F459928

General Info

Members Datasets Scaffolds Average Seq Length
530 339 524 255

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10003113|Ga0075365_100031136
Length 291
Sequence MFHDCHAAGRLAALTPHFVALGDMLTYAFLEDGMTKMAAEIRIFPCLNDNYGYLIHDPATKATASIDAPEAAPVIKALEKEGWKLTDILVTHHHGDHVGGVAELKQKYNCRVIAPHDKAKAIADVDQRVKEGDTVKVGSLAARVLETPGHTLDHISYMFDGDKALFAADTLFSIGCGRVFEGNYPMMWDSLLKLRALPDDTRVYCGHEYTAANVKFALTIEPENAALKARAEEVAKQRAANQPTIPTLLGEEKKANVFLRADVPQVAANVGMSGKGAADVFGEIRERKNRS

Samples

Sample ID Description Type Environment
1 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
2 2643221651 Afipia sp. Root123D2 Isolate Unclassified
3 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
4 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
5 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
292 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
317 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
320 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
321 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
322 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
323 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
324 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
325 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
326 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
327 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
328 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
329 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
330 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
331 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
332 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
333 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
334 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0.38
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.7
Nodule 0
Rhizoplane 1.13
Rhizosphere 81.51
Stem 0
Stem Tuber 0
Unclassified 5.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1033275 3300005262 Bacteria 1606
2 Ga0070658_10075940 3300005327 Bacteria 2756
3 Ga0070658_10360364 3300005327 Bacteria 1245
4 Ga0070676_10022589 3300005328 Bacteria 3528
5 Ga0070683_100020669 3300005329 Bacteria 5861
6 Ga0070690_100312144 3300005330 Bacteria 1130
7 Ga0070670_100284165 3300005331 Bacteria 1445
8 Ga0070677_10002261 3300005333 Bacteria 6140
9 Ga0068869_100706912 3300005334 Bacteria 860
10 Ga0070666_10248860 3300005335 Bacteria 1258
11 Ga0068868_100155670 3300005338 Bacteria 1885
12 Ga0070661_100218783 3300005344 Bacteria 1460
13 Ga0070669_100216329 3300005353 Bacteria 1513
14 Ga0070675_100258455 3300005354 Bacteria 1525
15 Ga0070675_100546229 3300005354 Unclassified 1047
16 Ga0070674_100021623 3300005356 Bacteria 4135
17 Ga0070673_100017637 3300005364 Bacteria 5082
18 Ga0070667_100062304 3300005367 Bacteria 3159
19 Ga0070667_100087427 3300005367 Bacteria 2675
20 Ga0070709_10003001 3300005434 Bacteria 9085
21 Ga0070709_10004073 3300005434 Bacteria 7888
22 Ga0070713_100000768 3300005436 Bacteria 20535
23 Ga0070713_100050097 3300005436 Bacteria 3448
24 Ga0070710_10000783 3300005437 Bacteria 15215
25 Ga0070710_10011138 3300005437 Bacteria 4436
26 Ga0070711_100014561 3300005439 Bacteria 4955
27 Ga0070711_100472494 3300005439 Bacteria 1029
28 Ga0070694_100472071 3300005444 Bacteria 994
29 Ga0070663_100544819 3300005455 Bacteria 969
30 Ga0070678_100015675 3300005456 Bacteria 4824
31 Ga0070681_10052200 3300005458 Bacteria 4078
32 Ga0070681_10099564 3300005458 Bacteria 2852
33 Ga0070681_10341409 3300005458 Bacteria 1407
34 Ga0070679_100029863 3300005530 Bacteria 5379
35 Ga0070679_100112332 3300005530 Bacteria 2710
36 Ga0070684_100010288 3300005535 Bacteria 7406
37 Ga0070684_100018435 3300005535 Bacteria 5750
38 Ga0068853_100213968 3300005539 Bacteria 1758
39 Ga0070672_100314516 3300005543 Bacteria 1330
40 Ga0070686_100088863 3300005544 Bacteria 2063
41 Ga0070695_100003309 3300005545 Bacteria 9420
42 Ga0070693_100047172 3300005547 Bacteria 2450
43 Ga0070665_100214894 3300005548 Bacteria 1924
44 Ga0070665_100314562 3300005548 Bacteria 1570
45 Ga0068855_100140528 3300005563 Bacteria 2753
46 Ga0068855_101067411 3300005563 Bacteria 846
47 Ga0068852_101091218 3300005616 Unclassified 818
48 Ga0068864_100196374 3300005618 Bacteria 1852
49 Ga0068861_100019252 3300005719 Bacteria 4877
50 Ga0068860_100135759 3300005843 Bacteria 2362
51 Ga0068862_100125823 3300005844 Bacteria 2263
52 Ga0068862_100367396 3300005844 Bacteria 1338
53 Ga0068862_100675343 3300005844 Bacteria 999
54 Ga0081455_10117951 3300005937 Bacteria 2096
55 Ga0081539_10000522 3300005985 Bacteria 79973
56 Ga0081539_10048337 3300005985 Bacteria 2420
57 Ga0070717_10075333 3300006028 Bacteria 2822
58 Ga0075365_10003113 3300006038 Bacteria 8439
59 Ga0075365_10186131 3300006038 Bacteria 1452
60 Ga0075368_10039067 3300006042 Bacteria 1859
61 Ga0075363_100006649 3300006048 Bacteria 5269
62 Ga0075364_10027819 3300006051 Bacteria 3615
63 Ga0075364_10028155 3300006051 Bacteria 3596
64 Ga0070715_10000865 3300006163 Bacteria 8356
65 Ga0070716_100001482 3300006173 Bacteria 10479
66 Ga0070716_100053489 3300006173 Bacteria 2302
67 Ga0070712_100217066 3300006175 Bacteria 1512
68 Ga0075362_10010464 3300006177 Bacteria 3622
69 Ga0075362_10013395 3300006177 Bacteria 3284
70 Ga0075367_10005803 3300006178 Bacteria 6177
71 Ga0075367_10039032 3300006178 Bacteria 2767
72 Ga0075367_10144434 3300006178 Bacteria 1475
73 Ga0075366_10033238 3300006195 Bacteria 3038
74 Ga0075366_10214704 3300006195 Bacteria 1171
75 Ga0075370_10006281 3300006353 Bacteria 5966
76 Ga0075370_10019630 3300006353 Bacteria 3683
77 Ga0068871_100057891 3300006358 Bacteria 3154
78 Ga0068871_100330713 3300006358 Unclassified 1344
79 Ga0075428_100002387 3300006844 Bacteria 20393
80 Ga0075428_100299541 3300006844 Bacteria 1729
81 Ga0075430_100023729 3300006846 Bacteria 5224
82 Ga0075431_100000881 3300006847 Bacteria 26399
83 Ga0075431_100391755 3300006847 Unclassified 1391
84 Ga0075433_10345521 3300006852 Bacteria 1315
85 Ga0075434_100005953 3300006871 Bacteria 11160
86 Ga0075434_100820864 3300006871 Bacteria 946
87 Ga0068865_100187046 3300006881 Bacteria 1599
88 Ga0075436_100217875 3300006914 Bacteria 1354
89 Ga0099794_10012605 3300007265 Bacteria 3654
90 Ga0099794_10015075 3300007265 Bacteria 3404
91 Ga0099794_10017446 3300007265 Bacteria 3200
92 Ga0099795_10006176 3300007788 Bacteria 3249
93 Ga0105250_10063529 3300009092 Bacteria 1486
94 Ga0111539_10000144 3300009094 Bacteria 81842
95 Ga0111539_10253827 3300009094 Bacteria 2048
96 Ga0111539_10518624 3300009094 Unclassified 1388
97 Ga0105245_10007083 3300009098 Bacteria 9838
98 Ga0105247_10368322 3300009101 Unclassified 1015
99 Ga0114129_10000542 3300009147 Bacteria 46285
100 Ga0105241_10260035 3300009174 Bacteria 1475
101 Ga0105242_10013985 3300009176 Bacteria 6209
102 Ga0105242_10433484 3300009176 Bacteria 1235
103 Ga0105248_10158178 3300009177 Bacteria 2557
104 Ga0105237_10219030 3300009545 Bacteria 1904
105 Ga0105238_10010498 3300009551 Bacteria 9296
106 Ga0105238_10082580 3300009551 Bacteria 3203
107 Ga0105238_10105024 3300009551 Bacteria 2806
108 Ga0105238_10125835 3300009551 Bacteria 2541
109 Ga0105238_10182831 3300009551 Bacteria 2073
110 Ga0105238_10389472 3300009551 Bacteria 1386
111 Ga0099796_10015537 3300010159 Bacteria 2227
112 Ga0099796_10020826 3300010159 Bacteria 2010
113 Ga0105239_10587026 3300010375 Bacteria 1270
114 Ga0157373_10041341 3300013100 Bacteria 3298
115 Ga0157371_10300657 3300013102 Bacteria 1162
116 Ga0157370_10075072 3300013104 Bacteria 3188
117 Ga0157370_10244627 3300013104 Bacteria 1660
118 Ga0157369_10111758 3300013105 Bacteria 2904
119 Ga0157369_10206877 3300013105 Bacteria 2058
120 Ga0157369_10354799 3300013105 Bacteria 1523
121 Ga0157378_10109266 3300013297 Bacteria 2533
122 Ga0163162_10589735 3300013306 Bacteria 1238
123 Ga0157375_10095149 3300013308 Bacteria 3049
124 Ga0157380_10029987 3300014326 Bacteria 4162
125 Ga0157380_10333297 3300014326 Bacteria 1412
126 Ga0157379_10536620 3300014968 Bacteria 1087
127 Ga0157376_10104898 3300014969 Bacteria 2478
128 Ga0157376_10979362 3300014969 Bacteria 867
129 Ga0163161_10134008 3300017792 Bacteria 1871
130 Ga0213876_10008883 3300021384 Bacteria 5419
131 Ga0224712_10014402 3300022467 Bacteria 2545
132 Ga0209564_1000602 3300025295 Bacteria 56176
133 Ga0209564_1008246 3300025295 Bacteria 5188
134 Ga0207696_1020893 3300025711 Bacteria 2103
135 Ga0207682_10001508 3300025893 Bacteria 10728
136 Ga0207692_10001515 3300025898 Bacteria 8727
137 Ga0207692_10006519 3300025898 Bacteria 4737
138 Ga0207710_10249163 3300025900 Unclassified 888
139 Ga0207688_10024392 3300025901 Bacteria 3316
140 Ga0207680_10459582 3300025903 Unclassified 904
141 Ga0207647_10033231 3300025904 Bacteria 3304
142 Ga0207647_10085984 3300025904 Bacteria 1880
143 Ga0207685_10007721 3300025905 Bacteria 3017
144 Ga0207699_10000360 3300025906 Bacteria 24053
145 Ga0207699_10010387 3300025906 Bacteria 4671
146 Ga0207645_10018494 3300025907 Bacteria 4584
147 Ga0207643_10047442 3300025908 Bacteria 2431
