F459928
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 530 | 339 | 524 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10003113|Ga0075365_100031136 |
| Length | 291 |
| Sequence | MFHDCHAAGRLAALTPHFVALGDMLTYAFLEDGMTKMAAEIRIFPCLNDNYGYLIHDPATKATASIDAPEAAPVIKALEKEGWKLTDILVTHHHGDHVGGVAELKQKYNCRVIAPHDKAKAIADVDQRVKEGDTVKVGSLAARVLETPGHTLDHISYMFDGDKALFAADTLFSIGCGRVFEGNYPMMWDSLLKLRALPDDTRVYCGHEYTAANVKFALTIEPENAALKARAEEVAKQRAANQPTIPTLLGEEKKANVFLRADVPQVAANVGMSGKGAADVFGEIRERKNRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 2 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 3 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 4 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 5 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 67 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 68 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 149 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 156 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 157 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 169 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 176 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 185 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 186 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 187 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 188 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 189 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 190 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 191 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 270 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 271 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 300 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 317 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 318 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 319 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 321 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 322 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 324 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 325 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 326 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 327 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 328 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 329 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 330 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 331 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 332 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 333 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 334 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 335 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 0.38 |
| Isolates | 1.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.7 |
| Nodule | 0 |
| Rhizoplane | 1.13 |
| Rhizosphere | 81.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065165_1033275 | 3300005262 | Bacteria | 1606 |
| 2 | Ga0070658_10075940 | 3300005327 | Bacteria | 2756 |
| 3 | Ga0070658_10360364 | 3300005327 | Bacteria | 1245 |
| 4 | Ga0070676_10022589 | 3300005328 | Bacteria | 3528 |
| 5 | Ga0070683_100020669 | 3300005329 | Bacteria | 5861 |
| 6 | Ga0070690_100312144 | 3300005330 | Bacteria | 1130 |
| 7 | Ga0070670_100284165 | 3300005331 | Bacteria | 1445 |
| 8 | Ga0070677_10002261 | 3300005333 | Bacteria | 6140 |
| 9 | Ga0068869_100706912 | 3300005334 | Bacteria | 860 |
| 10 | Ga0070666_10248860 | 3300005335 | Bacteria | 1258 |
| 11 | Ga0068868_100155670 | 3300005338 | Bacteria | 1885 |
| 12 | Ga0070661_100218783 | 3300005344 | Bacteria | 1460 |
| 13 | Ga0070669_100216329 | 3300005353 | Bacteria | 1513 |
| 14 | Ga0070675_100258455 | 3300005354 | Bacteria | 1525 |
| 15 | Ga0070675_100546229 | 3300005354 | Unclassified | 1047 |
| 16 | Ga0070674_100021623 | 3300005356 | Bacteria | 4135 |
| 17 | Ga0070673_100017637 | 3300005364 | Bacteria | 5082 |
| 18 | Ga0070667_100062304 | 3300005367 | Bacteria | 3159 |
| 19 | Ga0070667_100087427 | 3300005367 | Bacteria | 2675 |
| 20 | Ga0070709_10003001 | 3300005434 | Bacteria | 9085 |
| 21 | Ga0070709_10004073 | 3300005434 | Bacteria | 7888 |
| 22 | Ga0070713_100000768 | 3300005436 | Bacteria | 20535 |
| 23 | Ga0070713_100050097 | 3300005436 | Bacteria | 3448 |
| 24 | Ga0070710_10000783 | 3300005437 | Bacteria | 15215 |
| 25 | Ga0070710_10011138 | 3300005437 | Bacteria | 4436 |
| 26 | Ga0070711_100014561 | 3300005439 | Bacteria | 4955 |
| 27 | Ga0070711_100472494 | 3300005439 | Bacteria | 1029 |
| 28 | Ga0070694_100472071 | 3300005444 | Bacteria | 994 |
| 29 | Ga0070663_100544819 | 3300005455 | Bacteria | 969 |
| 30 | Ga0070678_100015675 | 3300005456 | Bacteria | 4824 |
| 31 | Ga0070681_10052200 | 3300005458 | Bacteria | 4078 |
| 32 | Ga0070681_10099564 | 3300005458 | Bacteria | 2852 |
| 33 | Ga0070681_10341409 | 3300005458 | Bacteria | 1407 |
| 34 | Ga0070679_100029863 | 3300005530 | Bacteria | 5379 |
| 35 | Ga0070679_100112332 | 3300005530 | Bacteria | 2710 |
| 36 | Ga0070684_100010288 | 3300005535 | Bacteria | 7406 |
| 37 | Ga0070684_100018435 | 3300005535 | Bacteria | 5750 |
| 38 | Ga0068853_100213968 | 3300005539 | Bacteria | 1758 |
| 39 | Ga0070672_100314516 | 3300005543 | Bacteria | 1330 |
| 40 | Ga0070686_100088863 | 3300005544 | Bacteria | 2063 |
| 41 | Ga0070695_100003309 | 3300005545 | Bacteria | 9420 |
| 42 | Ga0070693_100047172 | 3300005547 | Bacteria | 2450 |
| 43 | Ga0070665_100214894 | 3300005548 | Bacteria | 1924 |
| 44 | Ga0070665_100314562 | 3300005548 | Bacteria | 1570 |
| 45 | Ga0068855_100140528 | 3300005563 | Bacteria | 2753 |
| 46 | Ga0068855_101067411 | 3300005563 | Bacteria | 846 |
| 47 | Ga0068852_101091218 | 3300005616 | Unclassified | 818 |
| 48 | Ga0068864_100196374 | 3300005618 | Bacteria | 1852 |
| 49 | Ga0068861_100019252 | 3300005719 | Bacteria | 4877 |
| 50 | Ga0068860_100135759 | 3300005843 | Bacteria | 2362 |
| 51 | Ga0068862_100125823 | 3300005844 | Bacteria | 2263 |
| 52 | Ga0068862_100367396 | 3300005844 | Bacteria | 1338 |
| 53 | Ga0068862_100675343 | 3300005844 | Bacteria | 999 |
| 54 | Ga0081455_10117951 | 3300005937 | Bacteria | 2096 |
| 55 | Ga0081539_10000522 | 3300005985 | Bacteria | 79973 |
| 56 | Ga0081539_10048337 | 3300005985 | Bacteria | 2420 |
| 57 | Ga0070717_10075333 | 3300006028 | Bacteria | 2822 |
| 58 | Ga0075365_10003113 | 3300006038 | Bacteria | 8439 |
| 59 | Ga0075365_10186131 | 3300006038 | Bacteria | 1452 |
| 60 | Ga0075368_10039067 | 3300006042 | Bacteria | 1859 |
| 61 | Ga0075363_100006649 | 3300006048 | Bacteria | 5269 |
| 62 | Ga0075364_10027819 | 3300006051 | Bacteria | 3615 |
| 63 | Ga0075364_10028155 | 3300006051 | Bacteria | 3596 |
| 64 | Ga0070715_10000865 | 3300006163 | Bacteria | 8356 |
| 65 | Ga0070716_100001482 | 3300006173 | Bacteria | 10479 |
| 66 | Ga0070716_100053489 | 3300006173 | Bacteria | 2302 |
| 67 | Ga0070712_100217066 | 3300006175 | Bacteria | 1512 |
| 68 | Ga0075362_10010464 | 3300006177 | Bacteria | 3622 |
| 69 | Ga0075362_10013395 | 3300006177 | Bacteria | 3284 |
| 70 | Ga0075367_10005803 | 3300006178 | Bacteria | 6177 |
| 71 | Ga0075367_10039032 | 3300006178 | Bacteria | 2767 |
| 72 | Ga0075367_10144434 | 3300006178 | Bacteria | 1475 |
| 73 | Ga0075366_10033238 | 3300006195 | Bacteria | 3038 |
| 74 | Ga0075366_10214704 | 3300006195 | Bacteria | 1171 |
| 75 | Ga0075370_10006281 | 3300006353 | Bacteria | 5966 |
| 76 | Ga0075370_10019630 | 3300006353 | Bacteria | 3683 |
| 77 | Ga0068871_100057891 | 3300006358 | Bacteria | 3154 |
| 78 | Ga0068871_100330713 | 3300006358 | Unclassified | 1344 |
| 79 | Ga0075428_100002387 | 3300006844 | Bacteria | 20393 |
| 80 | Ga0075428_100299541 | 3300006844 | Bacteria | 1729 |
