_0592268 3300046459 Bacteria 742
252 Ga0495638_0002612 3300046460 Bacteria 14506
253 Ga0495650_0004119 3300046471 Bacteria 10129
254 Ga0495650_0028483 3300046471 Unclassified 2563
255 Ga0495580_0096682 3300046472 Bacteria 2054
256 Ga0495605_0001565 3300046474 Bacteria 14872
257 Ga0495605_0057614 3300046474 Bacteria 1869
258 Ga0495664_0042627 3300046477 Bacteria 2688
259 Ga0495607_0000044 3300046501 Bacteria 125410
260 Ga0495607_0015234 3300046501 Bacteria 4986
261 Ga0495583_0000173 3300046506 Bacteria 109405
262 Ga0495583_0081999 3300046506 Bacteria 1400
263 Ga0495606_0000129 3300046507 Bacteria 127929
264 Ga0495606_0001243 3300046507 Bacteria 35607
265 Ga0495606_0021093 3300046507 Bacteria 4779
266 Ga0495606_0104088 3300046507 Bacteria 1723
267 Ga0495610_0126618 3300046512 Bacteria 1113
268 Ga0495631_0117928 3300046518 Bacteria 1141
269 Ga0495643_0018882 3300046522 Bacteria 3994
270 Ga0495643_0060918 3300046522 Bacteria 2002
271 Ga0495648_0019577 3300046524 Bacteria 4754
272 Ga0495609_0106492 3300046538 Bacteria 1212
273 Ga0495633_0012390 3300046558 Bacteria 4537
274 Ga0495656_0178282 3300046615 Bacteria 1043
275 Ga0495668_0039569 3300046616 Bacteria 2632
276 Ga0495668_0125480 3300046616 Bacteria 1405
277 Ga0495668_0232370 3300046616 Bacteria 1010
278 Ga0495625_0101280 3300046660 Bacteria 1978
279 Ga0495661_0005158 3300046665 Bacteria 9307
280 Ga0495661_0219701 3300046665 Bacteria 985
281 Ga0495670_0006868 3300046691 Bacteria 5600
282 Ga0495649_0001153 3300046694 Bacteria 20576
283 Ga0495589_0006876 3300046794 Bacteria 5981
284 Ga0495660_0222312 3300046810 Bacteria 889
285 Ga0495683_0088637 3300047323 Bacteria 1502
286 Ga0495679_081363 3300047446 Bacteria 919
287 Ga0495673_0000904 3300047469 Bacteria 27167
288 Ga0495681_0081969 3300047470 Bacteria 1438
289 Ga0495686_0045031 3300047472 Bacteria 2792
290 Ga0495686_0056915 3300047472 Bacteria 2441
291 Ga0495593_0061508 3300047673 Bacteria 1964
292 Ga0495615_0061768 3300048090 Bacteria 990
293 Ga0495626_0037523 3300048091 Bacteria 2302
294 Ga0496102_0412384 3300048905 Bacteria 1269
295 Ga0496104_0000291 3300048907 Bacteria 44138
296 Ga0496104_0018320 3300048907 Bacteria 6388
297 Ga0496106_0000046 3300048909 Bacteria 101516
298 Ga0496106_0003765 3300048909 Bacteria 11299
299 Ga0496116_0064870 3300048919 Bacteria 2345
300 Ga0496116_0109687 3300048919 Bacteria 1626
301 Ga0496116_0109742 3300048919 Bacteria 1625
302 Ga0496118_0082865 3300048921 Bacteria 2245
303 Ga0496120_0158774 3300048923 Bacteria 1129
304 Ga0496121_0000102 3300048924 Bacteria 195341
305 Ga0496121_0048567 3300048924 Bacteria 3609
306 Ga0496121_0097355 3300048924 Bacteria 2280
307 Ga0496121_0129475 3300048924 Bacteria 1892
308 Ga0496121_0178605 3300048924 Bacteria 1535
309 Ga0496121_0323498 3300048924 Bacteria 1037
310 Ga0496122_0058147 3300048925 Bacteria 2865
311 Ga0496122_0150691 3300048925 Bacteria 1436
312 Ga0496123_0056860 3300048926 Bacteria 2552
313 Ga0496124_0022521 3300048927 Bacteria 5772
314 Ga0496124_0028556 3300048927 Bacteria 4988
315 Ga0496124_0062304 3300048927 Bacteria 3121
316 Ga0496125_0024433 3300048928 Bacteria 5557
317 Ga0496125_0042310 3300048928 Bacteria 3882
318 Ga0496126_0000679 3300048929 Bacteria 62626
319 Ga0496126_0075724 3300048929 Bacteria 2986
320 Ga0496126_0078879 3300048929 Bacteria 2917
321 Ga0496126_0177483 3300048929 Bacteria 1811
322 Ga0501031_0195385 3300049568 Bacteria 1321
323 Ga0501032_0108557 3300049569 Bacteria 1837
324 Ga0501033_0163087 3300049570 Bacteria 1604
325 Ga0501036_0208314 3300049572 Bacteria 1643
326 Ga0501037_0125484 3300049573 Bacteria 1843
327 Ga0501043_0235261 3300049579 Bacteria 1414
328 Ga0501043_0288326 3300049579 Bacteria 1257
329 Ga0501046_0046111 3300049580 Bacteria 3461
330 Ga0501046_0433852 3300049580 Bacteria 946
331 Ga0501068_0214366 3300049584 Bacteria 1223
332 Ga0501068_0227315 3300049584 Bacteria 1186
333 Ga0501073_0192190 3300049589 Bacteria 1412
334 Ga0501083_0169923 3300049744 Bacteria 1425
335 Ga0501083_0270297 3300049744 Bacteria 1106
336 Ga0501044_0283823 3300049823 Bacteria 1588
337 nmdc:mga03683_45363_c1 3300050489 Bacteria 1819
338 nmdc:mga0yw44_19063_c1 3300050492 Bacteria 3775
339 nmdc:mga0k408_83818_c1 3300050493 Bacteria 1869
340 nmdc:mga05p37_139945_c1 3300050507 Bacteria 2966
341 nmdc:mga05p37_91640_c1 3300050507 Bacteria 3745
342 nmdc:mga09592_1232_c1 3300050508 Bacteria 20495
343 nmdc:mga09592_296169_c1 3300050508 Bacteria 1403
344 nmdc:mga0qj67_42398_c1 3300050509 Bacteria 3582
345 nmdc:mga08y16_111226_c1 3300050511 Bacteria 2852
346 nmdc:mga0n895_12421_c1 3300050512 Bacteria 7640
347 nmdc:mga0rr50_22977_c1 3300050513 Bacteria 4290
348 nmdc:mga0a205_2900_c1 3300050515 Bacteria 15175
349 Ga0500643_000256 3300053087 Bacteria 48356
350 Ga0500644_0101721 3300053088 Bacteria 1093
351 Ga0500646_0002876 3300053090 Bacteria 4414
352 Ga0500583_0038358 3300053092 Bacteria 2157
353 Ga0500651_0336478 3300053093 Bacteria 859
354 Ga0500595_058609 3300053119 Bacteria 1170
355 Ga0500618_007052 3300053125 Bacteria 3241
356 Ga0500642_0184485 3300053130 Bacteria 975
357 Ga0500658_0028157 3300053134 Bacteria 2178