148 Ga0207705_10271759 3300025909 Bacteria 1296
149 Ga0207707_10030771 3300025912 Bacteria 4695
150 Ga0207707_10095860 3300025912 Bacteria 2593
151 Ga0207707_10097794 3300025912 Bacteria 2566
152 Ga0207693_10000073 3300025915 Bacteria 89380
153 Ga0207693_10015453 3300025915 Bacteria 6123
154 Ga0207693_10211290 3300025915 Bacteria 1525
155 Ga0207663_10000993 3300025916 Bacteria 12980
156 Ga0207663_10012680 3300025916 Bacteria 4563
157 Ga0207663_10159541 3300025916 Bacteria 1590
158 Ga0207660_10259223 3300025917 Bacteria 1374
159 Ga0207662_10035450 3300025918 Bacteria 2914
160 Ga0207657_10006265 3300025919 Bacteria 12367
161 Ga0207649_10152946 3300025920 Bacteria 1591
162 Ga0207652_10186134 3300025921 Bacteria 1867
163 Ga0207681_10047285 3300025923 Bacteria 2898
164 Ga0207681_10150575 3300025923 Bacteria 1743
165 Ga0207694_10022049 3300025924 Bacteria 4830
166 Ga0207694_10084471 3300025924 Bacteria 2497
167 Ga0207694_10099125 3300025924 Bacteria 2308
168 Ga0207694_10587286 3300025924 Bacteria 936
169 Ga0207650_10512369 3300025925 Bacteria 1003
170 Ga0207659_10188062 3300025926 Bacteria 1641
171 Ga0207687_10021525 3300025927 Bacteria 4285
172 Ga0207687_10119203 3300025927 Bacteria 1971
173 Ga0207700_10027298 3300025928 Bacteria 3996
174 Ga0207700_10069970 3300025928 Bacteria 2696
175 Ga0207664_10005740 3300025929 Bacteria 8491
176 Ga0207664_10009377 3300025929 Bacteria 6866
177 Ga0207664_10148940 3300025929 Bacteria 1987
178 Ga0207664_10252593 3300025929 Bacteria 1539
179 Ga0207644_10064574 3300025931 Bacteria 2660
180 Ga0207690_10449047 3300025932 Bacteria 1036
181 Ga0207706_10050316 3300025933 Bacteria 3682
182 Ga0207706_10135615 3300025933 Bacteria 2165
183 Ga0207709_10336730 3300025935 Bacteria 1134
184 Ga0207669_10024599 3300025937 Bacteria 3239
185 Ga0207704_10106925 3300025938 Bacteria 1881
186 Ga0207665_10000316 3300025939 Bacteria 33366
187 Ga0207665_10087039 3300025939 Bacteria 2159
188 Ga0207691_10016907 3300025940 Bacteria 6921
189 Ga0207711_10355527 3300025941 Bacteria 1357
190 Ga0207689_10163465 3300025942 Bacteria 1834
191 Ga0207661_10045556 3300025944 Bacteria 3472
192 Ga0207679_10049052 3300025945 Bacteria 3078
193 Ga0207667_10204481 3300025949 Bacteria 2025
194 Ga0207667_10765477 3300025949 Bacteria 964
195 Ga0207658_10101350 3300025986 Bacteria 2256
196 Ga0207658_10171871 3300025986 Bacteria 1786
197 Ga0207658_10506975 3300025986 Bacteria 1075
198 Ga0207677_10526178 3300026023 Bacteria 1026
199 Ga0207639_10198293 3300026041 Bacteria 1720
200 Ga0207678_10070849 3300026067 Bacteria 2989
201 Ga0207708_10202282 3300026075 Bacteria 1585
202 Ga0207708_10314941 3300026075 Unclassified 1276
203 Ga0207648_10208975 3300026089 Bacteria 1732
204 Ga0207676_10167633 3300026095 Bacteria 1910
205 Ga0207676_10421070 3300026095 Bacteria 1252
206 Ga0207674_10141706 3300026116 Bacteria 2363
207 Ga0207674_10159098 3300026116 Bacteria 2213
208 Ga0207675_100053662 3300026118 Bacteria 3761
209 Ga0207675_100367134 3300026118 Bacteria 1413
210 Ga0207683_10014358 3300026121 Bacteria 6747
211 Ga0209179_1001650 3300027512 Bacteria 2812
212 Ga0209179_1002729 3300027512 Bacteria 2435
213 Ga0207428_10013852 3300027907 Bacteria 7025
214 Ga0207428_10192868 3300027907 Bacteria 1535
215 Ga0265354_1002438 3300028016 Bacteria 2298
216 Ga0268266_10398071 3300028379 Bacteria 1302
217 Ga0268266_10758239 3300028379 Bacteria 937
218 Ga0307515_10131554 3300028794 Bacteria 2752
219 Ga0265770_1000659 3300030878 Bacteria 4800
220 Ga0265330_10051225 3300031235 Bacteria 1810
221 Ga0265340_10173155 3300031247 Bacteria 977
222 Ga0265339_10002564 3300031249 Bacteria 12958
223 Ga0265339_10045967 3300031249 Bacteria 2401
224 Ga0265316_10143685 3300031344 Bacteria 1791
225 Ga0265316_10185828 3300031344 Bacteria 1546
226 Ga0307408_100229136 3300031548 Bacteria 1520
227 Ga0307408_100230098 3300031548 Bacteria 1518
228 Ga0307516_10000012 3300031730 Bacteria 224120
229 Ga0373958_0018676 3300034819 Bacteria 1260
230 Ga0373928_0057160 3300035084 Bacteria 935
231 Ga0373934_0022274 3300035086 Bacteria 2444
232 Ga0373934_0145869 3300035086 Bacteria 968
233 Ga0373940_0036666 3300035088 Bacteria 1332
234 Ga0373944_0001048 3300035089 Bacteria 6825
235 Ga0373923_0090388 3300035111 Bacteria 1339
236 Ga0373923_0132978 3300035111 Bacteria 1119
237 Ga0373936_0026976 3300035113 Bacteria 2252
238 Ga0373936_0119287 3300035113 Bacteria 1125
239 Ga0373941_0006278 3300035115 Bacteria 2854
240 Ga0373945_0009707 3300035116 Bacteria 3157
241 Ga0373953_0146930 3300035117 Bacteria 1010
242 Ga0373954_0002232 3300035118 Bacteria 8051
243 Ga0373954_0004821 3300035118 Bacteria 5815
244 Ga0373956_0008976 3300035119 Bacteria 4054
245 Ga0373956_0065477 3300035119 Bacteria 1651
246 Ga0373956_0146663 3300035119 Bacteria 1109
247 Ga0373957_0033723 3300035120 Bacteria 1892
248 Ga0373943_0015761 3300035170 Bacteria 3437
249 Ga0373946_0001892 3300035171 Bacteria 7302
250 Ga0373946_0002159 3300035171 Bacteria 6904
251 Ga0373955_0009700 3300035172 Bacteria 4521
252 Ga0373955_0039994 3300035172 Bacteria 2506
253 Ga0373955_0062323 3300035172 Bacteria 2062
254 Ga0373955_0079459 3300035172 Bacteria 1850
255 Ga0373924_0009556 3300035410 Bacteria 3557
256 Ga0373924_0112709 3300035410 Bacteria 1176
257 Ga0373924_0210233 3300035410 Bacteria 859
258 Ga0373931_0002980 3300035691 Bacteria 7564
259 Ga0373935_0000434 3300035692 Bacteria 21781
260 Ga0373935_0191260 3300035692 Bacteria 1410
261 Ga0373927_0000645 3300035695 Bacteria 26401
262 Ga0373933_0002533 3300035724 Bacteria 10248
263 Ga0373933_0014674 3300035724 Bacteria 4362
264 Ga0373933_0046084 3300035724 Bacteria 2588
265 Ga0373947_0002079 3300035725 Bacteria 12221
266 Ga0373947_0025229 3300035725 Bacteria 3466
267 Ga0373947_0122293 3300035725 Bacteria 1654
268 Ga0373947_0412320 3300035725 Bacteria 912
269 Ga0373937_0013989 3300036401 Bacteria 7075
270 Ga0373937_0280473 3300036401 Bacteria 1573
271 Ga0373937_1078782 3300036401 Bacteria 752
272 Ga0373925_0006318 3300037068 Bacteria 8730
273 Ga0373925_0010149 3300037068 Bacteria 6837
274 Ga0373925_0108432 3300037068 Bacteria 2143
275 Ga0395899_0056987 3300037312 Bacteria 2886
276 Ga0395900_0201339 3300037418 Bacteria 2014
277 Ga0395901_0025191 3300038443 Bacteria 6107
278 Ga0436365_0471606 3300039437 Bacteria 1971
279 Ga0436365_0478771 3300039437 Bacteria 794
280 Ga0436365_0861583 3300039437 Bacteria 3390
281 Ga0436365_1639838 3300039437 Bacteria 14264
282 Ga0436365_1832441 3300039437 Bacteria 2732
283 Ga0436363_0283753 3300039450 Bacteria 1773
284 Ga0436362_0167044 3300039453 Bacteria 1594
285 Ga0439431_0067125 3300041997 Bacteria 951
286 Ga0439441_037950 3300042001 Bacteria 956
287 Ga0439435_0002498 3300042436 Bacteria 3667
288 Ga0439464_0032904 3300042439 Bacteria 1458
289 Ga0439460_0006852 3300042461 Bacteria 2838
290 Ga0439440_0065393 3300042993 Bacteria 936
291 Ga0466966_0346953 3300044684 Bacteria 892
292 Ga0466963_0024101 3300044694 Bacteria 3872
293 Ga0466959_0068340 3300045049 Bacteria 2575
294 Ga0466967_0031475 3300045976 Bacteria 4466
295 Ga0466967_0497178 3300045976 Bacteria 1196
296 Ga0495617_020023 3300046452 Bacteria 2261
297 Ga0495592_0010417 3300046454 Bacteria 7012
298 Ga0495592_0066586 3300046454 Bacteria 2635
299 Ga0495603_0000189 3300046455 Bacteria 32189
300 Ga0495603_0182267 3300046455 Bacteria 1215
301 Ga0495603_0224455 3300046455 Bacteria 1083
302 Ga0495591_024325 3300046458 Bacteria 1922
303 Ga0495629_0000268 3300046459 Bacteria 45291
304 Ga0495629_0339572 3300046459 Bacteria 1025
305 Ga0495638_0111733 3300046460 Bacteria 1622
306 Ga0495641_0004507 3300046461 Bacteria 9809
307 Ga0495641_0007758 3300046461 Bacteria 6647
308 Ga0495580_0000772 3300046472 Bacteria 27573
309 Ga0495580_0008443 3300046472 Bacteria 8194
310 Ga0495580_0021834 3300046472 Bacteria 4721
311 Ga0495582_0000144 3300046473 Bacteria 38436
312 Ga0495582_0082031 3300046473 Bacteria 1791
313 Ga0495639_0000067 3300046475 Bacteria 47932
314 Ga0495662_0019742 3300046476 Bacteria 3260
315 Ga0495662_0034507 3300046476 Bacteria 2441
316 Ga0495664_0023218 3300046477 Bacteria 3598
317 Ga0495584_0028442 3300046491 Bacteria 2833
318 Ga0495584_0065023 3300046491 Bacteria 1834
319 Ga0495584_0144946 3300046491 Bacteria 1206
320 Ga0495585_0004225 3300046492 Bacteria 9369
321 Ga0495594_0000102 3300046499 Bacteria 39784
322 Ga0495607_0005594 3300046501 Bacteria 8963
323 Ga0495607_0173408 3300046501 Bacteria 1087
324 Ga0495583_0103291 3300046506 Bacteria 1214
325 Ga0495608_0021002 3300046511 Bacteria 4485
326 Ga0495608_0070124 3300046511 Bacteria 2288
327 Ga0495616_0090058 3300046513 Bacteria 1454
328 Ga0495618_0168803 3300046514 Bacteria 1393
329 Ga0495618_0172727 3300046514 Bacteria 1375
330 Ga0495628_0028272 3300046516 Bacteria 4557
331 Ga0495630_0018756 3300046517 Bacteria 5083
332 Ga0495630_0070155 3300046517 Bacteria 2636
333 Ga0495630_0097623 3300046517 Bacteria 2222
334 Ga0495631_0018028 3300046518 Bacteria 3330
335 Ga0495637_0064316 3300046520 Bacteria 1496
336 Ga0495644_0000306 3300046523 Bacteria 22634