| 81 | Ga0075430_100023729 | 3300006846 | Bacteria | 5224 |
| 82 | Ga0075431_100000881 | 3300006847 | Bacteria | 26399 |
| 83 | Ga0075431_100391755 | 3300006847 | Unclassified | 1391 |
| 84 | Ga0075433_10345521 | 3300006852 | Bacteria | 1315 |
| 85 | Ga0075434_100005953 | 3300006871 | Bacteria | 11160 |
| 86 | Ga0075434_100820864 | 3300006871 | Bacteria | 946 |
| 87 | Ga0068865_100187046 | 3300006881 | Bacteria | 1599 |
| 88 | Ga0075436_100217875 | 3300006914 | Bacteria | 1354 |
| 89 | Ga0099794_10012605 | 3300007265 | Bacteria | 3654 |
| 90 | Ga0099794_10015075 | 3300007265 | Bacteria | 3404 |
| 91 | Ga0099794_10017446 | 3300007265 | Bacteria | 3200 |
| 92 | Ga0099795_10006176 | 3300007788 | Bacteria | 3249 |
| 93 | Ga0105250_10063529 | 3300009092 | Bacteria | 1486 |
| 94 | Ga0111539_10000144 | 3300009094 | Bacteria | 81842 |
| 95 | Ga0111539_10253827 | 3300009094 | Bacteria | 2048 |
| 96 | Ga0111539_10518624 | 3300009094 | Unclassified | 1388 |
| 97 | Ga0105245_10007083 | 3300009098 | Bacteria | 9838 |
| 98 | Ga0105247_10368322 | 3300009101 | Unclassified | 1015 |
| 99 | Ga0114129_10000542 | 3300009147 | Bacteria | 46285 |
| 100 | Ga0105241_10260035 | 3300009174 | Bacteria | 1475 |
| 101 | Ga0105242_10013985 | 3300009176 | Bacteria | 6209 |
| 102 | Ga0105242_10433484 | 3300009176 | Bacteria | 1235 |
| 103 | Ga0105248_10158178 | 3300009177 | Bacteria | 2557 |
| 104 | Ga0105237_10219030 | 3300009545 | Bacteria | 1904 |
| 105 | Ga0105238_10010498 | 3300009551 | Bacteria | 9296 |
| 106 | Ga0105238_10082580 | 3300009551 | Bacteria | 3203 |
| 107 | Ga0105238_10105024 | 3300009551 | Bacteria | 2806 |
| 108 | Ga0105238_10125835 | 3300009551 | Bacteria | 2541 |
| 109 | Ga0105238_10182831 | 3300009551 | Bacteria | 2073 |
| 110 | Ga0105238_10389472 | 3300009551 | Bacteria | 1386 |
| 111 | Ga0099796_10015537 | 3300010159 | Bacteria | 2227 |
| 112 | Ga0099796_10020826 | 3300010159 | Bacteria | 2010 |
| 113 | Ga0105239_10587026 | 3300010375 | Bacteria | 1270 |
| 114 | Ga0157373_10041341 | 3300013100 | Bacteria | 3298 |
| 115 | Ga0157371_10300657 | 3300013102 | Bacteria | 1162 |
| 116 | Ga0157370_10075072 | 3300013104 | Bacteria | 3188 |
| 117 | Ga0157370_10244627 | 3300013104 | Bacteria | 1660 |
| 118 | Ga0157369_10111758 | 3300013105 | Bacteria | 2904 |
| 119 | Ga0157369_10206877 | 3300013105 | Bacteria | 2058 |
| 120 | Ga0157369_10354799 | 3300013105 | Bacteria | 1523 |
| 121 | Ga0157378_10109266 | 3300013297 | Bacteria | 2533 |
| 122 | Ga0163162_10589735 | 3300013306 | Bacteria | 1238 |
| 123 | Ga0157375_10095149 | 3300013308 | Bacteria | 3049 |
| 124 | Ga0157380_10029987 | 3300014326 | Bacteria | 4162 |
| 125 | Ga0157380_10333297 | 3300014326 | Bacteria | 1412 |
| 126 | Ga0157379_10536620 | 3300014968 | Bacteria | 1087 |
| 127 | Ga0157376_10104898 | 3300014969 | Bacteria | 2478 |
| 128 | Ga0157376_10979362 | 3300014969 | Bacteria | 867 |
| 129 | Ga0163161_10134008 | 3300017792 | Bacteria | 1871 |
| 130 | Ga0213876_10008883 | 3300021384 | Bacteria | 5419 |
| 131 | Ga0224712_10014402 | 3300022467 | Bacteria | 2545 |
| 132 | Ga0209564_1000602 | 3300025295 | Bacteria | 56176 |
| 133 | Ga0209564_1008246 | 3300025295 | Bacteria | 5188 |
| 134 | Ga0207696_1020893 | 3300025711 | Bacteria | 2103 |
| 135 | Ga0207682_10001508 | 3300025893 | Bacteria | 10728 |
| 136 | Ga0207692_10001515 | 3300025898 | Bacteria | 8727 |
| 137 | Ga0207692_10006519 | 3300025898 | Bacteria | 4737 |
| 138 | Ga0207710_10249163 | 3300025900 | Unclassified | 888 |
| 139 | Ga0207688_10024392 | 3300025901 | Bacteria | 3316 |
| 140 | Ga0207680_10459582 | 3300025903 | Unclassified | 904 |
| 141 | Ga0207647_10033231 | 3300025904 | Bacteria | 3304 |
| 142 | Ga0207647_10085984 | 3300025904 | Bacteria | 1880 |
| 143 | Ga0207685_10007721 | 3300025905 | Bacteria | 3017 |
| 144 | Ga0207699_10000360 | 3300025906 | Bacteria | 24053 |
| 145 | Ga0207699_10010387 | 3300025906 | Bacteria | 4671 |
| 146 | Ga0207645_10018494 | 3300025907 | Bacteria | 4584 |
| 147 | Ga0207643_10047442 | 3300025908 | Bacteria | 2431 |
| 148 | Ga0207705_10271759 | 3300025909 | Bacteria | 1296 |
| 149 | Ga0207707_10030771 | 3300025912 | Bacteria | 4695 |
| 150 | Ga0207707_10095860 | 3300025912 | Bacteria | 2593 |
| 151 | Ga0207707_10097794 | 3300025912 | Bacteria | 2566 |
| 152 | Ga0207693_10000073 | 3300025915 | Bacteria | 89380 |
| 153 | Ga0207693_10015453 | 3300025915 | Bacteria | 6123 |
| 154 | Ga0207693_10211290 | 3300025915 | Bacteria | 1525 |
| 155 | Ga0207663_10000993 | 3300025916 | Bacteria | 12980 |
| 156 | Ga0207663_10012680 | 3300025916 | Bacteria | 4563 |
| 157 | Ga0207663_10159541 | 3300025916 | Bacteria | 1590 |
| 158 | Ga0207660_10259223 | 3300025917 | Bacteria | 1374 |
| 159 | Ga0207662_10035450 | 3300025918 | Bacteria | 2914 |
| 160 | Ga0207657_10006265 | 3300025919 | Bacteria | 12367 |
| 161 | Ga0207649_10152946 | 3300025920 | Bacteria | 1591 |
| 162 | Ga0207652_10186134 | 3300025921 | Bacteria | 1867 |
| 163 | Ga0207681_10047285 | 3300025923 | Bacteria | 2898 |
| 164 | Ga0207681_10150575 | 3300025923 | Bacteria | 1743 |
| 165 | Ga0207694_10022049 | 3300025924 | Bacteria | 4830 |
| 166 | Ga0207694_10084471 | 3300025924 | Bacteria | 2497 |
| 167 | Ga0207694_10099125 | 3300025924 | Bacteria | 2308 |
| 168 | Ga0207694_10587286 | 3300025924 | Bacteria | 936 |
| 169 | Ga0207650_10512369 | 3300025925 | Bacteria | 1003 |
| 170 | Ga0207659_10188062 | 3300025926 | Bacteria | 1641 |
| 171 | Ga0207687_10021525 | 3300025927 | Bacteria | 4285 |
| 172 | Ga0207687_10119203 | 3300025927 | Bacteria | 1971 |
| 173 | Ga0207700_10027298 | 3300025928 | Bacteria | 3996 |
| 174 | Ga0207700_10069970 | 3300025928 | Bacteria | 2696 |
| 175 | Ga0207664_10005740 | 3300025929 | Bacteria | 8491 |
| 176 | Ga0207664_10009377 | 3300025929 | Bacteria | 6866 |
| 177 | Ga0207664_10148940 | 3300025929 | Bacteria | 1987 |
| 178 | Ga0207664_10252593 | 3300025929 | Bacteria | 1539 |
| 179 | Ga0207644_10064574 | 3300025931 | Bacteria | 2660 |
| 180 | Ga0207690_10449047 | 3300025932 | Bacteria | 1036 |
| 181 | Ga0207706_10050316 | 3300025933 | Bacteria | 3682 |
| 182 | Ga0207706_10135615 | 3300025933 | Bacteria | 2165 |
| 183 | Ga0207709_10336730 | 3300025935 | Bacteria | 1134 |
| 184 | Ga0207669_10024599 | 3300025937 | Bacteria | 3239 |
| 185 | Ga0207704_10106925 | 3300025938 | Bacteria | 1881 |
| 186 | Ga0207665_10000316 | 3300025939 | Bacteria | 33366 |
| 187 | Ga0207665_10087039 | 3300025939 | Bacteria | 2159 |
| 188 | Ga0207691_10016907 | 3300025940 | Bacteria | 6921 |
| 189 | Ga0207711_10355527 | 3300025941 | Bacteria | 1357 |
| 190 | Ga0207689_10163465 | 3300025942 | Bacteria | 1834 |
| 191 | Ga0207661_10045556 | 3300025944 | Bacteria | 3472 |
| 192 | Ga0207679_10049052 | 3300025945 | Bacteria | 3078 |
| 193 | Ga0207667_10204481 | 3300025949 | Bacteria | 2025 |
| 194 | Ga0207667_10765477 | 3300025949 | Bacteria | 964 |
| 195 | Ga0207658_10101350 | 3300025986 | Bacteria | 2256 |
| 196 | Ga0207658_10171871 | 3300025986 | Bacteria | 1786 |
| 197 | Ga0207658_10506975 | 3300025986 | Bacteria | 1075 |
| 198 | Ga0207677_10526178 | 3300026023 | Bacteria | 1026 |
| 199 | Ga0207639_10198293 | 3300026041 | Bacteria | 1720 |
| 200 | Ga0207678_10070849 | 3300026067 | Bacteria | 2989 |
| 201 | Ga0207708_10202282 | 3300026075 | Bacteria | 1585 |
| 202 | Ga0207708_10314941 | 3300026075 | Unclassified | 1276 |
| 203 | Ga0207648_10208975 | 3300026089 | Bacteria | 1732 |
| 204 | Ga0207676_10167633 | 3300026095 | Bacteria | 1910 |
| 205 | Ga0207676_10421070 | 3300026095 | Bacteria | 1252 |
| 206 | Ga0207674_10141706 | 3300026116 | Bacteria | 2363 |
| 207 | Ga0207674_10159098 | 3300026116 | Bacteria | 2213 |