358 Ga0500564_058444 3300053138 Bacteria 1753
359 Ga0500568_0000106 3300053139 Bacteria 77620
360 Ga0500568_0032685 3300053139 Bacteria 2138
361 Ga0500604_0000901 3300053151 Bacteria 8215
362 Ga0500604_0012235 3300053151 Bacteria 2315
363 Ga0500622_0001154 3300053156 Bacteria 21943
364 Ga0500622_0048121 3300053156 Bacteria 2201
365 Ga0500638_196404 3300053162 Bacteria 857
366 Ga0501084_0113202 3300054114 Bacteria 2281
367 Ga0500661_005921 3300055283 Bacteria 2280
368 Ga0501082_0229112 3300060353 Bacteria 1617
369 Ga0501082_0233660 3300060353 Bacteria 1600
370 Ga0466962_0054086 3300061719 Bacteria 1918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100010304 Ga0070714_1000103046 177
2 3300005436 Ga0070713_100174867 Ga0070713_1001748672 177
3 3300025928 Ga0207700_10126716 Ga0207700_101267161 177
4 3300048929 Ga0496126_0075724 Ga0496126_0075724_121_870 178
5 3300003323 rootH1_10149944 rootH1_101499441 204
6 3300003320 rootH2_10059413 rootH2_100594134 213
7 3300031548 Ga0307408_100041831 Ga0307408_1000418314 213
8 3300031852 Ga0307410_10043234 Ga0307410_100432343 213
9 3300031903 Ga0307407_10046698 Ga0307407_100466982 213
10 3300046459 Ga0495629_0592268 Ga0495629_0592268_11_730 216
11 3300048905 Ga0496102_0412384 Ga0496102_0412384_267_1049 217
12 3300053087 Ga0500643_000256 Ga0500643_000256_9856_10614 218
13 3300025254 Ga0209148_1009593 Ga0209148_10095932 221
14 3300025272 Ga0209455_1003249 Ga0209455_10032494 221
15 iso_pu_bacteria 2908674828 2908676725 223
16 iso_pu_bacteria 2919039151 2919041558 223
17 iso_pu_bacteria 2928500415 2928502796 223
18 3300005327 Ga0070658_10065242 Ga0070658_100652426 225
19 3300005458 Ga0070681_10141978 Ga0070681_101419782 225
20 3300005530 Ga0070679_100025377 Ga0070679_1000253771 225
21 3300005563 Ga0068855_100031798 Ga0068855_1000317987 225
22 3300005614 Ga0068856_100167113 Ga0068856_1001671133 225
23 3300006038 Ga0075365_10295039 Ga0075365_102950392 225
24 3300009093 Ga0105240_10066371 Ga0105240_100663716 225
25 3300009545 Ga0105237_10611459 Ga0105237_106114591 225
26 3300013104 Ga0157370_10019096 Ga0157370_100190962 225
27 3300025909 Ga0207705_10108138 Ga0207705_101081383 225
28 3300025912 Ga0207707_10361657 Ga0207707_103616571 225
29 3300025913 Ga0207695_10063748 Ga0207695_100637485 225
30 3300025917 Ga0207660_10072909 Ga0207660_100729095 225
31 3300025949 Ga0207667_10013254 Ga0207667_100132544 225
32 3300026078 Ga0207702_10239045 Ga0207702_102390452 225
33 3300041451 Ga0451791_0487884 Ga0451791_0487884_886_1635 225
34 3300041452 Ga0451793_1076619 Ga0451793_1076619_733_1479 225
35 3300048925 Ga0496122_0150691 Ga0496122_0150691_599_1345 225
36 3300048927 Ga0496124_0062304 Ga0496124_0062304_1809_2555 225
37 3300048929 Ga0496126_0078879 Ga0496126_0078879_886_1635 225
38 3300006844 Ga0075428_100106598 Ga0075428_1001065981 226
39 3300006846 Ga0075430_100037838 Ga0075430_1000378383 226
40 3300030521 Ga0307511_10000036 Ga0307511_1000003610 226
41 3300048924 Ga0496121_0178605 Ga0496121_0178605_423_1196 226
42 3300050509 nmdc:mga0qj67_42398_c1 nmdc:mga0qj67_42398_c1_2149_2916 226
43 3300053162 Ga0500638_196404 Ga0500638_196404_55_828 226
44 3300007265 Ga0099794_10010276 Ga0099794_100102763 227
45 3300032002 Ga0307416_100425356 Ga0307416_1004253562 227
46 3300009101 Ga0105247_10081457 Ga0105247_100814573 228
47 3300002773 JGI25152J39213_1003247 JGI25152J39213_10032472 229
48 iso_pu_bacteria 2791355137 2792839590 230
49 iso_pu_bacteria 2876761206 2876762089 230
50 iso_pu_bacteria 2509276021 2509387348 231
51 iso_pu_bacteria 2509276033 2509442747 231
52 iso_pu_bacteria 2510461076 2510893983 231
53 iso_pu_bacteria 2510461076 2510899008 231
54 iso_pu_bacteria 2510917028 2511183508 231
55 iso_pu_bacteria 2510917030 2511193869 231
56 iso_pu_bacteria 2513237084 2513570209 231
57 iso_pu_bacteria 2513237088 2513598008 231
58 iso_pu_bacteria 2513237093 2513632831 231
59 iso_pu_bacteria 2513237098 2513676840 231
60 iso_pu_bacteria 2513237103 2513710441 231
61 iso_pu_bacteria 2513237138 2513870648 231
62 iso_pu_bacteria 2513237162 2514019683 231
63 iso_pu_bacteria 2515075009 2515111636 231
64 iso_pu_bacteria 2515154113 2515634876 231
65 iso_pu_bacteria 2515154114 2515641961 231
66 iso_pu_bacteria 2515154116 2515656028 231
67 iso_pu_bacteria 2516653077 2517040319 231
68 iso_pu_bacteria 2517093000 2517094399 231
69 iso_pu_bacteria 2529292951 2530644940 231
70 iso_pu_bacteria 2534681796 2535516016 231
71 iso_pu_bacteria 2582581294 2585199756 231
72 iso_pu_bacteria 2582581298 2585226069 231
73 iso_pu_bacteria 2582581867 2585400568 231
74 iso_pu_bacteria 2585427528 2585540173 231
75 iso_pu_bacteria 2585427529 2585547102 231
76 iso_pu_bacteria 2585427590 2585819869 231
77 iso_pu_bacteria 2585427593 2585838371 231
78 iso_pu_bacteria 2615840624 2616292976 231
79 iso_pu_bacteria 2718217882 2719180605 231
80 iso_pu_bacteria 2718217927 2719385207 231
81 iso_pu_bacteria 2718217997 2719665030 231
82 iso_pu_bacteria 2718218009 2719731354 231
83 iso_pu_bacteria 2718218199 2720491450 231
84 iso_pu_bacteria 2718218232 2720612745 231
85 iso_pu_bacteria 2718218233 2720619600 231