337 Ga0495663_0023455 3300046525 Bacteria 1787
338 Ga0495663_0044559 3300046525 Bacteria 1358
339 Ga0495666_0039515 3300046526 Bacteria 2290
340 Ga0495652_0013648 3300046529 Bacteria 7311
341 Ga0495652_0058875 3300046529 Bacteria 3252
342 Ga0495654_0038735 3300046530 Bacteria 2382
343 Ga0495665_0000355 3300046531 Bacteria 23262
344 Ga0495665_0008953 3300046531 Bacteria 5431
345 Ga0495640_0004592 3300046533 Bacteria 11016
346 Ga0495640_0076662 3300046533 Bacteria 2230
347 Ga0495586_0027068 3300046535 Bacteria 3068
348 Ga0495586_0230464 3300046535 Bacteria 1054
349 Ga0495587_0044390 3300046536 Bacteria 2644
350 Ga0495587_0071699 3300046536 Bacteria 2014
351 Ga0495598_0002396 3300046537 Bacteria 3869
352 Ga0495609_0046901 3300046538 Bacteria 1935
353 Ga0495621_0136638 3300046539 Bacteria 957
354 Ga0495622_0000649 3300046557 Bacteria 19833
355 Ga0495622_0004842 3300046557 Bacteria 6235
356 Ga0495633_0001183 3300046558 Bacteria 20947
357 Ga0495667_0019434 3300046559 Bacteria 4584
358 Ga0495667_0031521 3300046559 Bacteria 3558
359 Ga0495656_0000381 3300046615 Bacteria 14786
360 Ga0495656_0030222 3300046615 Bacteria 2188
361 Ga0495656_0035348 3300046615 Bacteria 2052
362 Ga0495634_0007987 3300046642 Bacteria 7893
363 Ga0495634_0020441 3300046642 Bacteria 4694
364 Ga0495611_0130417 3300046648 Bacteria 1172
365 Ga0495625_0051874 3300046660 Bacteria 2938
366 Ga0495635_0001955 3300046663 Bacteria 14010
367 Ga0495635_0198640 3300046663 Bacteria 1361
368 Ga0495659_0000645 3300046664 Bacteria 12657
369 Ga0495661_0061995 3300046665 Bacteria 2217
370 Ga0495588_0003103 3300046674 Bacteria 7194
371 Ga0495588_0190601 3300046674 Bacteria 1083
372 Ga0495657_0074244 3300046675 Bacteria 2213
373 Ga0495599_0017266 3300046678 Bacteria 4486
374 Ga0495646_0071068 3300046680 Bacteria 2048
375 Ga0495647_0000151 3300046681 Bacteria 17761
376 Ga0495658_0000439 3300046683 Bacteria 23198
377 Ga0495658_0068462 3300046683 Bacteria 2055
378 Ga0495613_0005413 3300046689 Bacteria 9591
379 Ga0495613_0030381 3300046689 Bacteria 4013
380 Ga0495624_0017115 3300046690 Bacteria 4871
381 Ga0495624_0017221 3300046690 Bacteria 4855
382 Ga0495670_0002108 3300046691 Bacteria 9817
383 Ga0495670_0004752 3300046691 Bacteria 6671
384 Ga0495670_0243679 3300046691 Bacteria 957
385 Ga0495600_0006075 3300046809 Bacteria 7316
386 Ga0495600_0096349 3300046809 Bacteria 1929
387 Ga0495660_0050946 3300046810 Bacteria 2254
388 Ga0495581_0000084 3300047315 Bacteria 38216
389 Ga0495581_0004621 3300047315 Bacteria 7951
390 Ga0495604_0042976 3300047317 Bacteria 3540
391 Ga0495674_0006112 3300047319 Bacteria 11563
392 Ga0495674_0085063 3300047319 Bacteria 2709
393 Ga0495672_0004345 3300047320 Bacteria 11663
394 Ga0495672_0090625 3300047320 Bacteria 1680
395 Ga0495676_0015887 3300047321 Bacteria 6690
396 Ga0495680_0083655 3300047322 Bacteria 2406
397 Ga0495680_0237797 3300047322 Bacteria 1294
398 Ga0495680_0272446 3300047322 Bacteria 1195
399 Ga0495677_0074512 3300047445 Bacteria 1267
400 Ga0495684_0015749 3300047471 Bacteria 5818
401 Ga0495684_0035512 3300047471 Bacteria 3823
402 Ga0495686_0077375 3300047472 Bacteria 2037
403 Ga0495593_0000038 3300047673 Bacteria 53141
404 Ga0495593_0077949 3300047673 Bacteria 1716
405 Ga0495614_0015458 3300048089 Bacteria 3327
406 Ga0495615_0016157 3300048090 Bacteria 1605
407 Ga0496104_0552897 3300048907 Bacteria 1062
408 Ga0496112_0006551 3300048915 Bacteria 10247
409 Ga0496113_0110517 3300048916 Bacteria 2139
410 Ga0496115_0361911 3300048918 Bacteria 1182
411 Ga0496115_0486533 3300048918 Bacteria 993
412 Ga0496116_0008716 3300048919 Bacteria 8758
413 Ga0496116_0212171 3300048919 Bacteria 1002
414 Ga0496117_0087125 3300048920 Bacteria 2025
415 Ga0496117_0099447 3300048920 Bacteria 1845
416 Ga0496118_0073400 3300048921 Bacteria 2451
417 Ga0496119_0069436 3300048922 Bacteria 2070
418 Ga0496121_0002503 3300048924 Bacteria 27924
419 Ga0496121_0194751 3300048924 Bacteria 1450
420 Ga0496121_0252132 3300048924 Bacteria 1223
421 Ga0496122_0082037 3300048925 Bacteria 2241
422 Ga0496122_0196476 3300048925 Bacteria 1184
423 Ga0496124_0144580 3300048927 Bacteria 1873
424 Ga0496124_0190826 3300048927 Bacteria 1568
425 Ga0496124_0351667 3300048927 Bacteria 1042
426 Ga0496125_0021733 3300048928 Bacteria 5972
427 Ga0496125_0139266 3300048928 Bacteria 1690
428 Ga0501033_0069428 3300049570 Bacteria 2590
429 Ga0501034_0061846 3300049571 Bacteria 3760
430 Ga0501034_0227180 3300049571 Bacteria 1817
431 Ga0501034_0235945 3300049571 Bacteria 1776
432 Ga0501036_0256230 3300049572 Bacteria 1466
433 Ga0501038_0030866 3300049574 Bacteria 4738
434 Ga0501038_0143221 3300049574 Bacteria 1953
435 Ga0501041_0110127 3300049577 Bacteria 1708
436 Ga0501043_0015355 3300049579 Bacteria 5998
437 Ga0501043_0364439 3300049579 Bacteria 1096
438 Ga0501047_0003901 3300049581 Bacteria 14021
439 Ga0501047_0057292 3300049581 Bacteria 3768
440 Ga0501048_0160356 3300049582 Bacteria 1592
441 Ga0501068_0016013 3300049584 Bacteria 4319
442 Ga0501069_0005696 3300049585 Bacteria 6489
443 Ga0501070_0014884 3300049586 Bacteria 6544
444 Ga0501070_0070613 3300049586 Bacteria 2892
445 Ga0501070_0146650 3300049586 Bacteria 1948
446 Ga0501072_0095655 3300049588 Bacteria 2361
447 Ga0501073_0027419 3300049589 Bacteria 4073
448 Ga0501073_0320268 3300049589 Bacteria 1070
449 Ga0501074_0082975 3300049590 Bacteria 2298
450 Ga0501075_0002331 3300049591 Bacteria 12593
451 Ga0501076_0194754 3300049592 Bacteria 1654
452 Ga0501080_0016494 3300049742 Bacteria 6823
453 Ga0501080_0025862 3300049742 Bacteria 5453
454 Ga0501080_0089509 3300049742 Bacteria 2859
455 Ga0501080_0099163 3300049742 Bacteria 2703
456 Ga0501083_0070803 3300049744 Bacteria 2319
457 Ga0501083_0314940 3300049744 Bacteria 1018
458 Ga0501035_0000371 3300049822 Bacteria 51668
459 Ga0501035_0016438 3300049822 Bacteria 6825
460 Ga0501044_0332332 3300049823 Bacteria 1442
461 Ga0501045_0046031 3300049824 Bacteria 3177
462 nmdc:mga03683_4846_c1 3300050489 Bacteria 2940
463 nmdc:mga03n38_216561_c1 3300050490 Bacteria 998
464 nmdc:mga03n38_47996_c1 3300050490 Bacteria 1892
465 nmdc:mga00v17_6965_c1 3300050491 Bacteria 6014
466 nmdc:mga0yw44_410015_c1 3300050492 Bacteria 917
467 nmdc:mga0yw44_910_c1 3300050492 Bacteria 11185
468 nmdc:mga0k408_162614_c1 3300050493 Bacteria 1330
469 nmdc:mga0k408_28781_c1 3300050493 Bacteria 3160
470 nmdc:mga0k408_356141_c1 3300050493 Bacteria 872
471 nmdc:mga06z11_238710_c1 3300050494 Bacteria 1067
472 nmdc:mga06z11_242058_c1 3300050494 Bacteria 1060
473 nmdc:mga06z11_3342_c1 3300050494 Bacteria 6211
474 nmdc:mga06z11_57586_c1 3300050494 Bacteria 2014
475 nmdc:mga07m45_37324_c1 3300050496 Bacteria 2710
476 nmdc:mga07m45_70557_c1 3300050496 Bacteria 1987
477 nmdc:mga05p37_52_c1 3300050507 Bacteria 102932
478 nmdc:mga09592_5230_c1 3300050508 Bacteria 10547
479 nmdc:mga0qj67_372400_c1 3300050509 Bacteria 1153
480 nmdc:mga06r32_248_c1 3300050510 Bacteria 44402
481 nmdc:mga06r32_430729_c1 3300050510 Bacteria 1300
482 nmdc:mga08y16_185_c1 3300050511 Bacteria 55383
483 nmdc:mga08y16_585806_c1 3300050511 Bacteria 1126
484 nmdc:mga0n895_4095_c1 3300050512 Bacteria 11871
485 nmdc:mga0n895_584706_c1 3300050512 Bacteria 1120
486 nmdc:mga0rr50_200384_c1 3300050513 Bacteria 1640
487 nmdc:mga08x19_52610_c1 3300050514 Bacteria 2619
488 Ga0495601_0000722 3300053077 Bacteria 17751
489 Ga0495601_0030306 3300053077 Bacteria 3358
490 Ga0495595_0008051 3300053084 Bacteria 4320
491 Ga0495619_0005352 3300053085 Bacteria 8127
492 Ga0495619_0050948 3300053085 Bacteria 2734
493 Ga0495619_0147529 3300053085 Bacteria 1622
494 Ga0500643_016829 3300053087 Bacteria 2466
495 Ga0500643_039956 3300053087 Bacteria 1383
496 Ga0500583_0083250 3300053092 Bacteria 1548
497 Ga0500651_0077567 3300053093 Bacteria 2062
498 Ga0500651_0080518 3300053093 Bacteria 2017
499 Ga0500651_0083360 3300053093 Bacteria 1978
500 Ga0500566_0000629 3300053094 Bacteria 19693
501 Ga0500641_0014121 3300053096 Bacteria 2943
502 Ga0500641_0017753 3300053096 Bacteria 2667
503 Ga0500650_0048591 3300053098 Bacteria 1967
504 Ga0500556_0000012 3300053104 Bacteria 250391
505 Ga0500593_018097 3300053117 Bacteria 3067
506 Ga0500607_140331 3300053121 Bacteria 1137
507 Ga0500608_095040 3300053122 Bacteria 1387
508 Ga0500642_0000055 3300053130 Bacteria 68809
509 Ga0500652_001690 3300053131 Bacteria 6687
510 Ga0500559_0000615 3300053136 Bacteria 24153
511 Ga0500559_0069306 3300053136 Bacteria 1586
512 Ga0500568_0000386 3300053139 Bacteria 33695
513 Ga0500573_0237605 3300053140 Bacteria 947
514 Ga0500586_000275 3300053145 Bacteria 10313
515 Ga0500604_0000814 3300053151 Bacteria 8588
516 Ga0500616_0000001 3300053153 Bacteria 1986011
517 Ga0500616_0000035 3300053153 Bacteria 394242
518 Ga0500616_0000038 3300053153 Bacteria 386801
519 Ga0500622_0000885 3300053156 Bacteria 25488
520 Ga0500636_0016619 3300053177 Bacteria 4339
521 Ga0500645_000592 3300053730 Bacteria 23396
522 Ga0500645_024050 3300053730 Bacteria 1864
523 Ga0501084_0231663 3300054114 Bacteria 1559
524 Ga0501082_0150136 3300060353 Bacteria 2024