| 208 | Ga0207675_100053662 | 3300026118 | Bacteria | 3761 |
| 209 | Ga0207675_100367134 | 3300026118 | Bacteria | 1413 |
| 210 | Ga0207683_10014358 | 3300026121 | Bacteria | 6747 |
| 211 | Ga0209179_1001650 | 3300027512 | Bacteria | 2812 |
| 212 | Ga0209179_1002729 | 3300027512 | Bacteria | 2435 |
| 213 | Ga0207428_10013852 | 3300027907 | Bacteria | 7025 |
| 214 | Ga0207428_10192868 | 3300027907 | Bacteria | 1535 |
| 215 | Ga0265354_1002438 | 3300028016 | Bacteria | 2298 |
| 216 | Ga0268266_10398071 | 3300028379 | Bacteria | 1302 |
| 217 | Ga0268266_10758239 | 3300028379 | Bacteria | 937 |
| 218 | Ga0307515_10131554 | 3300028794 | Bacteria | 2752 |
| 219 | Ga0265770_1000659 | 3300030878 | Bacteria | 4800 |
| 220 | Ga0265330_10051225 | 3300031235 | Bacteria | 1810 |
| 221 | Ga0265340_10173155 | 3300031247 | Bacteria | 977 |
| 222 | Ga0265339_10002564 | 3300031249 | Bacteria | 12958 |
| 223 | Ga0265339_10045967 | 3300031249 | Bacteria | 2401 |
| 224 | Ga0265316_10143685 | 3300031344 | Bacteria | 1791 |
| 225 | Ga0265316_10185828 | 3300031344 | Bacteria | 1546 |
| 226 | Ga0307408_100229136 | 3300031548 | Bacteria | 1520 |
| 227 | Ga0307408_100230098 | 3300031548 | Bacteria | 1518 |
| 228 | Ga0307516_10000012 | 3300031730 | Bacteria | 224120 |
| 229 | Ga0373958_0018676 | 3300034819 | Bacteria | 1260 |
| 230 | Ga0373928_0057160 | 3300035084 | Bacteria | 935 |
| 231 | Ga0373934_0022274 | 3300035086 | Bacteria | 2444 |
| 232 | Ga0373934_0145869 | 3300035086 | Bacteria | 968 |
| 233 | Ga0373940_0036666 | 3300035088 | Bacteria | 1332 |
| 234 | Ga0373944_0001048 | 3300035089 | Bacteria | 6825 |
| 235 | Ga0373923_0090388 | 3300035111 | Bacteria | 1339 |
| 236 | Ga0373923_0132978 | 3300035111 | Bacteria | 1119 |
| 237 | Ga0373936_0026976 | 3300035113 | Bacteria | 2252 |
| 238 | Ga0373936_0119287 | 3300035113 | Bacteria | 1125 |
| 239 | Ga0373941_0006278 | 3300035115 | Bacteria | 2854 |
| 240 | Ga0373945_0009707 | 3300035116 | Bacteria | 3157 |
| 241 | Ga0373953_0146930 | 3300035117 | Bacteria | 1010 |
| 242 | Ga0373954_0002232 | 3300035118 | Bacteria | 8051 |
| 243 | Ga0373954_0004821 | 3300035118 | Bacteria | 5815 |
| 244 | Ga0373956_0008976 | 3300035119 | Bacteria | 4054 |
| 245 | Ga0373956_0065477 | 3300035119 | Bacteria | 1651 |
| 246 | Ga0373956_0146663 | 3300035119 | Bacteria | 1109 |
| 247 | Ga0373957_0033723 | 3300035120 | Bacteria | 1892 |
| 248 | Ga0373943_0015761 | 3300035170 | Bacteria | 3437 |
| 249 | Ga0373946_0001892 | 3300035171 | Bacteria | 7302 |
| 250 | Ga0373946_0002159 | 3300035171 | Bacteria | 6904 |
| 251 | Ga0373955_0009700 | 3300035172 | Bacteria | 4521 |
| 252 | Ga0373955_0039994 | 3300035172 | Bacteria | 2506 |
| 253 | Ga0373955_0062323 | 3300035172 | Bacteria | 2062 |
| 254 | Ga0373955_0079459 | 3300035172 | Bacteria | 1850 |
| 255 | Ga0373924_0009556 | 3300035410 | Bacteria | 3557 |
| 256 | Ga0373924_0112709 | 3300035410 | Bacteria | 1176 |
| 257 | Ga0373924_0210233 | 3300035410 | Bacteria | 859 |
| 258 | Ga0373931_0002980 | 3300035691 | Bacteria | 7564 |
| 259 | Ga0373935_0000434 | 3300035692 | Bacteria | 21781 |
| 260 | Ga0373935_0191260 | 3300035692 | Bacteria | 1410 |
| 261 | Ga0373927_0000645 | 3300035695 | Bacteria | 26401 |
| 262 | Ga0373933_0002533 | 3300035724 | Bacteria | 10248 |
| 263 | Ga0373933_0014674 | 3300035724 | Bacteria | 4362 |
| 264 | Ga0373933_0046084 | 3300035724 | Bacteria | 2588 |
| 265 | Ga0373947_0002079 | 3300035725 | Bacteria | 12221 |
| 266 | Ga0373947_0025229 | 3300035725 | Bacteria | 3466 |
| 267 | Ga0373947_0122293 | 3300035725 | Bacteria | 1654 |
| 268 | Ga0373947_0412320 | 3300035725 | Bacteria | 912 |
| 269 | Ga0373937_0013989 | 3300036401 | Bacteria | 7075 |
| 270 | Ga0373937_0280473 | 3300036401 | Bacteria | 1573 |
| 271 | Ga0373937_1078782 | 3300036401 | Bacteria | 752 |
| 272 | Ga0373925_0006318 | 3300037068 | Bacteria | 8730 |
| 273 | Ga0373925_0010149 | 3300037068 | Bacteria | 6837 |
| 274 | Ga0373925_0108432 | 3300037068 | Bacteria | 2143 |
| 275 | Ga0395899_0056987 | 3300037312 | Bacteria | 2886 |
| 276 | Ga0395900_0201339 | 3300037418 | Bacteria | 2014 |
| 277 | Ga0395901_0025191 | 3300038443 | Bacteria | 6107 |
| 278 | Ga0436365_0471606 | 3300039437 | Bacteria | 1971 |
| 279 | Ga0436365_0478771 | 3300039437 | Bacteria | 794 |
| 280 | Ga0436365_0861583 | 3300039437 | Bacteria | 3390 |
| 281 | Ga0436365_1639838 | 3300039437 | Bacteria | 14264 |
| 282 | Ga0436365_1832441 | 3300039437 | Bacteria | 2732 |
| 283 | Ga0436363_0283753 | 3300039450 | Bacteria | 1773 |
| 284 | Ga0436362_0167044 | 3300039453 | Bacteria | 1594 |
| 285 | Ga0439431_0067125 | 3300041997 | Bacteria | 951 |
| 286 | Ga0439441_037950 | 3300042001 | Bacteria | 956 |
| 287 | Ga0439435_0002498 | 3300042436 | Bacteria | 3667 |
| 288 | Ga0439464_0032904 | 3300042439 | Bacteria | 1458 |
| 289 | Ga0439460_0006852 | 3300042461 | Bacteria | 2838 |
| 290 | Ga0439440_0065393 | 3300042993 | Bacteria | 936 |
| 291 | Ga0466966_0346953 | 3300044684 | Bacteria | 892 |
| 292 | Ga0466963_0024101 | 3300044694 | Bacteria | 3872 |
| 293 | Ga0466959_0068340 | 3300045049 | Bacteria | 2575 |
| 294 | Ga0466967_0031475 | 3300045976 | Bacteria | 4466 |
| 295 | Ga0466967_0497178 | 3300045976 | Bacteria | 1196 |
| 296 | Ga0495617_020023 | 3300046452 | Bacteria | 2261 |
| 297 | Ga0495592_0010417 | 3300046454 | Bacteria | 7012 |
| 298 | Ga0495592_0066586 | 3300046454 | Bacteria | 2635 |
| 299 | Ga0495603_0000189 | 3300046455 | Bacteria | 32189 |
| 300 | Ga0495603_0182267 | 3300046455 | Bacteria | 1215 |
| 301 | Ga0495603_0224455 | 3300046455 | Bacteria | 1083 |
| 302 | Ga0495591_024325 | 3300046458 | Bacteria | 1922 |
| 303 | Ga0495629_0000268 | 3300046459 | Bacteria | 45291 |
| 304 | Ga0495629_0339572 | 3300046459 | Bacteria | 1025 |
| 305 | Ga0495638_0111733 | 3300046460 | Bacteria | 1622 |
| 306 | Ga0495641_0004507 | 3300046461 | Bacteria | 9809 |
| 307 | Ga0495641_0007758 | 3300046461 | Bacteria | 6647 |
| 308 | Ga0495580_0000772 | 3300046472 | Bacteria | 27573 |
| 309 | Ga0495580_0008443 | 3300046472 | Bacteria | 8194 |
| 310 | Ga0495580_0021834 | 3300046472 | Bacteria | 4721 |
| 311 | Ga0495582_0000144 | 3300046473 | Bacteria | 38436 |
| 312 | Ga0495582_0082031 | 3300046473 | Bacteria | 1791 |
| 313 | Ga0495639_0000067 | 3300046475 | Bacteria | 47932 |
| 314 | Ga0495662_0019742 | 3300046476 | Bacteria | 3260 |
| 315 | Ga0495662_0034507 | 3300046476 | Bacteria | 2441 |
| 316 | Ga0495664_0023218 | 3300046477 | Bacteria | 3598 |
| 317 | Ga0495584_0028442 | 3300046491 | Bacteria | 2833 |
| 318 | Ga0495584_0065023 | 3300046491 | Bacteria | 1834 |
| 319 | Ga0495584_0144946 | 3300046491 | Bacteria | 1206 |
| 320 | Ga0495585_0004225 | 3300046492 | Bacteria | 9369 |
| 321 | Ga0495594_0000102 | 3300046499 | Bacteria | 39784 |
| 322 | Ga0495607_0005594 | 3300046501 | Bacteria | 8963 |
| 323 | Ga0495607_0173408 | 3300046501 | Bacteria | 1087 |
| 324 | Ga0495583_0103291 | 3300046506 | Bacteria | 1214 |
| 325 | Ga0495608_0021002 | 3300046511 | Bacteria | 4485 |
| 326 | Ga0495608_0070124 | 3300046511 | Bacteria | 2288 |
| 327 | Ga0495616_0090058 | 3300046513 | Bacteria | 1454 |
| 328 | Ga0495618_0168803 | 3300046514 | Bacteria | 1393 |
| 329 | Ga0495618_0172727 | 3300046514 | Bacteria | 1375 |
| 330 | Ga0495628_0028272 | 3300046516 | Bacteria | 4557 |
| 331 | Ga0495630_0018756 | 3300046517 | Bacteria | 5083 |
| 332 | Ga0495630_0070155 | 3300046517 | Bacteria | 2636 |
| 333 | Ga0495630_0097623 | 3300046517 | Bacteria | 2222 |
| 334 | Ga0495631_0018028 | 3300046518 | Bacteria | 3330 |
| 335 | Ga0495637_0064316 | 3300046520 | Bacteria | 1496 |
| 336 | Ga0495644_0000306 | 3300046523 | Bacteria | 22634 |
| 337 | Ga0495663_0023455 | 3300046525 | Bacteria | 1787 |