86 iso_pu_bacteria 2718218235 2720631038 231
87 iso_pu_bacteria 2718218269 2720774676 231
88 iso_pu_bacteria 2718218363 2721146699 231
89 iso_pu_bacteria 2718218365 2721158222 231
90 iso_pu_bacteria 2718218366 2721163578 231
91 iso_pu_bacteria 2718218423 2721398926 231
92 iso_pu_bacteria 2721755514 2722839748 231
93 iso_pu_bacteria 2721755556 2723026402 231
94 iso_pu_bacteria 2721755684 2723559945 231
95 iso_pu_bacteria 2721755685 2723566564 231
96 iso_pu_bacteria 2721755809 2724037739 231
97 iso_pu_bacteria 2721755810 2724044110 231
98 iso_pu_bacteria 2721755819 2724089283 231
99 iso_pu_bacteria 2721755822 2724103829 231
100 iso_pu_bacteria 2721755823 2724109667 231
101 iso_pu_bacteria 2724679232 2725951648 231
102 iso_pu_bacteria 2728369352 2730107338 231
103 iso_pu_bacteria 2728369365 2730163842 231
104 iso_pu_bacteria 2728369397 2730297854 231
105 iso_pu_bacteria 2738541333 2739037812 231
106 iso_pu_bacteria 2765235942 2766063626 231
107 iso_pu_bacteria 2791355256 2793296981 231
108 iso_pu_bacteria 2791355259 2793315545 231
109 iso_pu_bacteria 2791355260 2793321414 231
110 iso_pu_bacteria 2791355261 2793328765 231
111 iso_pu_bacteria 2791355262 2793335176 231
112 iso_pu_bacteria 2791355263 2793342640 231
113 iso_pu_bacteria 2791355264 2793350148 231
114 iso_pu_bacteria 2791355265 2793352088 231
115 iso_pu_bacteria 2791355266 2793360559 231
116 iso_pu_bacteria 2791355267 2793366226 231
117 iso_pu_bacteria 2802429633 2806048541 231
118 iso_pu_bacteria 2802429634 2806053616 231
119 iso_pu_bacteria 2802429635 2806060816 231
120 iso_pu_bacteria 2802429636 2806067691 231
121 iso_pu_bacteria 2802429637 2806072957 231
122 iso_pu_bacteria 2818991459 2819669940 231
123 iso_pu_bacteria 2838016132 2838018531 231
124 iso_pu_bacteria 2838022645 2838022754 231
125 iso_pu_bacteria 2838042994 2838047746 231
126 iso_pu_bacteria 2838048938 2838054054 231
127 iso_pu_bacteria 2838061910 2838066558 231
128 iso_pu_bacteria 2838068647 2838071165 231
129 iso_pu_bacteria 2838680041 2838682829 231
130 iso_pu_bacteria 2838694306 2838697462 231
131 iso_pu_bacteria 2838707686 2838709360 231
132 iso_pu_bacteria 2841864319 2841865126 231
133 iso_pu_bacteria 2842077413 2842077471 231
134 iso_pu_bacteria 2842110456 2842111192 231
135 iso_pu_bacteria 2842118031 2842120020 231
136 iso_pu_bacteria 2842198810 2842201419 231
137 iso_pu_bacteria 2842217011 2842220386 231
138 iso_pu_bacteria 2842237096 2842238772 231
139 iso_pu_bacteria 2842264693 2842268652 231
140 iso_pu_bacteria 2842285085 2842287807 231
141 iso_pu_bacteria 2842291075 2842291133 231
142 iso_pu_bacteria 2842311132 2842315130 231
143 iso_pu_bacteria 2842341865 2842347120 231
144 iso_pu_bacteria 2842370503 2842373458 231
145 iso_pu_bacteria 2842377471 2842377529 231
146 iso_pu_bacteria 2842384541 2842386531 231
147 iso_pu_bacteria 2842395702 2842399711 231
148 iso_pu_bacteria 2842402390 2842404665 231
149 iso_pu_bacteria 2842409023 2842411248 231
150 iso_pu_bacteria 2842415677 2842418303 231
151 iso_pu_bacteria 2842422224 2842425179 231
152 iso_pu_bacteria 2842428310 2842432785 231
153 iso_pu_bacteria 2842434925 2842439090 231
154 iso_pu_bacteria 2842441272 2842445719 231
155 iso_pu_bacteria 2842447887 2842451433 231
156 iso_pu_bacteria 2842462802 2842466929 231
157 iso_pu_bacteria 2842469257 2842473704 231
158 iso_pu_bacteria 2852387548 2852389440 231
159 iso_pu_bacteria 2857516855 2857523366 231
160 iso_pu_bacteria 2903768456 2903774620 231
161 iso_pu_bacteria 2919100787 2919104185 231
162 iso_pu_bacteria 2919171160 2919176028 231
163 iso_pu_bacteria 2923556063 2923558363 231
164 iso_pu_bacteria 2933586486 2933587217 231
165 iso_pu_bacteria 2933599457 2933601964 231
166 iso_pu_bacteria 2935894831 2935900404 231
167 iso_pu_bacteria 2936367885 2936373396 231
168 iso_pu_bacteria 2936375103 2936378665 231
169 iso_pu_bacteria 2936381700 2936387714 231
170 iso_pu_bacteria 2996887358 2996892228 231
171 iso_pu_bacteria 2996893221 2996893963 231
172 iso_pu_bacteria 3005445848 3005447042 231
173 iso_pu_bacteria 639633055 639647841 231
174 iso_pu_bacteria 8005258706 8005259574 231
175 iso_pu_bacteria 8005275841 8005279983 231
176 iso_pu_bacteria 8005282627 8005284080 231
177 iso_pu_bacteria 8005289223 8005294581 231
178 iso_pu_bacteria 8005301065 8005307233 231
179 iso_pu_bacteria 8005321885 8005326755 231
180 iso_pu_bacteria 8005376324 8005378567 231
181 iso_pu_bacteria 8005382845 8005384810 231
182 iso_pu_bacteria 8005395548 8005398259 231
183 iso_pu_bacteria 8005430974 8005436315 231
184 iso_pu_bacteria 8005460587 8005462288 231
185 iso_pu_bacteria 8005497431 8005499696 231
186 iso_pu_bacteria 8005542996 8005544713 231
187 iso_pu_bacteria 8005556819 8005558343 231
188 iso_pu_bacteria 8005563573 8005569524 231
189 iso_pu_bacteria 8005570704 8005575198 231
190 iso_pu_bacteria 8005619151 8005620877 231
191 iso_pu_bacteria 8005626139 8005627378 231
192 iso_pu_bacteria 8005668836 8005671117 231
193 iso_pu_bacteria 8005688590 8005695143 231
194 iso_pu_bacteria 8005695170 8005696380 231
195 iso_pu_bacteria 8018127388 8018128335 231