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0314940 Ga0501083_0314940_38_799 223
2 3300031249 Ga0265339_10045967 Ga0265339_100459672 228
3 3300005439 Ga0070711_100472494 Ga0070711_1004724942 233
4 3300049742 Ga0501080_0025862 Ga0501080_0025862_325_1086 234
5 3300006871 Ga0075434_100820864 Ga0075434_1008208641 238
6 3300050512 nmdc:mga0n895_584706_c1 nmdc:mga0n895_584706_c1_231_956 238
7 3300035086 Ga0373934_0145869 Ga0373934_0145869_44_763 239
8 3300036401 Ga0373937_1078782 Ga0373937_1078782_18_737 239
9 3300046455 Ga0495603_0224455 Ga0495603_0224455_335_1054 239
10 3300047472 Ga0495686_0077375 Ga0495686_0077375_965_1711 246
11 3300039437 Ga0436365_0478771 Ga0436365_0478771_17_760 247
12 3300049742 Ga0501080_0099163 Ga0501080_0099163_519_1310 248
13 3300046535 Ga0495586_0230464 Ga0495586_0230464_292_1041 249
14 3300007788 Ga0099795_10006176 Ga0099795_100061762 250
15 3300010159 Ga0099796_10015537 Ga0099796_100155372 250
16 3300027512 Ga0209179_1002729 Ga0209179_10027292 250
17 3300028016 Ga0265354_1002438 Ga0265354_10024382 250
18 3300030878 Ga0265770_1000659 Ga0265770_10006591 250
19 3300031730 Ga0307516_10000012 Ga0307516_10000012116 250
20 3300039437 Ga0436365_0471606 Ga0436365_0471606_332_1123 250
21 iso_pu_bacteria 2602042107 2603857827 251
22 iso_pu_bacteria 2643221651 2644290730 251
23 iso_pu_bacteria 2857524615 2857527199 251
24 iso_pu_bacteria 2893066018 2893068022 251
25 iso_pu_bacteria 2919073203 2919078315 251
26 iso_pu_bacteria 8006984368 8006992433 251
27 3300005458 Ga0070681_10052200 Ga0070681_100522004 252
28 3300009551 Ga0105238_10010498 Ga0105238_1001049810 252
29 3300025912 Ga0207707_10095860 Ga0207707_100958604 252
30 3300025916 Ga0207663_10159541 Ga0207663_101595412 252
31 3300025924 Ga0207694_10022049 Ga0207694_100220494 252
32 3300031344 Ga0265316_10143685 Ga0265316_101436852 252
33 3300035111 Ga0373923_0090388 Ga0373923_0090388_252_1016 252
34 3300035692 Ga0373935_0191260 Ga0373935_0191260_297_1061 252
35 3300037068 Ga0373925_0108432 Ga0373925_0108432_941_1705 252
36 3300049571 Ga0501034_0235945 Ga0501034_0235945_535_1302 252
37 3300006042 Ga0075368_10039067 Ga0075368_100390672 253
38 3300006051 Ga0075364_10028155 Ga0075364_100281556 253
39 3300006195 Ga0075366_10033238 Ga0075366_100332383 253
40 3300006353 Ga0075370_10006281 Ga0075370_100062818 253
41 3300035725 Ga0373947_0412320 Ga0373947_0412320_21_800 253
42 3300049581 Ga0501047_0003901 Ga0501047_0003901_5706_6470 253
43 3300049589 Ga0501073_0027419 Ga0501073_0027419_3096_3857 253
44 3300049589 Ga0501073_0320268 Ga0501073_0320268_167_928 253
45 3300050493 nmdc:mga0k408_162614_c1 nmdc:mga0k408_162614_c1_389_1150 253
46 3300050494 nmdc:mga06z11_57586_c1 nmdc:mga06z11_57586_c1_718_1479 253
47 3300054114 Ga0501084_0231663 Ga0501084_0231663_205_1005 253
48 3300025915 Ga0207693_10211290 Ga0207693_102112901 254
49 3300048925 Ga0496122_0082037 Ga0496122_0082037_1331_2095 254
50 3300005262 Ga0065165_1033275 Ga0065165_10332752 255
51 3300005327 Ga0070658_10075940 Ga0070658_100759403 255
52 3300005327 Ga0070658_10360364 Ga0070658_103603642 255
53 3300005328 Ga0070676_10022589 Ga0070676_100225894 255
54 3300005329 Ga0070683_100020669 Ga0070683_1000206695 255
55 3300005330 Ga0070690_100312144 Ga0070690_1003121441 255
56 3300005331 Ga0070670_100284165 Ga0070670_1002841652 255
57 3300005333 Ga0070677_10002261 Ga0070677_100022614 255
58 3300005334 Ga0068869_100706912 Ga0068869_1007069121 255
59 3300005335 Ga0070666_10248860 Ga0070666_102488601 255
60 3300005338 Ga0068868_100155670 Ga0068868_1001556703 255
61 3300005344 Ga0070661_100218783 Ga0070661_1002187832 255
62 3300005353 Ga0070669_100216329 Ga0070669_1002163292 255
63 3300005354 Ga0070675_100258455 Ga0070675_1002584552 255
64 3300005354 Ga0070675_100546229 Ga0070675_1005462292 255
65 3300005356 Ga0070674_100021623 Ga0070674_1000216232 255
66 3300005364 Ga0070673_100017637 Ga0070673_1000176372 255
67 3300005367 Ga0070667_100062304 Ga0070667_1000623043 255
68 3300005367 Ga0070667_100087427 Ga0070667_1000874272 255
69 3300005434 Ga0070709_10003001 Ga0070709_100030017 255
70 3300005434 Ga0070709_10004073 Ga0070709_100040737 255
71 3300005436 Ga0070713_100000768 Ga0070713_10000076815 255
72 3300005436 Ga0070713_100050097 Ga0070713_1000500972 255
73 3300005437 Ga0070710_10000783 Ga0070710_100007834 255
74 3300005437 Ga0070710_10011138 Ga0070710_100111384 255
75 3300005439 Ga0070711_100014561 Ga0070711_1000145616 255
76 3300005444 Ga0070694_100472071 Ga0070694_1004720711 255
77 3300005455 Ga0070663_100544819 Ga0070663_1005448191 255
78 3300005456 Ga0070678_100015675 Ga0070678_1000156752 255
79 3300005458 Ga0070681_10099564 Ga0070681_100995642 255
80 3300005458 Ga0070681_10341409 Ga0070681_103414092 255
81 3300005530 Ga0070679_100029863 Ga0070679_1000298635 255
82 3300005530 Ga0070679_100112332 Ga0070679_1001123323 255
83 3300005535 Ga0070684_100010288 Ga0070684_1000102885 255
84 3300005535 Ga0070684_100018435 Ga0070684_1000184352 255
85 3300005539 Ga0068853_100213968 Ga0068853_1002139682 255
86 3300005543 Ga0070672_100314516 Ga0070672_1003145162 255
87 3300005544 Ga0070686_100088863 Ga0070686_1000888631 255
88 3300005545 Ga0070695_100003309 Ga0070695_1000033098 255
89 3300005547 Ga0070693_100047172 Ga0070693_1000471721 255
90 3300005548 Ga0070665_100214894 Ga0070665_1002148942 255
91 3300005548 Ga0070665_100314562 Ga0070665_1003145622 255
92 3300005563 Ga0068855_100140528 Ga0068855_1001405282 255
93 3300005563 Ga0068855_101067411 Ga0068855_1010674111 255
94 3300005616 Ga0068852_101091218 Ga0068852_1010912181 255
95 3300005618 Ga0068864_100196374 Ga0068864_1001963742 255
96 3300005719 Ga0068861_100019252 Ga0068861_1000192526 255
97 3300005843 Ga0068860_100135759 Ga0068860_1001357591 255
98 3300005844 Ga0068862_100125823 Ga0068862_1001258233 255
99 3300005844 Ga0068862_100367396 Ga0068862_1003673962 255
100 3300005844 Ga0068862_100675343 Ga0068862_1006753431 255
101 3300005937 Ga0081455_10117951 Ga0081455_101179513 255
102 3300005985 Ga0081539_10000522 Ga0081539_1000052233 255
103 3300005985 Ga0081539_10048337 Ga0081539_100483372 255
104 3300006028 Ga0070717_10075333 Ga0070717_100753333 255
105 3300006038 Ga0075365_10003113 Ga0075365_100031136 255
106 3300006038 Ga0075365_10186131 Ga0075365_101861312 255
107 3300006048 Ga0075363_100006649 Ga0075363_1000066494 255
108 3300006051 Ga0075364_10027819 Ga0075364_100278193 255
109 3300006163 Ga0070715_10000865 Ga0070715_100008653 255
110 3300006173 Ga0070716_100001482 Ga0070716_1000014827 255
111 3300006173 Ga0070716_100053489 Ga0070716_1000534893 255
112 3300006175 Ga0070712_100217066 Ga0070712_1002170662 255
113 3300006177 Ga0075362_10010464 Ga0075362_100104643 255
114 3300006177 Ga0075362_10013395 Ga0075362_100133954 255
115 3300006178 Ga0075367_10005803 Ga0075367_100058035 255
116 3300006178 Ga0075367_10039032 Ga0075367_100390323 255
117 3300006178 Ga0075367_10144434 Ga0075367_101444341 255
118 3300006195 Ga0075366_10214704 Ga0075366_102147042 255
119 3300006353 Ga0075370_10019630 Ga0075370_100196304 255
120 3300006358 Ga0068871_100057891 Ga0068871_1000578912 255
121 3300006358 Ga0068871_100330713 Ga0068871_1003307132 255
122 3300006844 Ga0075428_100002387 Ga0075428_1000023875 255
123 3300006844 Ga0075428_100299541 Ga0075428_1002995412 255
124 3300006846 Ga0075430_100023729 Ga0075430_1000237295 255
125 3300006847 Ga0075431_100000881 Ga0075431_10000088119 255
126 3300006847 Ga0075431_100391755 Ga0075431_1003917552 255
127 3300006852 Ga0075433_10345521 Ga0075433_103455211 255
128 3300006871 Ga0075434_100005953 Ga0075434_10000595313 255
129 3300006881 Ga0068865_100187046 Ga0068865_1001870462 255
130 3300006914 Ga0075436_100217875 Ga0075436_1002178752 255
131 3300007265 Ga0099794_10012605 Ga0099794_100126053 255
132 3300007265 Ga0099794_10015075 Ga0099794_100150756 255
133 3300007265 Ga0099794_10017446 Ga0099794_100174462 255
134 3300009092 Ga0105250_10063529 Ga0105250_100635293 255
135 3300009094 Ga0111539_10000144 Ga0111539_1000014475 255
136 3300009094 Ga0111539_10253827 Ga0111539_102538272 255
137 3300009094 Ga0111539_10518624 Ga0111539_105186242 255
138 3300009098 Ga0105245_10007083 Ga0105245_100070838 255
139 3300009101 Ga0105247_10368322 Ga0105247_103683221 255
140 3300009147 Ga0114129_10000542 Ga0114129_1000054212 255