| 338 | Ga0495663_0044559 | 3300046525 | Bacteria | 1358 |
| 339 | Ga0495666_0039515 | 3300046526 | Bacteria | 2290 |
| 340 | Ga0495652_0013648 | 3300046529 | Bacteria | 7311 |
| 341 | Ga0495652_0058875 | 3300046529 | Bacteria | 3252 |
| 342 | Ga0495654_0038735 | 3300046530 | Bacteria | 2382 |
| 343 | Ga0495665_0000355 | 3300046531 | Bacteria | 23262 |
| 344 | Ga0495665_0008953 | 3300046531 | Bacteria | 5431 |
| 345 | Ga0495640_0004592 | 3300046533 | Bacteria | 11016 |
| 346 | Ga0495640_0076662 | 3300046533 | Bacteria | 2230 |
| 347 | Ga0495586_0027068 | 3300046535 | Bacteria | 3068 |
| 348 | Ga0495586_0230464 | 3300046535 | Bacteria | 1054 |
| 349 | Ga0495587_0044390 | 3300046536 | Bacteria | 2644 |
| 350 | Ga0495587_0071699 | 3300046536 | Bacteria | 2014 |
| 351 | Ga0495598_0002396 | 3300046537 | Bacteria | 3869 |
| 352 | Ga0495609_0046901 | 3300046538 | Bacteria | 1935 |
| 353 | Ga0495621_0136638 | 3300046539 | Bacteria | 957 |
| 354 | Ga0495622_0000649 | 3300046557 | Bacteria | 19833 |
| 355 | Ga0495622_0004842 | 3300046557 | Bacteria | 6235 |
| 356 | Ga0495633_0001183 | 3300046558 | Bacteria | 20947 |
| 357 | Ga0495667_0019434 | 3300046559 | Bacteria | 4584 |
| 358 | Ga0495667_0031521 | 3300046559 | Bacteria | 3558 |
| 359 | Ga0495656_0000381 | 3300046615 | Bacteria | 14786 |
| 360 | Ga0495656_0030222 | 3300046615 | Bacteria | 2188 |
| 361 | Ga0495656_0035348 | 3300046615 | Bacteria | 2052 |
| 362 | Ga0495634_0007987 | 3300046642 | Bacteria | 7893 |
| 363 | Ga0495634_0020441 | 3300046642 | Bacteria | 4694 |
| 364 | Ga0495611_0130417 | 3300046648 | Bacteria | 1172 |
| 365 | Ga0495625_0051874 | 3300046660 | Bacteria | 2938 |
| 366 | Ga0495635_0001955 | 3300046663 | Bacteria | 14010 |
| 367 | Ga0495635_0198640 | 3300046663 | Bacteria | 1361 |
| 368 | Ga0495659_0000645 | 3300046664 | Bacteria | 12657 |
| 369 | Ga0495661_0061995 | 3300046665 | Bacteria | 2217 |
| 370 | Ga0495588_0003103 | 3300046674 | Bacteria | 7194 |
| 371 | Ga0495588_0190601 | 3300046674 | Bacteria | 1083 |
| 372 | Ga0495657_0074244 | 3300046675 | Bacteria | 2213 |
| 373 | Ga0495599_0017266 | 3300046678 | Bacteria | 4486 |
| 374 | Ga0495646_0071068 | 3300046680 | Bacteria | 2048 |
| 375 | Ga0495647_0000151 | 3300046681 | Bacteria | 17761 |
| 376 | Ga0495658_0000439 | 3300046683 | Bacteria | 23198 |
| 377 | Ga0495658_0068462 | 3300046683 | Bacteria | 2055 |
| 378 | Ga0495613_0005413 | 3300046689 | Bacteria | 9591 |
| 379 | Ga0495613_0030381 | 3300046689 | Bacteria | 4013 |
| 380 | Ga0495624_0017115 | 3300046690 | Bacteria | 4871 |
| 381 | Ga0495624_0017221 | 3300046690 | Bacteria | 4855 |
| 382 | Ga0495670_0002108 | 3300046691 | Bacteria | 9817 |
| 383 | Ga0495670_0004752 | 3300046691 | Bacteria | 6671 |
| 384 | Ga0495670_0243679 | 3300046691 | Bacteria | 957 |
| 385 | Ga0495600_0006075 | 3300046809 | Bacteria | 7316 |
| 386 | Ga0495600_0096349 | 3300046809 | Bacteria | 1929 |
| 387 | Ga0495660_0050946 | 3300046810 | Bacteria | 2254 |
| 388 | Ga0495581_0000084 | 3300047315 | Bacteria | 38216 |
| 389 | Ga0495581_0004621 | 3300047315 | Bacteria | 7951 |
| 390 | Ga0495604_0042976 | 3300047317 | Bacteria | 3540 |
| 391 | Ga0495674_0006112 | 3300047319 | Bacteria | 11563 |
| 392 | Ga0495674_0085063 | 3300047319 | Bacteria | 2709 |
| 393 | Ga0495672_0004345 | 3300047320 | Bacteria | 11663 |
| 394 | Ga0495672_0090625 | 3300047320 | Bacteria | 1680 |
| 395 | Ga0495676_0015887 | 3300047321 | Bacteria | 6690 |
| 396 | Ga0495680_0083655 | 3300047322 | Bacteria | 2406 |
| 397 | Ga0495680_0237797 | 3300047322 | Bacteria | 1294 |
| 398 | Ga0495680_0272446 | 3300047322 | Bacteria | 1195 |
| 399 | Ga0495677_0074512 | 3300047445 | Bacteria | 1267 |
| 400 | Ga0495684_0015749 | 3300047471 | Bacteria | 5818 |
| 401 | Ga0495684_0035512 | 3300047471 | Bacteria | 3823 |
| 402 | Ga0495686_0077375 | 3300047472 | Bacteria | 2037 |
| 403 | Ga0495593_0000038 | 3300047673 | Bacteria | 53141 |
| 404 | Ga0495593_0077949 | 3300047673 | Bacteria | 1716 |
| 405 | Ga0495614_0015458 | 3300048089 | Bacteria | 3327 |
| 406 | Ga0495615_0016157 | 3300048090 | Bacteria | 1605 |
| 407 | Ga0496104_0552897 | 3300048907 | Bacteria | 1062 |
| 408 | Ga0496112_0006551 | 3300048915 | Bacteria | 10247 |
| 409 | Ga0496113_0110517 | 3300048916 | Bacteria | 2139 |
| 410 | Ga0496115_0361911 | 3300048918 | Bacteria | 1182 |
| 411 | Ga0496115_0486533 | 3300048918 | Bacteria | 993 |
| 412 | Ga0496116_0008716 | 3300048919 | Bacteria | 8758 |
| 413 | Ga0496116_0212171 | 3300048919 | Bacteria | 1002 |
| 414 | Ga0496117_0087125 | 3300048920 | Bacteria | 2025 |
| 415 | Ga0496117_0099447 | 3300048920 | Bacteria | 1845 |
| 416 | Ga0496118_0073400 | 3300048921 | Bacteria | 2451 |
| 417 | Ga0496119_0069436 | 3300048922 | Bacteria | 2070 |
| 418 | Ga0496121_0002503 | 3300048924 | Bacteria | 27924 |
| 419 | Ga0496121_0194751 | 3300048924 | Bacteria | 1450 |
| 420 | Ga0496121_0252132 | 3300048924 | Bacteria | 1223 |
| 421 | Ga0496122_0082037 | 3300048925 | Bacteria | 2241 |
| 422 | Ga0496122_0196476 | 3300048925 | Bacteria | 1184 |
| 423 | Ga0496124_0144580 | 3300048927 | Bacteria | 1873 |
| 424 | Ga0496124_0190826 | 3300048927 | Bacteria | 1568 |
| 425 | Ga0496124_0351667 | 3300048927 | Bacteria | 1042 |
| 426 | Ga0496125_0021733 | 3300048928 | Bacteria | 5972 |
| 427 | Ga0496125_0139266 | 3300048928 | Bacteria | 1690 |
| 428 | Ga0501033_0069428 | 3300049570 | Bacteria | 2590 |
| 429 | Ga0501034_0061846 | 3300049571 | Bacteria | 3760 |
| 430 | Ga0501034_0227180 | 3300049571 | Bacteria | 1817 |
| 431 | Ga0501034_0235945 | 3300049571 | Bacteria | 1776 |
| 432 | Ga0501036_0256230 | 3300049572 | Bacteria | 1466 |
| 433 | Ga0501038_0030866 | 3300049574 | Bacteria | 4738 |
| 434 | Ga0501038_0143221 | 3300049574 | Bacteria | 1953 |
| 435 | Ga0501041_0110127 | 3300049577 | Bacteria | 1708 |
| 436 | Ga0501043_0015355 | 3300049579 | Bacteria | 5998 |
| 437 | Ga0501043_0364439 | 3300049579 | Bacteria | 1096 |
| 438 | Ga0501047_0003901 | 3300049581 | Bacteria | 14021 |
| 439 | Ga0501047_0057292 | 3300049581 | Bacteria | 3768 |
| 440 | Ga0501048_0160356 | 3300049582 | Bacteria | 1592 |
| 441 | Ga0501068_0016013 | 3300049584 | Bacteria | 4319 |
| 442 | Ga0501069_0005696 | 3300049585 | Bacteria | 6489 |
| 443 | Ga0501070_0014884 | 3300049586 | Bacteria | 6544 |
| 444 | Ga0501070_0070613 | 3300049586 | Bacteria | 2892 |
| 445 | Ga0501070_0146650 | 3300049586 | Bacteria | 1948 |
| 446 | Ga0501072_0095655 | 3300049588 | Bacteria | 2361 |
| 447 | Ga0501073_0027419 | 3300049589 | Bacteria | 4073 |
| 448 | Ga0501073_0320268 | 3300049589 | Bacteria | 1070 |
| 449 | Ga0501074_0082975 | 3300049590 | Bacteria | 2298 |
| 450 | Ga0501075_0002331 | 3300049591 | Bacteria | 12593 |
| 451 | Ga0501076_0194754 | 3300049592 | Bacteria | 1654 |
| 452 | Ga0501080_0016494 | 3300049742 | Bacteria | 6823 |
| 453 | Ga0501080_0025862 | 3300049742 | Bacteria | 5453 |
| 454 | Ga0501080_0089509 | 3300049742 | Bacteria | 2859 |
| 455 | Ga0501080_0099163 | 3300049742 | Bacteria | 2703 |
| 456 | Ga0501083_0070803 | 3300049744 | Bacteria | 2319 |
| 457 | Ga0501083_0314940 | 3300049744 | Bacteria | 1018 |
| 458 | Ga0501035_0000371 | 3300049822 | Bacteria | 51668 |
| 459 | Ga0501035_0016438 | 3300049822 | Bacteria | 6825 |
| 460 | Ga0501044_0332332 | 3300049823 | Bacteria | 1442 |
| 461 | Ga0501045_0046031 | 3300049824 | Bacteria | 3177 |
| 462 | nmdc:mga03683_4846_c1 | 3300050489 | Bacteria | 2940 |
| 463 | nmdc:mga03n38_216561_c1 | 3300050490 | Bacteria | 998 |
| 464 | nmdc:mga03n38_47996_c1 | 3300050490 | Bacteria | 1892 |
| 465 | nmdc:mga00v17_6965_c1 | 3300050491 | Bacteria | 6014 |
| 466 | nmdc:mga0yw44_410015_c1 | 3300050492 | Bacteria | 917 |