196 iso_pu_bacteria 8018163183 8018164778 231
197 iso_pu_bacteria 8018176218 8018177769 231
198 iso_pu_bacteria 8024479707 8024485531 231
199 iso_pu_bacteria 8056382006 8056387759 231
200 iso_pu_bacteria 8057874678 8057875723 231
201 3300046507 Ga0495606_0000129 Ga0495606_0000129_19234_20010 232
202 3300053093 Ga0500651_0336478 Ga0500651_0336478_16_783 232
203 iso_pu_bacteria 2585428059 2587741620 232
204 iso_pu_bacteria 2643221676 2644422092 232
205 iso_pu_bacteria 2842363717 2842366954 232
206 iso_pu_bacteria 2904113452 2904115600 232
207 iso_pu_bacteria 2971410472 2971415270 232
208 iso_pu_bacteria 8056533031 8056540666 232
209 3300044656 Ga0466969_0004885 Ga0466969_0004885_1395_2165 233
210 3300044683 Ga0466965_0024538 Ga0466965_0024538_1616_2386 233
211 3300044684 Ga0466966_0006267 Ga0466966_0006267_4317_5087 233
212 3300044693 Ga0466961_0020199 Ga0466961_0020199_1396_2166 233
213 3300044694 Ga0466963_0080204 Ga0466963_0080204_94_864 233
214 3300044706 Ga0466964_0002940 Ga0466964_0002940_404_1174 233
215 3300044719 Ga0466971_0041909 Ga0466971_0041909_1268_2038 233
216 3300044735 Ga0466968_0007141 Ga0466968_0007141_301_1071 233
217 3300044765 Ga0466970_0154108 Ga0466970_0154108_227_997 233
218 3300044842 Ga0466957_0002121 Ga0466957_0002121_6869_7639 233
219 3300044842 Ga0466957_0140921 Ga0466957_0140921_349_1221 233
220 3300045049 Ga0466959_0012969 Ga0466959_0012969_1845_2615 233
221 3300045836 Ga0466958_0029411 Ga0466958_0029411_1230_2000 233
222 3300045976 Ga0466967_0018645 Ga0466967_0018645_4358_5128 233
223 3300061719 Ga0466962_0054086 Ga0466962_0054086_19_789 233
224 3300003316 rootH1_10029736 rootH1_100297364 234
225 3300003323 rootH1_10031533 rootH1_100315335 234
226 3300003323 rootH1_10125278 rootH1_101252781 234
227 3300003752 Ga0055539_1000280 Ga0055539_100028015 234
228 3300003756 Ga0055533_1000043 Ga0055533_1000043106 234
229 3300003759 Ga0055525_1000981 Ga0055525_10009816 234
230 3300003792 Ga0055540_1007015 Ga0055540_10070154 234
231 3300003841 Ga0055541_1006854 Ga0055541_10068543 234
232 3300005288 Ga0065714_10066554 Ga0065714_100665544 234
233 3300005295 Ga0065707_10082114 Ga0065707_1008211419 234
234 3300005327 Ga0070658_10016510 Ga0070658_100165103 234
235 3300005327 Ga0070658_10529010 Ga0070658_105290102 234
236 3300005330 Ga0070690_100008323 Ga0070690_1000083234 234
237 3300005334 Ga0068869_100086100 Ga0068869_1000861002 234
238 3300005366 Ga0070659_100034270 Ga0070659_1000342701 234
239 3300005455 Ga0070663_100228413 Ga0070663_1002284132 234
240 3300005543 Ga0070672_100264865 Ga0070672_1002648652 234
241 3300005563 Ga0068855_100065397 Ga0068855_1000653974 234
242 3300005719 Ga0068861_100004819 Ga0068861_1000048193 234
243 3300006028 Ga0070717_10213264 Ga0070717_102132641 234
244 3300006881 Ga0068865_100498240 Ga0068865_1004982402 234
245 3300009093 Ga0105240_10024884 Ga0105240_100248847 234
246 3300009545 Ga0105237_10346183 Ga0105237_103461832 234
247 3300010375 Ga0105239_10226497 Ga0105239_102264973 234
248 3300014326 Ga0157380_10000342 Ga0157380_1000034213 234
249 3300014497 Ga0182008_10052298 Ga0182008_100522982 234
250 3300021361 Ga0213872_10011509 Ga0213872_100115093 234
251 3300025226 Ga0209674_100067 Ga0209674_100067106 234
252 3300025230 Ga0209563_100068 Ga0209563_100068106 234
253 3300025253 Ga0209677_100049 Ga0209677_10004955 234
254 3300025253 Ga0209677_101808 Ga0209677_1018086 234
255 3300025256 Ga0209759_1000978 Ga0209759_10009788 234
256 3300025303 Ga0209051_1030961 Ga0209051_10309612 234
257 3300025909 Ga0207705_10017565 Ga0207705_100175653 234
258 3300025913 Ga0207695_10007496 Ga0207695_1000749611 234
259 3300025914 Ga0207671_10136072 Ga0207671_101360723 234
260 3300025932 Ga0207690_10039999 Ga0207690_100399993 234
261 3300025935 Ga0207709_10013955 Ga0207709_100139552 234
262 3300025940 Ga0207691_10475069 Ga0207691_104750692 234
263 3300025949 Ga0207667_10124317 Ga0207667_101243173 234
264 3300026118 Ga0207675_100057149 Ga0207675_1000571493 234
265 3300026118 Ga0207675_100140082 Ga0207675_1001400824 234
266 3300026121 Ga0207683_10377205 Ga0207683_103772052 234
267 3300031507 Ga0307509_10511758 Ga0307509_105117581 234
268 3300039447 Ga0436361_0151558 Ga0436361_0151558_1472_2245 234
269 3300039447 Ga0436361_0191516 Ga0436361_0191516_3036_3809 234
270 3300044658 Ga0466972_0035303 Ga0466972_0035303_1590_2363 234
271 3300044901 Ga0466960_0087813 Ga0466960_0087813_733_1506 234
272 3300046460 Ga0495638_0002612 Ga0495638_0002612_10912_11685 234
273 3300046471 Ga0495650_0004119 Ga0495650_0004119_2322_3209 234
274 3300046471 Ga0495650_0028483 Ga0495650_0028483_1712_2485 234
275 3300046474 Ga0495605_0001565 Ga0495605_0001565_1979_2752 234
276 3300046477 Ga0495664_0042627 Ga0495664_0042627_1628_2437 234
277 3300046501 Ga0495607_0000044 Ga0495607_0000044_21137_21910 234
278 3300046506 Ga0495583_0000173 Ga0495583_0000173_32250_33023 234
279 3300046507 Ga0495606_0001243 Ga0495606_0001243_30615_31388 234
280 3300046507 Ga0495606_0021093 Ga0495606_0021093_1981_2799 234
281 3300046616 Ga0495668_0039569 Ga0495668_0039569_104_877 234
282 3300046665 Ga0495661_0005158 Ga0495661_0005158_83_856 234