141 3300009174 Ga0105241_10260035 Ga0105241_102600352 255
142 3300009176 Ga0105242_10013985 Ga0105242_100139853 255
143 3300009176 Ga0105242_10433484 Ga0105242_104334842 255
144 3300009177 Ga0105248_10158178 Ga0105248_101581783 255
145 3300009545 Ga0105237_10219030 Ga0105237_102190303 255
146 3300009551 Ga0105238_10082580 Ga0105238_100825803 255
147 3300009551 Ga0105238_10105024 Ga0105238_101050242 255
148 3300009551 Ga0105238_10125835 Ga0105238_101258353 255
149 3300009551 Ga0105238_10182831 Ga0105238_101828312 255
150 3300009551 Ga0105238_10389472 Ga0105238_103894722 255
151 3300010159 Ga0099796_10020826 Ga0099796_100208263 255
152 3300010375 Ga0105239_10587026 Ga0105239_105870262 255
153 3300013100 Ga0157373_10041341 Ga0157373_100413414 255
154 3300013102 Ga0157371_10300657 Ga0157371_103006572 255
155 3300013104 Ga0157370_10075072 Ga0157370_100750724 255
156 3300013104 Ga0157370_10244627 Ga0157370_102446272 255
157 3300013105 Ga0157369_10111758 Ga0157369_101117582 255
158 3300013105 Ga0157369_10206877 Ga0157369_102068774 255
159 3300013105 Ga0157369_10354799 Ga0157369_103547992 255
160 3300013297 Ga0157378_10109266 Ga0157378_101092662 255
161 3300013306 Ga0163162_10589735 Ga0163162_105897351 255
162 3300013308 Ga0157375_10095149 Ga0157375_100951493 255
163 3300014326 Ga0157380_10029987 Ga0157380_100299872 255
164 3300014326 Ga0157380_10333297 Ga0157380_103332972 255
165 3300014968 Ga0157379_10536620 Ga0157379_105366202 255
166 3300014969 Ga0157376_10104898 Ga0157376_101048982 255
167 3300014969 Ga0157376_10979362 Ga0157376_109793621 255
168 3300017792 Ga0163161_10134008 Ga0163161_101340082 255
169 3300021384 Ga0213876_10008883 Ga0213876_100088835 255
170 3300022467 Ga0224712_10014402 Ga0224712_100144022 255
171 3300025295 Ga0209564_1000602 Ga0209564_100060236 255
172 3300025295 Ga0209564_1008246 Ga0209564_10082466 255
173 3300025711 Ga0207696_1020893 Ga0207696_10208932 255
174 3300025893 Ga0207682_10001508 Ga0207682_100015086 255
175 3300025898 Ga0207692_10001515 Ga0207692_100015154 255
176 3300025898 Ga0207692_10006519 Ga0207692_100065194 255
177 3300025900 Ga0207710_10249163 Ga0207710_102491631 255
178 3300025901 Ga0207688_10024392 Ga0207688_100243922 255
179 3300025903 Ga0207680_10459582 Ga0207680_104595821 255
180 3300025904 Ga0207647_10033231 Ga0207647_100332312 255
181 3300025904 Ga0207647_10085984 Ga0207647_100859842 255
182 3300025905 Ga0207685_10007721 Ga0207685_100077214 255
183 3300025906 Ga0207699_10000360 Ga0207699_1000036025 255
184 3300025906 Ga0207699_10010387 Ga0207699_100103873 255
185 3300025907 Ga0207645_10018494 Ga0207645_100184945 255
186 3300025908 Ga0207643_10047442 Ga0207643_100474422 255
187 3300025909 Ga0207705_10271759 Ga0207705_102717591 255
188 3300025912 Ga0207707_10030771 Ga0207707_100307714 255
189 3300025912 Ga0207707_10097794 Ga0207707_100977941 255
190 3300025915 Ga0207693_10000073 Ga0207693_1000007348 255
191 3300025915 Ga0207693_10015453 Ga0207693_100154534 255
192 3300025916 Ga0207663_10000993 Ga0207663_100009934 255
193 3300025916 Ga0207663_10012680 Ga0207663_100126804 255
194 3300025917 Ga0207660_10259223 Ga0207660_102592232 255
195 3300025918 Ga0207662_10035450 Ga0207662_100354503 255
196 3300025919 Ga0207657_10006265 Ga0207657_100062658 255
197 3300025920 Ga0207649_10152946 Ga0207649_101529462 255
198 3300025921 Ga0207652_10186134 Ga0207652_101861342 255
199 3300025923 Ga0207681_10047285 Ga0207681_100472852 255
200 3300025923 Ga0207681_10150575 Ga0207681_101505752 255
201 3300025924 Ga0207694_10084471 Ga0207694_100844713 255
202 3300025924 Ga0207694_10099125 Ga0207694_100991252 255
203 3300025924 Ga0207694_10587286 Ga0207694_105872862 255
204 3300025925 Ga0207650_10512369 Ga0207650_105123691 255
205 3300025926 Ga0207659_10188062 Ga0207659_101880622 255
206 3300025927 Ga0207687_10021525 Ga0207687_100215254 255
207 3300025927 Ga0207687_10119203 Ga0207687_101192032 255
208 3300025928 Ga0207700_10027298 Ga0207700_100272983 255
209 3300025928 Ga0207700_10069970 Ga0207700_100699701 255
210 3300025929 Ga0207664_10005740 Ga0207664_100057403 255
211 3300025929 Ga0207664_10009377 Ga0207664_100093775 255
212 3300025929 Ga0207664_10148940 Ga0207664_101489402 255
213 3300025929 Ga0207664_10252593 Ga0207664_102525932 255
214 3300025931 Ga0207644_10064574 Ga0207644_100645742 255
215 3300025932 Ga0207690_10449047 Ga0207690_104490472 255
216 3300025933 Ga0207706_10050316 Ga0207706_100503163 255
217 3300025933 Ga0207706_10135615 Ga0207706_101356154 255
218 3300025935 Ga0207709_10336730 Ga0207709_103367301 255
219 3300025937 Ga0207669_10024599 Ga0207669_100245994 255
220 3300025938 Ga0207704_10106925 Ga0207704_101069252 255
221 3300025939 Ga0207665_10000316 Ga0207665_1000031626 255
222 3300025939 Ga0207665_10087039 Ga0207665_100870392 255
223 3300025940 Ga0207691_10016907 Ga0207691_100169074 255
224 3300025941 Ga0207711_10355527 Ga0207711_103555272 255
225 3300025942 Ga0207689_10163465 Ga0207689_101634652 255
226 3300025944 Ga0207661_10045556 Ga0207661_100455565 255
227 3300025945 Ga0207679_10049052 Ga0207679_100490522 255
228 3300025949 Ga0207667_10204481 Ga0207667_102044813 255
229 3300025949 Ga0207667_10765477 Ga0207667_107654772 255
230 3300025986 Ga0207658_10101350 Ga0207658_101013502 255
231 3300025986 Ga0207658_10171871 Ga0207658_101718712 255
232 3300025986 Ga0207658_10506975 Ga0207658_105069751 255
233 3300026023 Ga0207677_10526178 Ga0207677_105261782 255
234 3300026041 Ga0207639_10198293 Ga0207639_101982932 255
235 3300026067 Ga0207678_10070849 Ga0207678_100708493 255
236 3300026075 Ga0207708_10202282 Ga0207708_102022822 255
237 3300026075 Ga0207708_10314941 Ga0207708_103149412 255
238 3300026089 Ga0207648_10208975 Ga0207648_102089752 255
239 3300026095 Ga0207676_10167633 Ga0207676_101676332 255
240 3300026095 Ga0207676_10421070 Ga0207676_104210702 255
241 3300026116 Ga0207674_10141706 Ga0207674_101417063 255
242 3300026116 Ga0207674_10159098 Ga0207674_101590983 255
243 3300026118 Ga0207675_100053662 Ga0207675_1000536621 255
244 3300026118 Ga0207675_100367134 Ga0207675_1003671342 255
245 3300026121 Ga0207683_10014358 Ga0207683_100143583 255
246 3300027512 Ga0209179_1001650 Ga0209179_10016503 255
247 3300027907 Ga0207428_10013852 Ga0207428_100138525 255
248 3300027907 Ga0207428_10192868 Ga0207428_101928683 255
249 3300028379 Ga0268266_10398071 Ga0268266_103980712 255
250 3300028379 Ga0268266_10758239 Ga0268266_107582392 255
251 3300028794 Ga0307515_10131554 Ga0307515_101315541 255
252 3300031235 Ga0265330_10051225 Ga0265330_100512252 255
253 3300031247 Ga0265340_10173155 Ga0265340_101731551 255
254 3300031249 Ga0265339_10002564 Ga0265339_100025645 255
255 3300031344 Ga0265316_10185828 Ga0265316_101858282 255
256 3300031548 Ga0307408_100229136 Ga0307408_1002291362 255
257 3300031548 Ga0307408_100230098 Ga0307408_1002300982 255
258 3300034819 Ga0373958_0018676 Ga0373958_0018676_31_801 255
259 3300035084 Ga0373928_0057160 Ga0373928_0057160_68_835 255
260 3300035086 Ga0373934_0022274 Ga0373934_0022274_619_1386 255
261 3300035088 Ga0373940_0036666 Ga0373940_0036666_431_1201 255
262 3300035089 Ga0373944_0001048 Ga0373944_0001048_4012_4779 255
263 3300035111 Ga0373923_0132978 Ga0373923_0132978_337_1104 255
264 3300035113 Ga0373936_0026976 Ga0373936_0026976_567_1382 255
265 3300035113 Ga0373936_0119287 Ga0373936_0119287_15_782 255
266 3300035115 Ga0373941_0006278 Ga0373941_0006278_1218_1988 255
267 3300035116 Ga0373945_0009707 Ga0373945_0009707_344_1111 255
268 3300035117 Ga0373953_0146930 Ga0373953_0146930_68_835 255
269 3300035118 Ga0373954_0002232 Ga0373954_0002232_960_1727 255
270 3300035118 Ga0373954_0004821 Ga0373954_0004821_842_1609 255
271 3300035119 Ga0373956_0008976 Ga0373956_0008976_1399_2166 255
272 3300035119 Ga0373956_0065477 Ga0373956_0065477_543_1310 255
273 3300035119 Ga0373956_0146663 Ga0373956_0146663_43_813 255
274 3300035120 Ga0373957_0033723 Ga0373957_0033723_194_964 255
275 3300035170 Ga0373943_0015761 Ga0373943_0015761_2047_2814 255
276 3300035171 Ga0373946_0001892 Ga0373946_0001892_4076_4843 255
277 3300035171 Ga0373946_0002159 Ga0373946_0002159_5192_5959 255
278 3300035172 Ga0373955_0009700 Ga0373955_0009700_3528_4295 255
279 3300035172 Ga0373955_0039994 Ga0373955_0039994_1303_2070 255