| 467 | nmdc:mga0yw44_910_c1 | 3300050492 | Bacteria | 11185 |
| 468 | nmdc:mga0k408_162614_c1 | 3300050493 | Bacteria | 1330 |
| 469 | nmdc:mga0k408_28781_c1 | 3300050493 | Bacteria | 3160 |
| 470 | nmdc:mga0k408_356141_c1 | 3300050493 | Bacteria | 872 |
| 471 | nmdc:mga06z11_238710_c1 | 3300050494 | Bacteria | 1067 |
| 472 | nmdc:mga06z11_242058_c1 | 3300050494 | Bacteria | 1060 |
| 473 | nmdc:mga06z11_3342_c1 | 3300050494 | Bacteria | 6211 |
| 474 | nmdc:mga06z11_57586_c1 | 3300050494 | Bacteria | 2014 |
| 475 | nmdc:mga07m45_37324_c1 | 3300050496 | Bacteria | 2710 |
| 476 | nmdc:mga07m45_70557_c1 | 3300050496 | Bacteria | 1987 |
| 477 | nmdc:mga05p37_52_c1 | 3300050507 | Bacteria | 102932 |
| 478 | nmdc:mga09592_5230_c1 | 3300050508 | Bacteria | 10547 |
| 479 | nmdc:mga0qj67_372400_c1 | 3300050509 | Bacteria | 1153 |
| 480 | nmdc:mga06r32_248_c1 | 3300050510 | Bacteria | 44402 |
| 481 | nmdc:mga06r32_430729_c1 | 3300050510 | Bacteria | 1300 |
| 482 | nmdc:mga08y16_185_c1 | 3300050511 | Bacteria | 55383 |
| 483 | nmdc:mga08y16_585806_c1 | 3300050511 | Bacteria | 1126 |
| 484 | nmdc:mga0n895_4095_c1 | 3300050512 | Bacteria | 11871 |
| 485 | nmdc:mga0n895_584706_c1 | 3300050512 | Bacteria | 1120 |
| 486 | nmdc:mga0rr50_200384_c1 | 3300050513 | Bacteria | 1640 |
| 487 | nmdc:mga08x19_52610_c1 | 3300050514 | Bacteria | 2619 |
| 488 | Ga0495601_0000722 | 3300053077 | Bacteria | 17751 |
| 489 | Ga0495601_0030306 | 3300053077 | Bacteria | 3358 |
| 490 | Ga0495595_0008051 | 3300053084 | Bacteria | 4320 |
| 491 | Ga0495619_0005352 | 3300053085 | Bacteria | 8127 |
| 492 | Ga0495619_0050948 | 3300053085 | Bacteria | 2734 |
| 493 | Ga0495619_0147529 | 3300053085 | Bacteria | 1622 |
| 494 | Ga0500643_016829 | 3300053087 | Bacteria | 2466 |
| 495 | Ga0500643_039956 | 3300053087 | Bacteria | 1383 |
| 496 | Ga0500583_0083250 | 3300053092 | Bacteria | 1548 |
| 497 | Ga0500651_0077567 | 3300053093 | Bacteria | 2062 |
| 498 | Ga0500651_0080518 | 3300053093 | Bacteria | 2017 |
| 499 | Ga0500651_0083360 | 3300053093 | Bacteria | 1978 |
| 500 | Ga0500566_0000629 | 3300053094 | Bacteria | 19693 |
| 501 | Ga0500641_0014121 | 3300053096 | Bacteria | 2943 |
| 502 | Ga0500641_0017753 | 3300053096 | Bacteria | 2667 |
| 503 | Ga0500650_0048591 | 3300053098 | Bacteria | 1967 |
| 504 | Ga0500556_0000012 | 3300053104 | Bacteria | 250391 |
| 505 | Ga0500593_018097 | 3300053117 | Bacteria | 3067 |
| 506 | Ga0500607_140331 | 3300053121 | Bacteria | 1137 |
| 507 | Ga0500608_095040 | 3300053122 | Bacteria | 1387 |
| 508 | Ga0500642_0000055 | 3300053130 | Bacteria | 68809 |
| 509 | Ga0500652_001690 | 3300053131 | Bacteria | 6687 |
| 510 | Ga0500559_0000615 | 3300053136 | Bacteria | 24153 |
| 511 | Ga0500559_0069306 | 3300053136 | Bacteria | 1586 |
| 512 | Ga0500568_0000386 | 3300053139 | Bacteria | 33695 |
| 513 | Ga0500573_0237605 | 3300053140 | Bacteria | 947 |
| 514 | Ga0500586_000275 | 3300053145 | Bacteria | 10313 |
| 515 | Ga0500604_0000814 | 3300053151 | Bacteria | 8588 |
| 516 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 517 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 518 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 519 | Ga0500622_0000885 | 3300053156 | Bacteria | 25488 |
| 520 | Ga0500636_0016619 | 3300053177 | Bacteria | 4339 |
| 521 | Ga0500645_000592 | 3300053730 | Bacteria | 23396 |
| 522 | Ga0500645_024050 | 3300053730 | Bacteria | 1864 |
| 523 | Ga0501084_0231663 | 3300054114 | Bacteria | 1559 |
| 524 | Ga0501082_0150136 | 3300060353 | Bacteria | 2024 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049744 | Ga0501083_0314940 | Ga0501083_0314940_38_799 | 223 |
| 2 | 3300031249 | Ga0265339_10045967 | Ga0265339_100459672 | 228 |
| 3 | 3300005439 | Ga0070711_100472494 | Ga0070711_1004724942 | 233 |
| 4 | 3300049742 | Ga0501080_0025862 | Ga0501080_0025862_325_1086 | 234 |
| 5 | 3300006871 | Ga0075434_100820864 | Ga0075434_1008208641 | 238 |
| 6 | 3300050512 | nmdc:mga0n895_584706_c1 | nmdc:mga0n895_584706_c1_231_956 | 238 |
| 7 | 3300035086 | Ga0373934_0145869 | Ga0373934_0145869_44_763 | 239 |
| 8 | 3300036401 | Ga0373937_1078782 | Ga0373937_1078782_18_737 | 239 |
| 9 | 3300046455 | Ga0495603_0224455 | Ga0495603_0224455_335_1054 | 239 |
| 10 | 3300047472 | Ga0495686_0077375 | Ga0495686_0077375_965_1711 | 246 |
| 11 | 3300039437 | Ga0436365_0478771 | Ga0436365_0478771_17_760 | 247 |
| 12 | 3300049742 | Ga0501080_0099163 | Ga0501080_0099163_519_1310 | 248 |
| 13 | 3300046535 | Ga0495586_0230464 | Ga0495586_0230464_292_1041 | 249 |
| 14 | 3300007788 | Ga0099795_10006176 | Ga0099795_100061762 | 250 |
| 15 | 3300010159 | Ga0099796_10015537 | Ga0099796_100155372 | 250 |
| 16 | 3300027512 | Ga0209179_1002729 | Ga0209179_10027292 | 250 |
| 17 | 3300028016 | Ga0265354_1002438 | Ga0265354_10024382 | 250 |
| 18 | 3300030878 | Ga0265770_1000659 | Ga0265770_10006591 | 250 |
| 19 | 3300031730 | Ga0307516_10000012 | Ga0307516_10000012116 | 250 |
| 20 | 3300039437 | Ga0436365_0471606 | Ga0436365_0471606_332_1123 | 250 |
| 21 | iso_pu_bacteria | 2602042107 | 2603857827 | 251 |
| 22 | iso_pu_bacteria | 2643221651 | 2644290730 | 251 |
| 23 | iso_pu_bacteria | 2857524615 | 2857527199 | 251 |
| 24 | iso_pu_bacteria | 2893066018 | 2893068022 | 251 |
| 25 | iso_pu_bacteria | 2919073203 | 2919078315 | 251 |
| 26 | iso_pu_bacteria | 8006984368 | 8006992433 | 251 |
| 27 | 3300005458 | Ga0070681_10052200 | Ga0070681_100522004 | 252 |
| 28 | 3300009551 | Ga0105238_10010498 | Ga0105238_1001049810 | 252 |
| 29 | 3300025912 | Ga0207707_10095860 | Ga0207707_100958604 | 252 |
| 30 | 3300025916 | Ga0207663_10159541 | Ga0207663_101595412 | 252 |
| 31 | 3300025924 | Ga0207694_10022049 | Ga0207694_100220494 | 252 |
| 32 | 3300031344 | Ga0265316_10143685 | Ga0265316_101436852 | 252 |
| 33 | 3300035111 | Ga0373923_0090388 | Ga0373923_0090388_252_1016 | 252 |
| 34 | 3300035692 | Ga0373935_0191260 | Ga0373935_0191260_297_1061 | 252 |
| 35 | 3300037068 | Ga0373925_0108432 | Ga0373925_0108432_941_1705 | 252 |
| 36 | 3300049571 | Ga0501034_0235945 | Ga0501034_0235945_535_1302 | 252 |
| 37 | 3300006042 | Ga0075368_10039067 | Ga0075368_100390672 | 253 |
| 38 | 3300006051 | Ga0075364_10028155 | Ga0075364_100281556 | 253 |
| 39 | 3300006195 | Ga0075366_10033238 | Ga0075366_100332383 | 253 |
| 40 | 3300006353 | Ga0075370_10006281 | Ga0075370_100062818 | 253 |
| 41 | 3300035725 | Ga0373947_0412320 | Ga0373947_0412320_21_800 | 253 |
| 42 | 3300049581 | Ga0501047_0003901 | Ga0501047_0003901_5706_6470 | 253 |
| 43 | 3300049589 | Ga0501073_0027419 | Ga0501073_0027419_3096_3857 | 253 |
| 44 | 3300049589 | Ga0501073_0320268 | Ga0501073_0320268_167_928 | 253 |
| 45 | 3300050493 | nmdc:mga0k408_162614_c1 | nmdc:mga0k408_162614_c1_389_1150 | 253 |
| 46 | 3300050494 | nmdc:mga06z11_57586_c1 | nmdc:mga06z11_57586_c1_718_1479 | 253 |
| 47 | 3300054114 | Ga0501084_0231663 | Ga0501084_0231663_205_1005 | 253 |
| 48 | 3300025915 | Ga0207693_10211290 | Ga0207693_102112901 | 254 |
| 49 | 3300048925 | Ga0496122_0082037 | Ga0496122_0082037_1331_2095 | 254 |
| 50 | 3300005262 | Ga0065165_1033275 | Ga0065165_10332752 | 255 |
| 51 | 3300005327 | Ga0070658_10075940 | Ga0070658_100759403 | 255 |
| 52 | 3300005327 | Ga0070658_10360364 | Ga0070658_103603642 | 255 |
| 53 | 3300005328 | Ga0070676_10022589 | Ga0070676_100225894 | 255 |
| 54 | 3300005329 | Ga0070683_100020669 | Ga0070683_1000206695 | 255 |
| 55 | 3300005330 | Ga0070690_100312144 | Ga0070690_1003121441 | 255 |
| 56 | 3300005331 | Ga0070670_100284165 | Ga0070670_1002841652 | 255 |
| 57 | 3300005333 | Ga0070677_10002261 | Ga0070677_100022614 | 255 |
| 58 | 3300005334 | Ga0068869_100706912 | Ga0068869_1007069121 | 255 |