283 3300046694 Ga0495649_0001153 Ga0495649_0001153_7771_8544 234
284 3300046794 Ga0495589_0006876 Ga0495589_0006876_562_1335 234
285 3300047469 Ga0495673_0000904 Ga0495673_0000904_17912_18763 234
286 3300047472 Ga0495686_0045031 Ga0495686_0045031_1143_1916 234
287 3300047472 Ga0495686_0056915 Ga0495686_0056915_904_1683 234
288 3300047673 Ga0495593_0061508 Ga0495593_0061508_17_790 234
289 3300048091 Ga0495626_0037523 Ga0495626_0037523_273_1046 234
290 3300048907 Ga0496104_0000291 Ga0496104_0000291_15703_16527 234
291 3300048921 Ga0496118_0082865 Ga0496118_0082865_82_855 234
292 3300048924 Ga0496121_0323498 Ga0496121_0323498_111_884 234
293 3300048927 Ga0496124_0022521 Ga0496124_0022521_3947_4798 234
294 3300053090 Ga0500646_0002876 Ga0500646_0002876_103_879 234
295 3300053092 Ga0500583_0038358 Ga0500583_0038358_962_1738 234
296 3300053119 Ga0500595_058609 Ga0500595_058609_241_1014 234
297 3300053130 Ga0500642_0184485 Ga0500642_0184485_16_882 234
298 3300053138 Ga0500564_058444 Ga0500564_058444_565_1338 234
299 3300053139 Ga0500568_0032685 Ga0500568_0032685_69_956 234
300 3300053151 Ga0500604_0000901 Ga0500604_0000901_48_935 234
301 3300055283 Ga0500661_005921 Ga0500661_005921_55_828 234
302 3300002739 JGI25158J39367_1003026 JGI25158J39367_10030262 235
303 3300002773 JGI25152J39213_1005508 JGI25152J39213_10055084 235
304 3300002987 JGI25159J45721_1000289 JGI25159J45721_100028927 235
305 3300002987 JGI25159J45721_1001613 JGI25159J45721_10016134 235
306 3300003187 JGI25151J46595_10000506 JGI25151J46595_1000050615 235
307 3300003215 JGI25153J46596_10005211 JGI25153J46596_100052117 235
308 3300003215 JGI25153J46596_10005668 JGI25153J46596_100056684 235
309 3300003316 rootH1_10068274 rootH1_100682744 235
310 3300003320 rootH2_10042848 rootH2_100428482 235
311 3300003323 rootH1_10157081 rootH1_101570812 235
312 3300003354 JGI25160J50197_1000004 JGI25160J50197_1000004389 235
313 3300003354 JGI25160J50197_1002391 JGI25160J50197_10023917 235
314 3300003354 JGI25160J50197_1004081 JGI25160J50197_10040816 235
315 3300003354 JGI25160J50197_1011479 JGI25160J50197_10114794 235
316 3300003374 JGI25161J50226_1000003 JGI25161J50226_100000340 235
317 3300003374 JGI25161J50226_1000126 JGI25161J50226_100012612 235
318 3300003374 JGI25161J50226_1000372 JGI25161J50226_100037213 235
319 3300003374 JGI25161J50226_1005931 JGI25161J50226_10059311 235
320 3300003771 Ga0055526_1000377 Ga0055526_100037715 235
321 3300003771 Ga0055526_1001577 Ga0055526_100157710 235
322 3300003771 Ga0055526_1004949 Ga0055526_10049498 235
323 3300003771 Ga0055526_1009362 Ga0055526_10093625 235
324 3300003771 Ga0055526_1014689 Ga0055526_10146892 235
325 3300003775 Ga0055524_1003719 Ga0055524_10037194 235
326 3300003775 Ga0055524_1004405 Ga0055524_10044052 235
327 3300003775 Ga0055524_1004442 Ga0055524_10044424 235
328 3300003775 Ga0055524_1009384 Ga0055524_10093842 235
329 3300003781 Ga0055536_1006211 Ga0055536_10062112 235
330 3300003790 Ga0055528_1000067 Ga0055528_100006742 235
331 3300003790 Ga0055528_1000890 Ga0055528_10008909 235
332 3300003790 Ga0055528_1001085 Ga0055528_100108517 235
333 3300003790 Ga0055528_1011409 Ga0055528_10114092 235
334 3300003790 Ga0055528_1014375 Ga0055528_10143753 235
335 3300003791 Ga0055530_10030293 Ga0055530_100302931 235
336 3300003792 Ga0055540_1000613 Ga0055540_100061313 235
337 3300003792 Ga0055540_1001575 Ga0055540_10015754 235
338 3300003792 Ga0055540_1004063 Ga0055540_10040634 235
339 3300003792 Ga0055540_1015524 Ga0055540_10155241 235
340 3300003794 Ga0055531_10004951 Ga0055531_100049512 235
341 3300004625 Ga0055543_1000001 Ga0055543_100000147 235
342 3300004625 Ga0055543_1000156 Ga0055543_100015659 235
343 3300004625 Ga0055543_1000622 Ga0055543_100062215 235
344 3300004625 Ga0055543_1007345 Ga0055543_10073452 235
345 3300005262 Ga0065165_1000675 Ga0065165_100067540 235
346 3300005262 Ga0065165_1000736 Ga0065165_10007362 235
347 3300005262 Ga0065165_1032052 Ga0065165_10320521 235
348 3300005337 Ga0070682_100302494 Ga0070682_1003024942 235
349 3300005355 Ga0070671_100024430 Ga0070671_1000244303 235
350 3300005455 Ga0070663_100217892 Ga0070663_1002178922 235
351 3300005530 Ga0070679_100437166 Ga0070679_1004371662 235
352 3300005548 Ga0070665_100400681 Ga0070665_1004006812 235
353 3300005983 Ga0081540_1052772 Ga0081540_10527722 235
354 3300005983 Ga0081540_1090622 Ga0081540_10906222 235
355 3300006038 Ga0075365_10003061 Ga0075365_100030612 235
356 3300006038 Ga0075365_10027593 Ga0075365_100275932 235
357 3300006048 Ga0075363_100151443 Ga0075363_1001514432 235
358 3300006177 Ga0075362_10074826 Ga0075362_100748261 235
359 3300006178 Ga0075367_10001548 Ga0075367_100015483 235
360 3300006186 Ga0075369_10028673 Ga0075369_100286733 235
361 3300006353 Ga0075370_10381938 Ga0075370_103819381 235
362 3300006847 Ga0075431_100080500 Ga0075431_1000805003 235
363 3300006852 Ga0075433_10008069 Ga0075433_100080695 235
364 3300006871 Ga0075434_100002979 Ga0075434_10000297912 235
365 3300007076 Ga0075435_100001787 Ga0075435_10000178717 235
366 3300009092 Ga0105250_10006700 Ga0105250_100067004 235