280 3300035172 Ga0373955_0062323 Ga0373955_0062323_1071_1838 255
281 3300035172 Ga0373955_0079459 Ga0373955_0079459_330_1097 255
282 3300035410 Ga0373924_0009556 Ga0373924_0009556_2171_2938 255
283 3300035410 Ga0373924_0112709 Ga0373924_0112709_204_971 255
284 3300035410 Ga0373924_0210233 Ga0373924_0210233_16_786 255
285 3300035691 Ga0373931_0002980 Ga0373931_0002980_5282_6052 255
286 3300035692 Ga0373935_0000434 Ga0373935_0000434_20143_20910 255
287 3300035695 Ga0373927_0000645 Ga0373927_0000645_17956_18723 255
288 3300035724 Ga0373933_0002533 Ga0373933_0002533_8204_8971 255
289 3300035724 Ga0373933_0014674 Ga0373933_0014674_2730_3497 255
290 3300035724 Ga0373933_0046084 Ga0373933_0046084_139_906 255
291 3300035725 Ga0373947_0002079 Ga0373947_0002079_7938_8705 255
292 3300035725 Ga0373947_0025229 Ga0373947_0025229_1066_1833 255
293 3300035725 Ga0373947_0122293 Ga0373947_0122293_63_830 255
294 3300036401 Ga0373937_0013989 Ga0373937_0013989_5154_5921 255
295 3300036401 Ga0373937_0280473 Ga0373937_0280473_677_1444 255
296 3300037068 Ga0373925_0006318 Ga0373925_0006318_5883_6650 255
297 3300037068 Ga0373925_0010149 Ga0373925_0010149_1514_2281 255
298 3300037312 Ga0395899_0056987 Ga0395899_0056987_86_853 255
299 3300037418 Ga0395900_0201339 Ga0395900_0201339_330_1097 255
300 3300038443 Ga0395901_0025191 Ga0395901_0025191_2048_2815 255
301 3300039437 Ga0436365_0861583 Ga0436365_0861583_1914_2681 255
302 3300039437 Ga0436365_1639838 Ga0436365_1639838_6793_7560 255
303 3300039437 Ga0436365_1832441 Ga0436365_1832441_672_1439 255
304 3300039450 Ga0436363_0283753 Ga0436363_0283753_869_1654 255
305 3300039453 Ga0436362_0167044 Ga0436362_0167044_359_1126 255
306 3300041997 Ga0439431_0067125 Ga0439431_0067125_137_904 255
307 3300042001 Ga0439441_037950 Ga0439441_037950_129_896 255
308 3300042436 Ga0439435_0002498 Ga0439435_0002498_2221_2988 255
309 3300042439 Ga0439464_0032904 Ga0439464_0032904_168_935 255
310 3300042461 Ga0439460_0006852 Ga0439460_0006852_1120_1887 255
311 3300042993 Ga0439440_0065393 Ga0439440_0065393_120_887 255
312 3300044684 Ga0466966_0346953 Ga0466966_0346953_91_858 255
313 3300044694 Ga0466963_0024101 Ga0466963_0024101_2225_3025 255
314 3300045049 Ga0466959_0068340 Ga0466959_0068340_1230_1997 255
315 3300045976 Ga0466967_0031475 Ga0466967_0031475_125_925 255
316 3300045976 Ga0466967_0497178 Ga0466967_0497178_349_1116 255
317 3300046452 Ga0495617_020023 Ga0495617_020023_1259_2026 255
318 3300046454 Ga0495592_0010417 Ga0495592_0010417_2627_3394 255
319 3300046454 Ga0495592_0066586 Ga0495592_0066586_1578_2345 255
320 3300046455 Ga0495603_0000189 Ga0495603_0000189_28473_29240 255
321 3300046455 Ga0495603_0182267 Ga0495603_0182267_381_1148 255
322 3300046458 Ga0495591_024325 Ga0495591_024325_1054_1821 255
323 3300046459 Ga0495629_0000268 Ga0495629_0000268_26497_27264 255
324 3300046459 Ga0495629_0339572 Ga0495629_0339572_74_841 255
325 3300046460 Ga0495638_0111733 Ga0495638_0111733_818_1585 255
326 3300046461 Ga0495641_0004507 Ga0495641_0004507_5243_6010 255
327 3300046461 Ga0495641_0007758 Ga0495641_0007758_2849_3616 255
328 3300046472 Ga0495580_0000772 Ga0495580_0000772_19478_20245 255
329 3300046472 Ga0495580_0008443 Ga0495580_0008443_1055_1822 255
330 3300046472 Ga0495580_0021834 Ga0495580_0021834_3365_4132 255
331 3300046473 Ga0495582_0000144 Ga0495582_0000144_26677_27444 255
332 3300046473 Ga0495582_0082031 Ga0495582_0082031_74_841 255
333 3300046475 Ga0495639_0000067 Ga0495639_0000067_18693_19460 255
334 3300046476 Ga0495662_0019742 Ga0495662_0019742_653_1420 255
335 3300046476 Ga0495662_0034507 Ga0495662_0034507_1212_1979 255
336 3300046477 Ga0495664_0023218 Ga0495664_0023218_951_1718 255
337 3300046491 Ga0495584_0028442 Ga0495584_0028442_625_1395 255
338 3300046491 Ga0495584_0065023 Ga0495584_0065023_687_1454 255
339 3300046491 Ga0495584_0144946 Ga0495584_0144946_400_1167 255
340 3300046492 Ga0495585_0004225 Ga0495585_0004225_6042_6809 255
341 3300046499 Ga0495594_0000102 Ga0495594_0000102_18045_18812 255
342 3300046501 Ga0495607_0005594 Ga0495607_0005594_3565_4332 255
343 3300046501 Ga0495607_0173408 Ga0495607_0173408_156_923 255
344 3300046506 Ga0495583_0103291 Ga0495583_0103291_352_1119 255
345 3300046511 Ga0495608_0021002 Ga0495608_0021002_2829_3596 255
346 3300046511 Ga0495608_0070124 Ga0495608_0070124_70_840 255
347 3300046513 Ga0495616_0090058 Ga0495616_0090058_593_1360 255
348 3300046514 Ga0495618_0168803 Ga0495618_0168803_372_1139 255
349 3300046514 Ga0495618_0172727 Ga0495618_0172727_208_975 255
350 3300046516 Ga0495628_0028272 Ga0495628_0028272_1671_2438 255
351 3300046517 Ga0495630_0018756 Ga0495630_0018756_2027_2794 255
352 3300046517 Ga0495630_0070155 Ga0495630_0070155_658_1425 255
353 3300046517 Ga0495630_0097623 Ga0495630_0097623_219_986 255
354 3300046518 Ga0495631_0018028 Ga0495631_0018028_2459_3226 255
355 3300046520 Ga0495637_0064316 Ga0495637_0064316_404_1171 255
356 3300046523 Ga0495644_0000306 Ga0495644_0000306_11509_12276 255
357 3300046525 Ga0495663_0023455 Ga0495663_0023455_482_1249 255
358 3300046525 Ga0495663_0044559 Ga0495663_0044559_222_989 255
359 3300046526 Ga0495666_0039515 Ga0495666_0039515_623_1390 255
360 3300046529 Ga0495652_0013648 Ga0495652_0013648_3267_4034 255
361 3300046529 Ga0495652_0058875 Ga0495652_0058875_625_1392 255
362 3300046530 Ga0495654_0038735 Ga0495654_0038735_411_1178 255
363 3300046531 Ga0495665_0000355 Ga0495665_0000355_3716_4483 255
364 3300046531 Ga0495665_0008953 Ga0495665_0008953_1212_1979 255
365 3300046533 Ga0495640_0004592 Ga0495640_0004592_7567_8334 255
366 3300046533 Ga0495640_0076662 Ga0495640_0076662_341_1108 255
367 3300046535 Ga0495586_0027068 Ga0495586_0027068_690_1457 255
368 3300046536 Ga0495587_0044390 Ga0495587_0044390_1321_2088 255
369 3300046536 Ga0495587_0071699 Ga0495587_0071699_297_1064 255
370 3300046537 Ga0495598_0002396 Ga0495598_0002396_2497_3264 255
371 3300046538 Ga0495609_0046901 Ga0495609_0046901_802_1569 255
372 3300046539 Ga0495621_0136638 Ga0495621_0136638_82_849 255
373 3300046557 Ga0495622_0000649 Ga0495622_0000649_2461_3228 255
374 3300046557 Ga0495622_0004842 Ga0495622_0004842_2633_3400 255
375 3300046558 Ga0495633_0001183 Ga0495633_0001183_8743_9510 255
376 3300046559 Ga0495667_0019434 Ga0495667_0019434_906_1673 255
377 3300046559 Ga0495667_0031521 Ga0495667_0031521_2323_3090 255
378 3300046615 Ga0495656_0000381 Ga0495656_0000381_12795_13562 255
379 3300046615 Ga0495656_0030222 Ga0495656_0030222_994_1761 255
380 3300046615 Ga0495656_0035348 Ga0495656_0035348_963_1730 255
381 3300046642 Ga0495634_0007987 Ga0495634_0007987_6808_7575 255
382 3300046642 Ga0495634_0020441 Ga0495634_0020441_1881_2648 255
383 3300046648 Ga0495611_0130417 Ga0495611_0130417_298_1065 255
384 3300046660 Ga0495625_0051874 Ga0495625_0051874_335_1102 255
385 3300046663 Ga0495635_0001955 Ga0495635_0001955_11516_12283 255
386 3300046663 Ga0495635_0198640 Ga0495635_0198640_248_1018 255
387 3300046664 Ga0495659_0000645 Ga0495659_0000645_11505_12272 255
388 3300046665 Ga0495661_0061995 Ga0495661_0061995_911_1678 255
389 3300046674 Ga0495588_0003103 Ga0495588_0003103_2455_3222 255
390 3300046674 Ga0495588_0190601 Ga0495588_0190601_250_1017 255
391 3300046675 Ga0495657_0074244 Ga0495657_0074244_594_1361 255
392 3300046678 Ga0495599_0017266 Ga0495599_0017266_3645_4412 255
393 3300046680 Ga0495646_0071068 Ga0495646_0071068_946_1713 255
394 3300046681 Ga0495647_0000151 Ga0495647_0000151_7726_8493 255
395 3300046683 Ga0495658_0000439 Ga0495658_0000439_6100_6867 255
396 3300046683 Ga0495658_0068462 Ga0495658_0068462_785_1552 255
397 3300046689 Ga0495613_0005413 Ga0495613_0005413_2277_3044 255
398 3300046689 Ga0495613_0030381 Ga0495613_0030381_2472_3239 255
399 3300046690 Ga0495624_0017115 Ga0495624_0017115_287_1054 255
400 3300046690 Ga0495624_0017221 Ga0495624_0017221_835_1602 255
401 3300046691 Ga0495670_0002108 Ga0495670_0002108_1426_2193 255
402 3300046691 Ga0495670_0004752 Ga0495670_0004752_3704_4471 255
403 3300046691 Ga0495670_0243679 Ga0495670_0243679_30_797 255
404 3300046809 Ga0495600_0006075 Ga0495600_0006075_5676_6443 255
405 3300046809 Ga0495600_0096349 Ga0495600_0096349_972_1739 255
406 3300046810 Ga0495660_0050946 Ga0495660_0050946_507_1274 255