| 59 | 3300005335 | Ga0070666_10248860 | Ga0070666_102488601 | 255 |
| 60 | 3300005338 | Ga0068868_100155670 | Ga0068868_1001556703 | 255 |
| 61 | 3300005344 | Ga0070661_100218783 | Ga0070661_1002187832 | 255 |
| 62 | 3300005353 | Ga0070669_100216329 | Ga0070669_1002163292 | 255 |
| 63 | 3300005354 | Ga0070675_100258455 | Ga0070675_1002584552 | 255 |
| 64 | 3300005354 | Ga0070675_100546229 | Ga0070675_1005462292 | 255 |
| 65 | 3300005356 | Ga0070674_100021623 | Ga0070674_1000216232 | 255 |
| 66 | 3300005364 | Ga0070673_100017637 | Ga0070673_1000176372 | 255 |
| 67 | 3300005367 | Ga0070667_100062304 | Ga0070667_1000623043 | 255 |
| 68 | 3300005367 | Ga0070667_100087427 | Ga0070667_1000874272 | 255 |
| 69 | 3300005434 | Ga0070709_10003001 | Ga0070709_100030017 | 255 |
| 70 | 3300005434 | Ga0070709_10004073 | Ga0070709_100040737 | 255 |
| 71 | 3300005436 | Ga0070713_100000768 | Ga0070713_10000076815 | 255 |
| 72 | 3300005436 | Ga0070713_100050097 | Ga0070713_1000500972 | 255 |
| 73 | 3300005437 | Ga0070710_10000783 | Ga0070710_100007834 | 255 |
| 74 | 3300005437 | Ga0070710_10011138 | Ga0070710_100111384 | 255 |
| 75 | 3300005439 | Ga0070711_100014561 | Ga0070711_1000145616 | 255 |
| 76 | 3300005444 | Ga0070694_100472071 | Ga0070694_1004720711 | 255 |
| 77 | 3300005455 | Ga0070663_100544819 | Ga0070663_1005448191 | 255 |
| 78 | 3300005456 | Ga0070678_100015675 | Ga0070678_1000156752 | 255 |
| 79 | 3300005458 | Ga0070681_10099564 | Ga0070681_100995642 | 255 |
| 80 | 3300005458 | Ga0070681_10341409 | Ga0070681_103414092 | 255 |
| 81 | 3300005530 | Ga0070679_100029863 | Ga0070679_1000298635 | 255 |
| 82 | 3300005530 | Ga0070679_100112332 | Ga0070679_1001123323 | 255 |
| 83 | 3300005535 | Ga0070684_100010288 | Ga0070684_1000102885 | 255 |
| 84 | 3300005535 | Ga0070684_100018435 | Ga0070684_1000184352 | 255 |
| 85 | 3300005539 | Ga0068853_100213968 | Ga0068853_1002139682 | 255 |
| 86 | 3300005543 | Ga0070672_100314516 | Ga0070672_1003145162 | 255 |
| 87 | 3300005544 | Ga0070686_100088863 | Ga0070686_1000888631 | 255 |
| 88 | 3300005545 | Ga0070695_100003309 | Ga0070695_1000033098 | 255 |
| 89 | 3300005547 | Ga0070693_100047172 | Ga0070693_1000471721 | 255 |
| 90 | 3300005548 | Ga0070665_100214894 | Ga0070665_1002148942 | 255 |
| 91 | 3300005548 | Ga0070665_100314562 | Ga0070665_1003145622 | 255 |
| 92 | 3300005563 | Ga0068855_100140528 | Ga0068855_1001405282 | 255 |
| 93 | 3300005563 | Ga0068855_101067411 | Ga0068855_1010674111 | 255 |
| 94 | 3300005616 | Ga0068852_101091218 | Ga0068852_1010912181 | 255 |
| 95 | 3300005618 | Ga0068864_100196374 | Ga0068864_1001963742 | 255 |
| 96 | 3300005719 | Ga0068861_100019252 | Ga0068861_1000192526 | 255 |
| 97 | 3300005843 | Ga0068860_100135759 | Ga0068860_1001357591 | 255 |
| 98 | 3300005844 | Ga0068862_100125823 | Ga0068862_1001258233 | 255 |
| 99 | 3300005844 | Ga0068862_100367396 | Ga0068862_1003673962 | 255 |
| 100 | 3300005844 | Ga0068862_100675343 | Ga0068862_1006753431 | 255 |
| 101 | 3300005937 | Ga0081455_10117951 | Ga0081455_101179513 | 255 |
| 102 | 3300005985 | Ga0081539_10000522 | Ga0081539_1000052233 | 255 |
| 103 | 3300005985 | Ga0081539_10048337 | Ga0081539_100483372 | 255 |
| 104 | 3300006028 | Ga0070717_10075333 | Ga0070717_100753333 | 255 |
| 105 | 3300006038 | Ga0075365_10003113 | Ga0075365_100031136 | 255 |
| 106 | 3300006038 | Ga0075365_10186131 | Ga0075365_101861312 | 255 |
| 107 | 3300006048 | Ga0075363_100006649 | Ga0075363_1000066494 | 255 |
| 108 | 3300006051 | Ga0075364_10027819 | Ga0075364_100278193 | 255 |
| 109 | 3300006163 | Ga0070715_10000865 | Ga0070715_100008653 | 255 |
| 110 | 3300006173 | Ga0070716_100001482 | Ga0070716_1000014827 | 255 |
| 111 | 3300006173 | Ga0070716_100053489 | Ga0070716_1000534893 | 255 |
| 112 | 3300006175 | Ga0070712_100217066 | Ga0070712_1002170662 | 255 |
| 113 | 3300006177 | Ga0075362_10010464 | Ga0075362_100104643 | 255 |
| 114 | 3300006177 | Ga0075362_10013395 | Ga0075362_100133954 | 255 |
| 115 | 3300006178 | Ga0075367_10005803 | Ga0075367_100058035 | 255 |
| 116 | 3300006178 | Ga0075367_10039032 | Ga0075367_100390323 | 255 |
| 117 | 3300006178 | Ga0075367_10144434 | Ga0075367_101444341 | 255 |
| 118 | 3300006195 | Ga0075366_10214704 | Ga0075366_102147042 | 255 |
| 119 | 3300006353 | Ga0075370_10019630 | Ga0075370_100196304 | 255 |
| 120 | 3300006358 | Ga0068871_100057891 | Ga0068871_1000578912 | 255 |
| 121 | 3300006358 | Ga0068871_100330713 | Ga0068871_1003307132 | 255 |
| 122 | 3300006844 | Ga0075428_100002387 | Ga0075428_1000023875 | 255 |
| 123 | 3300006844 | Ga0075428_100299541 | Ga0075428_1002995412 | 255 |
| 124 | 3300006846 | Ga0075430_100023729 | Ga0075430_1000237295 | 255 |
| 125 | 3300006847 | Ga0075431_100000881 | Ga0075431_10000088119 | 255 |
| 126 | 3300006847 | Ga0075431_100391755 | Ga0075431_1003917552 | 255 |
| 127 | 3300006852 | Ga0075433_10345521 | Ga0075433_103455211 | 255 |
| 128 | 3300006871 | Ga0075434_100005953 | Ga0075434_10000595313 | 255 |
| 129 | 3300006881 | Ga0068865_100187046 | Ga0068865_1001870462 | 255 |
| 130 | 3300006914 | Ga0075436_100217875 | Ga0075436_1002178752 | 255 |
| 131 | 3300007265 | Ga0099794_10012605 | Ga0099794_100126053 | 255 |
| 132 | 3300007265 | Ga0099794_10015075 | Ga0099794_100150756 | 255 |
| 133 | 3300007265 | Ga0099794_10017446 | Ga0099794_100174462 | 255 |
| 134 | 3300009092 | Ga0105250_10063529 | Ga0105250_100635293 | 255 |
| 135 | 3300009094 | Ga0111539_10000144 | Ga0111539_1000014475 | 255 |
| 136 | 3300009094 | Ga0111539_10253827 | Ga0111539_102538272 | 255 |
| 137 | 3300009094 | Ga0111539_10518624 | Ga0111539_105186242 | 255 |
| 138 | 3300009098 | Ga0105245_10007083 | Ga0105245_100070838 | 255 |
| 139 | 3300009101 | Ga0105247_10368322 | Ga0105247_103683221 | 255 |
| 140 | 3300009147 | Ga0114129_10000542 | Ga0114129_1000054212 | 255 |
| 141 | 3300009174 | Ga0105241_10260035 | Ga0105241_102600352 | 255 |
| 142 | 3300009176 | Ga0105242_10013985 | Ga0105242_100139853 | 255 |
| 143 | 3300009176 | Ga0105242_10433484 | Ga0105242_104334842 | 255 |
| 144 | 3300009177 | Ga0105248_10158178 | Ga0105248_101581783 | 255 |
| 145 | 3300009545 | Ga0105237_10219030 | Ga0105237_102190303 | 255 |
| 146 | 3300009551 | Ga0105238_10082580 | Ga0105238_100825803 | 255 |
| 147 | 3300009551 | Ga0105238_10105024 | Ga0105238_101050242 | 255 |
| 148 | 3300009551 | Ga0105238_10125835 | Ga0105238_101258353 | 255 |
| 149 | 3300009551 | Ga0105238_10182831 | Ga0105238_101828312 | 255 |
| 150 | 3300009551 | Ga0105238_10389472 | Ga0105238_103894722 | 255 |
| 151 | 3300010159 | Ga0099796_10020826 | Ga0099796_100208263 | 255 |
| 152 | 3300010375 | Ga0105239_10587026 | Ga0105239_105870262 | 255 |
| 153 | 3300013100 | Ga0157373_10041341 | Ga0157373_100413414 | 255 |
| 154 | 3300013102 | Ga0157371_10300657 | Ga0157371_103006572 | 255 |
| 155 | 3300013104 | Ga0157370_10075072 | Ga0157370_100750724 | 255 |
| 156 | 3300013104 | Ga0157370_10244627 | Ga0157370_102446272 | 255 |
| 157 | 3300013105 | Ga0157369_10111758 | Ga0157369_101117582 | 255 |
| 158 | 3300013105 | Ga0157369_10206877 | Ga0157369_102068774 | 255 |
| 159 | 3300013105 | Ga0157369_10354799 | Ga0157369_103547992 | 255 |
| 160 | 3300013297 | Ga0157378_10109266 | Ga0157378_101092662 | 255 |
| 161 | 3300013306 | Ga0163162_10589735 | Ga0163162_105897351 | 255 |
| 162 | 3300013308 | Ga0157375_10095149 | Ga0157375_100951493 | 255 |
| 163 | 3300014326 | Ga0157380_10029987 | Ga0157380_100299872 | 255 |
| 164 | 3300014326 | Ga0157380_10333297 | Ga0157380_103332972 | 255 |
| 165 | 3300014968 | Ga0157379_10536620 | Ga0157379_105366202 | 255 |
| 166 | 3300014969 | Ga0157376_10104898 | Ga0157376_101048982 | 255 |
| 167 | 3300014969 | Ga0157376_10979362 | Ga0157376_109793621 | 255 |