367 3300009094 Ga0111539_10035256 Ga0111539_100352563 235
368 3300009147 Ga0114129_10007097 Ga0114129_100070978 235
369 3300009147 Ga0114129_10042922 Ga0114129_100429226 235
370 3300009147 Ga0114129_10130812 Ga0114129_101308123 235
371 3300009148 Ga0105243_10279568 Ga0105243_102795682 235
372 3300009176 Ga0105242_10205025 Ga0105242_102050252 235
373 3300009177 Ga0105248_10019813 Ga0105248_100198132 235
374 3300009553 Ga0105249_10201227 Ga0105249_102012272 235
375 3300009765 Ga0123341_1000001 Ga0123341_1000001321 235
376 3300009766 Ga0123342_1014705 Ga0123342_10147053 235
377 3300010159 Ga0099796_10022005 Ga0099796_100220052 235
378 3300010159 Ga0099796_10038215 Ga0099796_100382152 235
379 3300013296 Ga0157374_10194314 Ga0157374_101943142 235
380 3300014969 Ga0157376_10192925 Ga0157376_101929251 235
381 3300025208 Ga0209436_100361 Ga0209436_10036113 235
382 3300025245 Ga0207425_1008731 Ga0207425_10087312 235
383 3300025245 Ga0207425_1009115 Ga0207425_10091152 235
384 3300025245 Ga0207425_1013189 Ga0207425_10131892 235
385 3300025258 Ga0209129_1001535 Ga0209129_100153514 235
386 3300025258 Ga0209129_1002325 Ga0209129_100232512 235
387 3300025258 Ga0209129_1003783 Ga0209129_10037836 235
388 3300025258 Ga0209129_1012809 Ga0209129_10128092 235
389 3300025261 Ga0209233_1013804 Ga0209233_10138042 235
390 3300025273 Ga0209673_1000068 Ga0209673_100006818 235
391 3300025273 Ga0209673_1000310 Ga0209673_100031055 235
392 3300025273 Ga0209673_1000348 Ga0209673_100034811 235
393 3300025273 Ga0209673_1002113 Ga0209673_10021132 235
394 3300025273 Ga0209673_1006019 Ga0209673_10060192 235
395 3300025273 Ga0209673_1008798 Ga0209673_10087985 235
396 3300025284 Ga0209130_1000006 Ga0209130_1000006231 235
397 3300025284 Ga0209130_1000012 Ga0209130_1000012381 235
398 3300025292 Ga0209676_1011024 Ga0209676_10110242 235
399 3300025294 Ga0209025_1000097 Ga0209025_1000097224 235
400 3300025294 Ga0209025_1004704 Ga0209025_10047044 235
401 3300025294 Ga0209025_1008093 Ga0209025_10080936 235
402 3300025294 Ga0209025_1023600 Ga0209025_10236003 235
403 3300025295 Ga0209564_1000137 Ga0209564_100013746 235
404 3300025295 Ga0209564_1000739 Ga0209564_100073914 235
405 3300025295 Ga0209564_1000966 Ga0209564_100096628 235
406 3300025295 Ga0209564_1004497 Ga0209564_10044979 235
407 3300025295 Ga0209564_1009101 Ga0209564_10091015 235
408 3300025297 Ga0209758_1000714 Ga0209758_100071415 235
409 3300025297 Ga0209758_1001743 Ga0209758_10017433 235
410 3300025297 Ga0209758_1002296 Ga0209758_100229619 235
411 3300025297 Ga0209758_1008924 Ga0209758_10089246 235
412 3300025297 Ga0209758_1008929 Ga0209758_10089296 235
413 3300025298 Ga0209050_1001715 Ga0209050_10017153 235
414 3300025299 Ga0209256_1000397 Ga0209256_100039727 235
415 3300025299 Ga0209256_1001022 Ga0209256_100102219 235
416 3300025299 Ga0209256_1005212 Ga0209256_10052129 235
417 3300025299 Ga0209256_1006066 Ga0209256_10060662 235
418 3300025302 Ga0207426_1000003 Ga0207426_10000031092 235
419 3300025302 Ga0207426_1000010 Ga0207426_1000010740 235
420 3300025302 Ga0207426_1000094 Ga0207426_1000094221 235
421 3300025302 Ga0207426_1003738 Ga0207426_10037382 235
422 3300025303 Ga0209051_1000201 Ga0209051_100020197 235
423 3300025303 Ga0209051_1001312 Ga0209051_10013125 235
424 3300025303 Ga0209051_1019336 Ga0209051_10193361 235
425 3300025304 Ga0209257_1001768 Ga0209257_100176815 235
426 3300025304 Ga0209257_1002387 Ga0209257_100238711 235
427 3300025304 Ga0209257_1014345 Ga0209257_10143453 235
428 3300025900 Ga0207710_10018041 Ga0207710_100180413 235
429 3300025912 Ga0207707_10015378 Ga0207707_100153787 235
430 3300025921 Ga0207652_10511802 Ga0207652_105118022 235
431 3300025931 Ga0207644_10088264 Ga0207644_100882642 235
432 3300025941 Ga0207711_10372648 Ga0207711_103726482 235
433 3300025961 Ga0207712_10237192 Ga0207712_102371922 235
434 3300026095 Ga0207676_10399010 Ga0207676_103990102 235
435 3300027671 Ga0209588_1012102 Ga0209588_10121021 235
436 3300028794 Ga0307515_10056344 Ga0307515_100563445 235
437 3300031456 Ga0307513_10047444 Ga0307513_100474442 235
438 3300041404 Ga0439436_0027971 Ga0439436_0027971_748_1524 235
439 3300041413 Ga0439465_0009331 Ga0439465_0009331_1637_2413 235
440 3300041413 Ga0439465_0010918 Ga0439465_0010918_65_841 235
441 3300041441 Ga0451787_130413 Ga0451787_130413_227_1003 235
442 3300041451 Ga0451791_0954775 Ga0451791_0954775_96_872 235
443 3300041491 Ga0451833_0887560 Ga0451833_0887560_1084_1860 235
444 3300041494 Ga0451837_0082266 Ga0451837_0082266_518_1294 235
445 3300041496 Ga0451839_0865257 Ga0451839_0865257_51_827 235
446 3300041498 Ga0451841_0194129 Ga0451841_0194129_2349_3125 235
447 3300041498 Ga0451841_1431128 Ga0451841_1431128_119_895 235
448 3300041501 Ga0451845_0835782 Ga0451845_0835782_88_864 235
449 3300041511 Ga0451855_0695010 Ga0451855_0695010_46_822 235
450 3300041512 Ga0451853_0201273 Ga0451853_0201273_1390_2166 235
451 3300041997 Ga0439431_0062065 Ga0439431_0062065_134_910 235
452 3300042007 Ga0439449_0044246 Ga0439449_0044246_490_1266 235
453 3300046452 Ga0495617_077242 Ga0495617_077242_251_1027 235