407 3300047315 Ga0495581_0000084 Ga0495581_0000084_16451_17218 255
408 3300047315 Ga0495581_0004621 Ga0495581_0004621_6198_6965 255
409 3300047317 Ga0495604_0042976 Ga0495604_0042976_2590_3357 255
410 3300047319 Ga0495674_0006112 Ga0495674_0006112_5934_6701 255
411 3300047319 Ga0495674_0085063 Ga0495674_0085063_762_1529 255
412 3300047320 Ga0495672_0004345 Ga0495672_0004345_8659_9426 255
413 3300047320 Ga0495672_0090625 Ga0495672_0090625_704_1477 255
414 3300047321 Ga0495676_0015887 Ga0495676_0015887_1562_2329 255
415 3300047322 Ga0495680_0083655 Ga0495680_0083655_654_1421 255
416 3300047322 Ga0495680_0237797 Ga0495680_0237797_152_919 255
417 3300047322 Ga0495680_0272446 Ga0495680_0272446_105_872 255
418 3300047445 Ga0495677_0074512 Ga0495677_0074512_455_1222 255
419 3300047471 Ga0495684_0015749 Ga0495684_0015749_185_952 255
420 3300047471 Ga0495684_0035512 Ga0495684_0035512_1957_2724 255
421 3300047673 Ga0495593_0000038 Ga0495593_0000038_22073_22840 255
422 3300047673 Ga0495593_0077949 Ga0495593_0077949_807_1574 255
423 3300048089 Ga0495614_0015458 Ga0495614_0015458_241_1008 255
424 3300048090 Ga0495615_0016157 Ga0495615_0016157_802_1569 255
425 3300048907 Ga0496104_0552897 Ga0496104_0552897_133_900 255
426 3300048915 Ga0496112_0006551 Ga0496112_0006551_353_1120 255
427 3300048916 Ga0496113_0110517 Ga0496113_0110517_1174_1941 255
428 3300048918 Ga0496115_0361911 Ga0496115_0361911_64_831 255
429 3300048918 Ga0496115_0486533 Ga0496115_0486533_187_954 255
430 3300048919 Ga0496116_0008716 Ga0496116_0008716_2139_2906 255
431 3300048919 Ga0496116_0212171 Ga0496116_0212171_164_931 255
432 3300048920 Ga0496117_0087125 Ga0496117_0087125_633_1400 255
433 3300048920 Ga0496117_0099447 Ga0496117_0099447_671_1438 255
434 3300048921 Ga0496118_0073400 Ga0496118_0073400_1061_1828 255
435 3300048922 Ga0496119_0069436 Ga0496119_0069436_271_1038 255
436 3300048924 Ga0496121_0002503 Ga0496121_0002503_12127_12894 255
437 3300048924 Ga0496121_0194751 Ga0496121_0194751_222_989 255
438 3300048924 Ga0496121_0252132 Ga0496121_0252132_172_939 255
439 3300048925 Ga0496122_0196476 Ga0496122_0196476_19_786 255
440 3300048927 Ga0496124_0144580 Ga0496124_0144580_806_1573 255
441 3300048927 Ga0496124_0190826 Ga0496124_0190826_757_1524 255
442 3300048927 Ga0496124_0351667 Ga0496124_0351667_135_902 255
443 3300048928 Ga0496125_0021733 Ga0496125_0021733_4087_4854 255
444 3300048928 Ga0496125_0139266 Ga0496125_0139266_198_965 255
445 3300049570 Ga0501033_0069428 Ga0501033_0069428_407_1174 255
446 3300049571 Ga0501034_0061846 Ga0501034_0061846_455_1225 255
447 3300049571 Ga0501034_0227180 Ga0501034_0227180_774_1541 255
448 3300049572 Ga0501036_0256230 Ga0501036_0256230_53_820 255
449 3300049574 Ga0501038_0030866 Ga0501038_0030866_1019_1786 255
450 3300049574 Ga0501038_0143221 Ga0501038_0143221_1176_1943 255
451 3300049577 Ga0501041_0110127 Ga0501041_0110127_133_903 255
452 3300049579 Ga0501043_0015355 Ga0501043_0015355_600_1370 255
453 3300049579 Ga0501043_0364439 Ga0501043_0364439_311_1078 255
454 3300049581 Ga0501047_0057292 Ga0501047_0057292_1236_2003 255
455 3300049582 Ga0501048_0160356 Ga0501048_0160356_118_885 255
456 3300049584 Ga0501068_0016013 Ga0501068_0016013_2914_3684 255
457 3300049585 Ga0501069_0005696 Ga0501069_0005696_4411_5181 255
458 3300049586 Ga0501070_0014884 Ga0501070_0014884_4394_5164 255
459 3300049586 Ga0501070_0070613 Ga0501070_0070613_1755_2525 255
460 3300049586 Ga0501070_0146650 Ga0501070_0146650_452_1219 255
461 3300049588 Ga0501072_0095655 Ga0501072_0095655_1095_1862 255
462 3300049590 Ga0501074_0082975 Ga0501074_0082975_631_1401 255
463 3300049591 Ga0501075_0002331 Ga0501075_0002331_2027_2797 255
464 3300049592 Ga0501076_0194754 Ga0501076_0194754_104_874 255
465 3300049742 Ga0501080_0016494 Ga0501080_0016494_104_874 255
466 3300049742 Ga0501080_0089509 Ga0501080_0089509_197_967 255
467 3300049744 Ga0501083_0070803 Ga0501083_0070803_1443_2210 255
468 3300049822 Ga0501035_0000371 Ga0501035_0000371_18275_19045 255
469 3300049822 Ga0501035_0016438 Ga0501035_0016438_660_1427 255
470 3300049823 Ga0501044_0332332 Ga0501044_0332332_160_927 255
471 3300049824 Ga0501045_0046031 Ga0501045_0046031_56_826 255
472 3300050489 nmdc:mga03683_4846_c1 nmdc:mga03683_4846_c1_839_1714 255
473 3300050490 nmdc:mga03n38_216561_c1 nmdc:mga03n38_216561_c1_154_921 255
474 3300050490 nmdc:mga03n38_47996_c1 nmdc:mga03n38_47996_c1_1075_1851 255
475 3300050491 nmdc:mga00v17_6965_c1 nmdc:mga00v17_6965_c1_3761_4636 255
476 3300050492 nmdc:mga0yw44_410015_c1 nmdc:mga0yw44_410015_c1_71_838 255
477 3300050492 nmdc:mga0yw44_910_c1 nmdc:mga0yw44_910_c1_1072_1947 255
478 3300050493 nmdc:mga0k408_28781_c1 nmdc:mga0k408_28781_c1_112_879 255
479 3300050493 nmdc:mga0k408_356141_c1 nmdc:mga0k408_356141_c1_69_836 255
480 3300050494 nmdc:mga06z11_238710_c1 nmdc:mga06z11_238710_c1_23_790 255
481 3300050494 nmdc:mga06z11_242058_c1 nmdc:mga06z11_242058_c1_243_1010 255
482 3300050494 nmdc:mga06z11_3342_c1 nmdc:mga06z11_3342_c1_3715_4590 255
483 3300050496 nmdc:mga07m45_37324_c1 nmdc:mga07m45_37324_c1_740_1507 255
484 3300050496 nmdc:mga07m45_70557_c1 nmdc:mga07m45_70557_c1_63_830 255
485 3300050507 nmdc:mga05p37_52_c1 nmdc:mga05p37_52_c1_12257_13030 255
486 3300050508 nmdc:mga09592_5230_c1 nmdc:mga09592_5230_c1_3071_3844 255
487 3300050509 nmdc:mga0qj67_372400_c1 nmdc:mga0qj67_372400_c1_141_920 255
488 3300050510 nmdc:mga06r32_248_c1 nmdc:mga06r32_248_c1_21247_22020 255
489 3300050510 nmdc:mga06r32_430729_c1 nmdc:mga06r32_430729_c1_12_782 255
490 3300050511 nmdc:mga08y16_185_c1 nmdc:mga08y16_185_c1_37922_38695 255
491 3300050511 nmdc:mga08y16_585806_c1 nmdc:mga08y16_585806_c1_164_931 255
492 3300050512 nmdc:mga0n895_4095_c1 nmdc:mga0n895_4095_c1_1148_1915 255
493 3300050513 nmdc:mga0rr50_200384_c1 nmdc:mga0rr50_200384_c1_442_1209 255
494 3300050514 nmdc:mga08x19_52610_c1 nmdc:mga08x19_52610_c1_473_1240 255
495 3300053077 Ga0495601_0000722 Ga0495601_0000722_6927_7694 255
496 3300053077 Ga0495601_0030306 Ga0495601_0030306_2347_3114 255
497 3300053084 Ga0495595_0008051 Ga0495595_0008051_3198_3965 255
498 3300053085 Ga0495619_0005352 Ga0495619_0005352_7176_7943 255
499 3300053085 Ga0495619_0050948 Ga0495619_0050948_270_1037 255
500 3300053085 Ga0495619_0147529 Ga0495619_0147529_136_903 255
501 3300053087 Ga0500643_016829 Ga0500643_016829_1073_1840 255
502 3300053087 Ga0500643_039956 Ga0500643_039956_114_881 255
503 3300053092 Ga0500583_0083250 Ga0500583_0083250_282_1049 255
504 3300053093 Ga0500651_0077567 Ga0500651_0077567_652_1419 255
505 3300053093 Ga0500651_0080518 Ga0500651_0080518_1047_1814 255
506 3300053093 Ga0500651_0083360 Ga0500651_0083360_546_1313 255
507 3300053094 Ga0500566_0000629 Ga0500566_0000629_11426_12193 255
508 3300053096 Ga0500641_0014121 Ga0500641_0014121_709_1476 255
509 3300053096 Ga0500641_0017753 Ga0500641_0017753_561_1328 255
510 3300053098 Ga0500650_0048591 Ga0500650_0048591_1099_1866 255
511 3300053104 Ga0500556_0000012 Ga0500556_0000012_165106_165873 255
512 3300053117 Ga0500593_018097 Ga0500593_018097_2256_3023 255
513 3300053121 Ga0500607_140331 Ga0500607_140331_264_1031 255
514 3300053122 Ga0500608_095040 Ga0500608_095040_98_865 255
515 3300053130 Ga0500642_0000055 Ga0500642_0000055_11702_12469 255
516 3300053131 Ga0500652_001690 Ga0500652_001690_3779_4546 255
517 3300053136 Ga0500559_0000615 Ga0500559_0000615_18512_19279 255
518 3300053136 Ga0500559_0069306 Ga0500559_0069306_796_1563 255
519 3300053139 Ga0500568_0000386 Ga0500568_0000386_12179_12946 255
520 3300053140 Ga0500573_0237605 Ga0500573_0237605_170_937 255
521 3300053145 Ga0500586_000275 Ga0500586_000275_1823_2590 255
522 3300053151 Ga0500604_0000814 Ga0500604_0000814_4699_5466 255
523 3300053153 Ga0500616_0000001 Ga0500616_0000001_896838_897605 255
524 3300053153 Ga0500616_0000035 Ga0500616_0000035_219186_219953 255
525 3300053153 Ga0500616_0000038 Ga0500616_0000038_136654_137421 255
526 3300053156 Ga0500622_0000885 Ga0500622_0000885_1307_2074 255
527 3300053177 Ga0500636_0016619 Ga0500636_0016619_2239_3006 255
528 3300053730 Ga0500645_000592 Ga0500645_000592_6525_7292 255
529 3300053730 Ga0500645_024050 Ga0500645_024050_935_1702 255
530 3300060353 Ga0501082_0150136 Ga0501082_0150136_336_1115 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16123