| 168 | 3300017792 | Ga0163161_10134008 | Ga0163161_101340082 | 255 |
| 169 | 3300021384 | Ga0213876_10008883 | Ga0213876_100088835 | 255 |
| 170 | 3300022467 | Ga0224712_10014402 | Ga0224712_100144022 | 255 |
| 171 | 3300025295 | Ga0209564_1000602 | Ga0209564_100060236 | 255 |
| 172 | 3300025295 | Ga0209564_1008246 | Ga0209564_10082466 | 255 |
| 173 | 3300025711 | Ga0207696_1020893 | Ga0207696_10208932 | 255 |
| 174 | 3300025893 | Ga0207682_10001508 | Ga0207682_100015086 | 255 |
| 175 | 3300025898 | Ga0207692_10001515 | Ga0207692_100015154 | 255 |
| 176 | 3300025898 | Ga0207692_10006519 | Ga0207692_100065194 | 255 |
| 177 | 3300025900 | Ga0207710_10249163 | Ga0207710_102491631 | 255 |
| 178 | 3300025901 | Ga0207688_10024392 | Ga0207688_100243922 | 255 |
| 179 | 3300025903 | Ga0207680_10459582 | Ga0207680_104595821 | 255 |
| 180 | 3300025904 | Ga0207647_10033231 | Ga0207647_100332312 | 255 |
| 181 | 3300025904 | Ga0207647_10085984 | Ga0207647_100859842 | 255 |
| 182 | 3300025905 | Ga0207685_10007721 | Ga0207685_100077214 | 255 |
| 183 | 3300025906 | Ga0207699_10000360 | Ga0207699_1000036025 | 255 |
| 184 | 3300025906 | Ga0207699_10010387 | Ga0207699_100103873 | 255 |
| 185 | 3300025907 | Ga0207645_10018494 | Ga0207645_100184945 | 255 |
| 186 | 3300025908 | Ga0207643_10047442 | Ga0207643_100474422 | 255 |
| 187 | 3300025909 | Ga0207705_10271759 | Ga0207705_102717591 | 255 |
| 188 | 3300025912 | Ga0207707_10030771 | Ga0207707_100307714 | 255 |
| 189 | 3300025912 | Ga0207707_10097794 | Ga0207707_100977941 | 255 |
| 190 | 3300025915 | Ga0207693_10000073 | Ga0207693_1000007348 | 255 |
| 191 | 3300025915 | Ga0207693_10015453 | Ga0207693_100154534 | 255 |
| 192 | 3300025916 | Ga0207663_10000993 | Ga0207663_100009934 | 255 |
| 193 | 3300025916 | Ga0207663_10012680 | Ga0207663_100126804 | 255 |
| 194 | 3300025917 | Ga0207660_10259223 | Ga0207660_102592232 | 255 |
| 195 | 3300025918 | Ga0207662_10035450 | Ga0207662_100354503 | 255 |
| 196 | 3300025919 | Ga0207657_10006265 | Ga0207657_100062658 | 255 |
| 197 | 3300025920 | Ga0207649_10152946 | Ga0207649_101529462 | 255 |
| 198 | 3300025921 | Ga0207652_10186134 | Ga0207652_101861342 | 255 |
| 199 | 3300025923 | Ga0207681_10047285 | Ga0207681_100472852 | 255 |
| 200 | 3300025923 | Ga0207681_10150575 | Ga0207681_101505752 | 255 |
| 201 | 3300025924 | Ga0207694_10084471 | Ga0207694_100844713 | 255 |
| 202 | 3300025924 | Ga0207694_10099125 | Ga0207694_100991252 | 255 |
| 203 | 3300025924 | Ga0207694_10587286 | Ga0207694_105872862 | 255 |
| 204 | 3300025925 | Ga0207650_10512369 | Ga0207650_105123691 | 255 |
| 205 | 3300025926 | Ga0207659_10188062 | Ga0207659_101880622 | 255 |
| 206 | 3300025927 | Ga0207687_10021525 | Ga0207687_100215254 | 255 |
| 207 | 3300025927 | Ga0207687_10119203 | Ga0207687_101192032 | 255 |
| 208 | 3300025928 | Ga0207700_10027298 | Ga0207700_100272983 | 255 |
| 209 | 3300025928 | Ga0207700_10069970 | Ga0207700_100699701 | 255 |
| 210 | 3300025929 | Ga0207664_10005740 | Ga0207664_100057403 | 255 |
| 211 | 3300025929 | Ga0207664_10009377 | Ga0207664_100093775 | 255 |
| 212 | 3300025929 | Ga0207664_10148940 | Ga0207664_101489402 | 255 |
| 213 | 3300025929 | Ga0207664_10252593 | Ga0207664_102525932 | 255 |
| 214 | 3300025931 | Ga0207644_10064574 | Ga0207644_100645742 | 255 |
| 215 | 3300025932 | Ga0207690_10449047 | Ga0207690_104490472 | 255 |
| 216 | 3300025933 | Ga0207706_10050316 | Ga0207706_100503163 | 255 |
| 217 | 3300025933 | Ga0207706_10135615 | Ga0207706_101356154 | 255 |
| 218 | 3300025935 | Ga0207709_10336730 | Ga0207709_103367301 | 255 |
| 219 | 3300025937 | Ga0207669_10024599 | Ga0207669_100245994 | 255 |
| 220 | 3300025938 | Ga0207704_10106925 | Ga0207704_101069252 | 255 |
| 221 | 3300025939 | Ga0207665_10000316 | Ga0207665_1000031626 | 255 |
| 222 | 3300025939 | Ga0207665_10087039 | Ga0207665_100870392 | 255 |
| 223 | 3300025940 | Ga0207691_10016907 | Ga0207691_100169074 | 255 |
| 224 | 3300025941 | Ga0207711_10355527 | Ga0207711_103555272 | 255 |
| 225 | 3300025942 | Ga0207689_10163465 | Ga0207689_101634652 | 255 |
| 226 | 3300025944 | Ga0207661_10045556 | Ga0207661_100455565 | 255 |
| 227 | 3300025945 | Ga0207679_10049052 | Ga0207679_100490522 | 255 |
| 228 | 3300025949 | Ga0207667_10204481 | Ga0207667_102044813 | 255 |
| 229 | 3300025949 | Ga0207667_10765477 | Ga0207667_107654772 | 255 |
| 230 | 3300025986 | Ga0207658_10101350 | Ga0207658_101013502 | 255 |
| 231 | 3300025986 | Ga0207658_10171871 | Ga0207658_101718712 | 255 |
| 232 | 3300025986 | Ga0207658_10506975 | Ga0207658_105069751 | 255 |
| 233 | 3300026023 | Ga0207677_10526178 | Ga0207677_105261782 | 255 |
| 234 | 3300026041 | Ga0207639_10198293 | Ga0207639_101982932 | 255 |
| 235 | 3300026067 | Ga0207678_10070849 | Ga0207678_100708493 | 255 |
| 236 | 3300026075 | Ga0207708_10202282 | Ga0207708_102022822 | 255 |
| 237 | 3300026075 | Ga0207708_10314941 | Ga0207708_103149412 | 255 |
| 238 | 3300026089 | Ga0207648_10208975 | Ga0207648_102089752 | 255 |
| 239 | 3300026095 | Ga0207676_10167633 | Ga0207676_101676332 | 255 |
| 240 | 3300026095 | Ga0207676_10421070 | Ga0207676_104210702 | 255 |
| 241 | 3300026116 | Ga0207674_10141706 | Ga0207674_101417063 | 255 |
| 242 | 3300026116 | Ga0207674_10159098 | Ga0207674_101590983 | 255 |
| 243 | 3300026118 | Ga0207675_100053662 | Ga0207675_1000536621 | 255 |
| 244 | 3300026118 | Ga0207675_100367134 | Ga0207675_1003671342 | 255 |
| 245 | 3300026121 | Ga0207683_10014358 | Ga0207683_100143583 | 255 |
| 246 | 3300027512 | Ga0209179_1001650 | Ga0209179_10016503 | 255 |
| 247 | 3300027907 | Ga0207428_10013852 | Ga0207428_100138525 | 255 |
| 248 | 3300027907 | Ga0207428_10192868 | Ga0207428_101928683 | 255 |
| 249 | 3300028379 | Ga0268266_10398071 | Ga0268266_103980712 | 255 |
| 250 | 3300028379 | Ga0268266_10758239 | Ga0268266_107582392 | 255 |
| 251 | 3300028794 | Ga0307515_10131554 | Ga0307515_101315541 | 255 |
| 252 | 3300031235 | Ga0265330_10051225 | Ga0265330_100512252 | 255 |
| 253 | 3300031247 | Ga0265340_10173155 | Ga0265340_101731551 | 255 |
| 254 | 3300031249 | Ga0265339_10002564 | Ga0265339_100025645 | 255 |
| 255 | 3300031344 | Ga0265316_10185828 | Ga0265316_101858282 | 255 |
| 256 | 3300031548 | Ga0307408_100229136 | Ga0307408_1002291362 | 255 |
| 257 | 3300031548 | Ga0307408_100230098 | Ga0307408_1002300982 | 255 |
| 258 | 3300034819 | Ga0373958_0018676 | Ga0373958_0018676_31_801 | 255 |
| 259 | 3300035084 | Ga0373928_0057160 | Ga0373928_0057160_68_835 | 255 |
| 260 | 3300035086 | Ga0373934_0022274 | Ga0373934_0022274_619_1386 | 255 |
| 261 | 3300035088 | Ga0373940_0036666 | Ga0373940_0036666_431_1201 | 255 |
| 262 | 3300035089 | Ga0373944_0001048 | Ga0373944_0001048_4012_4779 | 255 |
| 263 | 3300035111 | Ga0373923_0132978 | Ga0373923_0132978_337_1104 | 255 |
| 264 | 3300035113 | Ga0373936_0026976 | Ga0373936_0026976_567_1382 | 255 |
| 265 | 3300035113 | Ga0373936_0119287 | Ga0373936_0119287_15_782 | 255 |
| 266 | 3300035115 | Ga0373941_0006278 | Ga0373941_0006278_1218_1988 | 255 |
| 267 | 3300035116 | Ga0373945_0009707 | Ga0373945_0009707_344_1111 | 255 |
| 268 | 3300035117 | Ga0373953_0146930 | Ga0373953_0146930_68_835 | 255 |
| 269 | 3300035118 | Ga0373954_0002232 | Ga0373954_0002232_960_1727 | 255 |
| 270 | 3300035118 | Ga0373954_0004821 | Ga0373954_0004821_842_1609 | 255 |
| 271 | 3300035119 | Ga0373956_0008976 | Ga0373956_0008976_1399_2166 | 255 |
| 272 | 3300035119 | Ga0373956_0065477 | Ga0373956_0065477_543_1310 | 255 |
| 273 | 3300035119 | Ga0373956_0146663 | Ga0373956_0146663_43_813 | 255 |
| 274 | 3300035120 | Ga0373957_0033723 | Ga0373957_0033723_194_964 | 255 |
| 275 | 3300035170 | Ga0373943_0015761 | Ga0373943_0015761_2047_2814 | 255 |