454 3300046472 Ga0495580_0096682 Ga0495580_0096682_847_1632 235
455 3300046474 Ga0495605_0057614 Ga0495605_0057614_382_1158 235
456 3300046501 Ga0495607_0015234 Ga0495607_0015234_3382_4158 235
457 3300046506 Ga0495583_0081999 Ga0495583_0081999_224_1000 235
458 3300046507 Ga0495606_0104088 Ga0495606_0104088_688_1464 235
459 3300046512 Ga0495610_0126618 Ga0495610_0126618_93_869 235
460 3300046518 Ga0495631_0117928 Ga0495631_0117928_114_890 235
461 3300046522 Ga0495643_0018882 Ga0495643_0018882_1706_2482 235
462 3300046522 Ga0495643_0060918 Ga0495643_0060918_204_980 235
463 3300046524 Ga0495648_0019577 Ga0495648_0019577_3501_4277 235
464 3300046538 Ga0495609_0106492 Ga0495609_0106492_305_1081 235
465 3300046558 Ga0495633_0012390 Ga0495633_0012390_294_1070 235
466 3300046615 Ga0495656_0178282 Ga0495656_0178282_73_849 235
467 3300046616 Ga0495668_0125480 Ga0495668_0125480_554_1330 235
468 3300046616 Ga0495668_0232370 Ga0495668_0232370_55_831 235
469 3300046660 Ga0495625_0101280 Ga0495625_0101280_272_1048 235
470 3300046665 Ga0495661_0219701 Ga0495661_0219701_189_965 235
471 3300046691 Ga0495670_0006868 Ga0495670_0006868_555_1331 235
472 3300046810 Ga0495660_0222312 Ga0495660_0222312_42_818 235
473 3300047323 Ga0495683_0088637 Ga0495683_0088637_318_1094 235
474 3300047446 Ga0495679_081363 Ga0495679_081363_88_864 235
475 3300047470 Ga0495681_0081969 Ga0495681_0081969_144_920 235
476 3300048090 Ga0495615_0061768 Ga0495615_0061768_69_845 235
477 3300048907 Ga0496104_0018320 Ga0496104_0018320_2198_2974 235
478 3300048909 Ga0496106_0000046 Ga0496106_0000046_3510_4286 235
479 3300048909 Ga0496106_0003765 Ga0496106_0003765_6340_7119 235
480 3300048919 Ga0496116_0064870 Ga0496116_0064870_557_1339 235
481 3300048919 Ga0496116_0109687 Ga0496116_0109687_223_999 235
482 3300048919 Ga0496116_0109742 Ga0496116_0109742_589_1365 235
483 3300048923 Ga0496120_0158774 Ga0496120_0158774_259_1035 235
484 3300048924 Ga0496121_0000102 Ga0496121_0000102_18482_19261 235
485 3300048924 Ga0496121_0048567 Ga0496121_0048567_415_1191 235
486 3300048924 Ga0496121_0097355 Ga0496121_0097355_464_1240 235
487 3300048924 Ga0496121_0129475 Ga0496121_0129475_925_1701 235
488 3300048925 Ga0496122_0058147 Ga0496122_0058147_720_1496 235
489 3300048926 Ga0496123_0056860 Ga0496123_0056860_570_1346 235
490 3300048927 Ga0496124_0028556 Ga0496124_0028556_2177_2953 235
491 3300048928 Ga0496125_0024433 Ga0496125_0024433_2098_2874 235
492 3300048928 Ga0496125_0042310 Ga0496125_0042310_1063_1839 235
493 3300048929 Ga0496126_0000679 Ga0496126_0000679_1015_1845 235
494 3300048929 Ga0496126_0177483 Ga0496126_0177483_783_1562 235
495 3300049568 Ga0501031_0195385 Ga0501031_0195385_519_1295 235
496 3300049569 Ga0501032_0108557 Ga0501032_0108557_883_1659 235
497 3300049570 Ga0501033_0163087 Ga0501033_0163087_103_879 235
498 3300049572 Ga0501036_0208314 Ga0501036_0208314_771_1547 235
499 3300049573 Ga0501037_0125484 Ga0501037_0125484_725_1501 235
500 3300049579 Ga0501043_0235261 Ga0501043_0235261_329_1105 235
501 3300049579 Ga0501043_0288326 Ga0501043_0288326_365_1141 235
502 3300049580 Ga0501046_0046111 Ga0501046_0046111_1401_2177 235
503 3300049580 Ga0501046_0433852 Ga0501046_0433852_85_861 235
504 3300049584 Ga0501068_0214366 Ga0501068_0214366_291_1067 235
505 3300049584 Ga0501068_0227315 Ga0501068_0227315_275_1051 235
506 3300049589 Ga0501073_0192190 Ga0501073_0192190_571_1347 235
507 3300049744 Ga0501083_0169923 Ga0501083_0169923_609_1385 235
508 3300049744 Ga0501083_0270297 Ga0501083_0270297_100_954 235
509 3300049823 Ga0501044_0283823 Ga0501044_0283823_522_1298 235
510 3300050489 nmdc:mga03683_45363_c1 nmdc:mga03683_45363_c1_718_1494 235
511 3300050492 nmdc:mga0yw44_19063_c1 nmdc:mga0yw44_19063_c1_767_1543 235
512 3300050493 nmdc:mga0k408_83818_c1 nmdc:mga0k408_83818_c1_656_1432 235
513 3300050507 nmdc:mga05p37_139945_c1 nmdc:mga05p37_139945_c1_846_1631 235
514 3300050507 nmdc:mga05p37_91640_c1 nmdc:mga05p37_91640_c1_1603_2388 235
515 3300050508 nmdc:mga09592_1232_c1 nmdc:mga09592_1232_c1_11279_12064 235
516 3300050508 nmdc:mga09592_296169_c1 nmdc:mga09592_296169_c1_582_1367 235
517 3300050511 nmdc:mga08y16_111226_c1 nmdc:mga08y16_111226_c1_1953_2738 235
518 3300050512 nmdc:mga0n895_12421_c1 nmdc:mga0n895_12421_c1_6549_7334 235
519 3300050513 nmdc:mga0rr50_22977_c1 nmdc:mga0rr50_22977_c1_329_1114 235
520 3300050515 nmdc:mga0a205_2900_c1 nmdc:mga0a205_2900_c1_3919_4704 235
521 3300053088 Ga0500644_0101721 Ga0500644_0101721_264_1040 235
522 3300053125 Ga0500618_007052 Ga0500618_007052_1429_2217 235
523 3300053134 Ga0500658_0028157 Ga0500658_0028157_226_1050 235
524 3300053139 Ga0500568_0000106 Ga0500568_0000106_76005_76829 235
525 3300053151 Ga0500604_0012235 Ga0500604_0012235_972_1796 235
526 3300053156 Ga0500622_0001154 Ga0500622_0001154_16374_17150 235
527 3300053156 Ga0500622_0048121 Ga0500622_0048121_862_1638 235
528 3300054114 Ga0501084_0113202 Ga0501084_0113202_969_1745 235
529 3300060353 Ga0501082_0229112 Ga0501082_0229112_118_894 235
530 3300060353 Ga0501082_0233660 Ga0501082_0233660_724_1500 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