HAGH_C

Hydroxyacylglutathione hydrolase C-terminus

208

291

0.96

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

49

207

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xm8-assembly2.cif.gz_B x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 0.9758 4 255
1xm8-assembly2.cif.gz_B x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 0.9645 4 255
8ewo-assembly2.cif.gz_B crystal structure of putative glyoxylase ii from pseudomonas aeruginosa 0.9527 3 255
6s0i-assembly1.cif.gz_A crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site 0.9515 4 255
1qh5-assembly1.cif.gz_B human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl)glutathione 0.9482 4 255
ID Description Score Start End Superfamily
af_I1MD49_73_326_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.979 4 255 3.60.15.10
af_I1MD49_73_326_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9677 4 255 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9592 4 255 3.60.15.10
af_O35952_50_309_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9446 4 255 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9444 4 255 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A420AU35-F1-model_v4 deleted 1.002 1 255
AF-J3HYY5-F1-model_v4 hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) 0.9973 139 255 GO:0016787
GO:0046872
AF-A0A380W4M2-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 0.9964 1 255 GO:0004416
GO:0019243
GO:0046872
AF-A0A380W4M2-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 0.9925 1 255 GO:0004416
GO:0019243
GO:0046872
AF-A0A831W259-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) 0.99 110 255 GO:0004416
GO:0019243
GO:0046872

Feature Viewer

pLDDT pTM Quality
97.51 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map