44

231

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

50

283

0.94

PF08659

KR

KR domain

44

215

0.89

PF23441

38

285

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9853 2 224
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9852 2 224
4bmn-assembly1.cif.gz_C apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9844 2 224
6ihh-assembly1.cif.gz_A crystal structure of rasadh f12 from ralstonia.sp in complex with nadph and a6o 0.9831 2 224
4i5g-assembly1.cif.gz_C crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s, a86n, s88a 0.9824 2 224
ID Description Score Start End Superfamily
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.981 2 224 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9652 3 223 3.40.50.720
af_Q54PL1_17_278_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9636 2 223 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9629 3 223 3.40.50.720
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 3 224 3.40.50.720
ID Description Score Start End GO Terms
AF-K0VUL8-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9888 1 183 GO:0016491
AF-A0A7Y6JY91-F1-model_v4 SDR family oxidoreductase 0.9875 1 233 GO:0016491
AF-A0A239IFX9-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9862 1 233 GO:0016491
AF-A0A5R9A4V7-F1-model_v4 SDR family oxidoreductase 0.9852 3 224 GO:0016491
AF-A0A537JGP5-F1-model_v4 SDR family oxidoreductase 0.9847 2 224 GO:0016491

Feature Viewer

pLDDT pTM Quality
96 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map