| 276 | 3300035171 | Ga0373946_0001892 | Ga0373946_0001892_4076_4843 | 255 |
| 277 | 3300035171 | Ga0373946_0002159 | Ga0373946_0002159_5192_5959 | 255 |
| 278 | 3300035172 | Ga0373955_0009700 | Ga0373955_0009700_3528_4295 | 255 |
| 279 | 3300035172 | Ga0373955_0039994 | Ga0373955_0039994_1303_2070 | 255 |
| 280 | 3300035172 | Ga0373955_0062323 | Ga0373955_0062323_1071_1838 | 255 |
| 281 | 3300035172 | Ga0373955_0079459 | Ga0373955_0079459_330_1097 | 255 |
| 282 | 3300035410 | Ga0373924_0009556 | Ga0373924_0009556_2171_2938 | 255 |
| 283 | 3300035410 | Ga0373924_0112709 | Ga0373924_0112709_204_971 | 255 |
| 284 | 3300035410 | Ga0373924_0210233 | Ga0373924_0210233_16_786 | 255 |
| 285 | 3300035691 | Ga0373931_0002980 | Ga0373931_0002980_5282_6052 | 255 |
| 286 | 3300035692 | Ga0373935_0000434 | Ga0373935_0000434_20143_20910 | 255 |
| 287 | 3300035695 | Ga0373927_0000645 | Ga0373927_0000645_17956_18723 | 255 |
| 288 | 3300035724 | Ga0373933_0002533 | Ga0373933_0002533_8204_8971 | 255 |
| 289 | 3300035724 | Ga0373933_0014674 | Ga0373933_0014674_2730_3497 | 255 |
| 290 | 3300035724 | Ga0373933_0046084 | Ga0373933_0046084_139_906 | 255 |
| 291 | 3300035725 | Ga0373947_0002079 | Ga0373947_0002079_7938_8705 | 255 |
| 292 | 3300035725 | Ga0373947_0025229 | Ga0373947_0025229_1066_1833 | 255 |
| 293 | 3300035725 | Ga0373947_0122293 | Ga0373947_0122293_63_830 | 255 |
| 294 | 3300036401 | Ga0373937_0013989 | Ga0373937_0013989_5154_5921 | 255 |
| 295 | 3300036401 | Ga0373937_0280473 | Ga0373937_0280473_677_1444 | 255 |
| 296 | 3300037068 | Ga0373925_0006318 | Ga0373925_0006318_5883_6650 | 255 |
| 297 | 3300037068 | Ga0373925_0010149 | Ga0373925_0010149_1514_2281 | 255 |
| 298 | 3300037312 | Ga0395899_0056987 | Ga0395899_0056987_86_853 | 255 |
| 299 | 3300037418 | Ga0395900_0201339 | Ga0395900_0201339_330_1097 | 255 |
| 300 | 3300038443 | Ga0395901_0025191 | Ga0395901_0025191_2048_2815 | 255 |
| 301 | 3300039437 | Ga0436365_0861583 | Ga0436365_0861583_1914_2681 | 255 |
| 302 | 3300039437 | Ga0436365_1639838 | Ga0436365_1639838_6793_7560 | 255 |
| 303 | 3300039437 | Ga0436365_1832441 | Ga0436365_1832441_672_1439 | 255 |
| 304 | 3300039450 | Ga0436363_0283753 | Ga0436363_0283753_869_1654 | 255 |
| 305 | 3300039453 | Ga0436362_0167044 | Ga0436362_0167044_359_1126 | 255 |
| 306 | 3300041997 | Ga0439431_0067125 | Ga0439431_0067125_137_904 | 255 |
| 307 | 3300042001 | Ga0439441_037950 | Ga0439441_037950_129_896 | 255 |
| 308 | 3300042436 | Ga0439435_0002498 | Ga0439435_0002498_2221_2988 | 255 |
| 309 | 3300042439 | Ga0439464_0032904 | Ga0439464_0032904_168_935 | 255 |
| 310 | 3300042461 | Ga0439460_0006852 | Ga0439460_0006852_1120_1887 | 255 |
| 311 | 3300042993 | Ga0439440_0065393 | Ga0439440_0065393_120_887 | 255 |
| 312 | 3300044684 | Ga0466966_0346953 | Ga0466966_0346953_91_858 | 255 |
| 313 | 3300044694 | Ga0466963_0024101 | Ga0466963_0024101_2225_3025 | 255 |
| 314 | 3300045049 | Ga0466959_0068340 | Ga0466959_0068340_1230_1997 | 255 |
| 315 | 3300045976 | Ga0466967_0031475 | Ga0466967_0031475_125_925 | 255 |
| 316 | 3300045976 | Ga0466967_0497178 | Ga0466967_0497178_349_1116 | 255 |
| 317 | 3300046452 | Ga0495617_020023 | Ga0495617_020023_1259_2026 | 255 |
| 318 | 3300046454 | Ga0495592_0010417 | Ga0495592_0010417_2627_3394 | 255 |
| 319 | 3300046454 | Ga0495592_0066586 | Ga0495592_0066586_1578_2345 | 255 |
| 320 | 3300046455 | Ga0495603_0000189 | Ga0495603_0000189_28473_29240 | 255 |
| 321 | 3300046455 | Ga0495603_0182267 | Ga0495603_0182267_381_1148 | 255 |
| 322 | 3300046458 | Ga0495591_024325 | Ga0495591_024325_1054_1821 | 255 |
| 323 | 3300046459 | Ga0495629_0000268 | Ga0495629_0000268_26497_27264 | 255 |
| 324 | 3300046459 | Ga0495629_0339572 | Ga0495629_0339572_74_841 | 255 |
| 325 | 3300046460 | Ga0495638_0111733 | Ga0495638_0111733_818_1585 | 255 |
| 326 | 3300046461 | Ga0495641_0004507 | Ga0495641_0004507_5243_6010 | 255 |
| 327 | 3300046461 | Ga0495641_0007758 | Ga0495641_0007758_2849_3616 | 255 |
| 328 | 3300046472 | Ga0495580_0000772 | Ga0495580_0000772_19478_20245 | 255 |
| 329 | 3300046472 | Ga0495580_0008443 | Ga0495580_0008443_1055_1822 | 255 |
| 330 | 3300046472 | Ga0495580_0021834 | Ga0495580_0021834_3365_4132 | 255 |
| 331 | 3300046473 | Ga0495582_0000144 | Ga0495582_0000144_26677_27444 | 255 |
| 332 | 3300046473 | Ga0495582_0082031 | Ga0495582_0082031_74_841 | 255 |
| 333 | 3300046475 | Ga0495639_0000067 | Ga0495639_0000067_18693_19460 | 255 |
| 334 | 3300046476 | Ga0495662_0019742 | Ga0495662_0019742_653_1420 | 255 |
| 335 | 3300046476 | Ga0495662_0034507 | Ga0495662_0034507_1212_1979 | 255 |
| 336 | 3300046477 | Ga0495664_0023218 | Ga0495664_0023218_951_1718 | 255 |
| 337 | 3300046491 | Ga0495584_0028442 | Ga0495584_0028442_625_1395 | 255 |
| 338 | 3300046491 | Ga0495584_0065023 | Ga0495584_0065023_687_1454 | 255 |
| 339 | 3300046491 | Ga0495584_0144946 | Ga0495584_0144946_400_1167 | 255 |
| 340 | 3300046492 | Ga0495585_0004225 | Ga0495585_0004225_6042_6809 | 255 |
| 341 | 3300046499 | Ga0495594_0000102 | Ga0495594_0000102_18045_18812 | 255 |
| 342 | 3300046501 | Ga0495607_0005594 | Ga0495607_0005594_3565_4332 | 255 |
| 343 | 3300046501 | Ga0495607_0173408 | Ga0495607_0173408_156_923 | 255 |
| 344 | 3300046506 | Ga0495583_0103291 | Ga0495583_0103291_352_1119 | 255 |
| 345 | 3300046511 | Ga0495608_0021002 | Ga0495608_0021002_2829_3596 | 255 |
| 346 | 3300046511 | Ga0495608_0070124 | Ga0495608_0070124_70_840 | 255 |
| 347 | 3300046513 | Ga0495616_0090058 | Ga0495616_0090058_593_1360 | 255 |
| 348 | 3300046514 | Ga0495618_0168803 | Ga0495618_0168803_372_1139 | 255 |
| 349 | 3300046514 | Ga0495618_0172727 | Ga0495618_0172727_208_975 | 255 |
| 350 | 3300046516 | Ga0495628_0028272 | Ga0495628_0028272_1671_2438 | 255 |
| 351 | 3300046517 | Ga0495630_0018756 | Ga0495630_0018756_2027_2794 | 255 |
| 352 | 3300046517 | Ga0495630_0070155 | Ga0495630_0070155_658_1425 | 255 |
| 353 | 3300046517 | Ga0495630_0097623 | Ga0495630_0097623_219_986 | 255 |
| 354 | 3300046518 | Ga0495631_0018028 | Ga0495631_0018028_2459_3226 | 255 |
| 355 | 3300046520 | Ga0495637_0064316 | Ga0495637_0064316_404_1171 | 255 |
| 356 | 3300046523 | Ga0495644_0000306 | Ga0495644_0000306_11509_12276 | 255 |
| 357 | 3300046525 | Ga0495663_0023455 | Ga0495663_0023455_482_1249 | 255 |
| 358 | 3300046525 | Ga0495663_0044559 | Ga0495663_0044559_222_989 | 255 |
| 359 | 3300046526 | Ga0495666_0039515 | Ga0495666_0039515_623_1390 | 255 |
| 360 | 3300046529 | Ga0495652_0013648 | Ga0495652_0013648_3267_4034 | 255 |
| 361 | 3300046529 | Ga0495652_0058875 | Ga0495652_0058875_625_1392 | 255 |
| 362 | 3300046530 | Ga0495654_0038735 | Ga0495654_0038735_411_1178 | 255 |
| 363 | 3300046531 | Ga0495665_0000355 | Ga0495665_0000355_3716_4483 | 255 |
| 364 | 3300046531 | Ga0495665_0008953 | Ga0495665_0008953_1212_1979 | 255 |
| 365 | 3300046533 | Ga0495640_0004592 | Ga0495640_0004592_7567_8334 | 255 |
| 366 | 3300046533 | Ga0495640_0076662 | Ga0495640_0076662_341_1108 | 255 |
| 367 | 3300046535 | Ga0495586_0027068 | Ga0495586_0027068_690_1457 | 255 |
| 368 | 3300046536 | Ga0495587_0044390 | Ga0495587_0044390_1321_2088 | 255 |
| 369 | 3300046536 | Ga0495587_0071699 | Ga0495587_0071699_297_1064 | 255 |
| 370 | 3300046537 | Ga0495598_0002396 | Ga0495598_0002396_2497_3264 | 255 |
| 371 | 3300046538 | Ga0495609_0046901 | Ga0495609_0046901_802_1569 | 255 |
| 372 | 3300046539 | Ga0495621_0136638 | Ga0495621_0136638_82_849 | 255 |
| 373 | 3300046557 | Ga0495622_0000649 | Ga0495622_0000649_2461_3228 | 255 |
| 374 | 3300046557 | Ga0495622_0004842 | Ga0495622_0004842_2633_3400 | 255 |
| 375 | 3300046558 | Ga0495633_0001183 | Ga0495633_0001183_8743_9510 | 255 |
| 376 | 3300046559 | Ga0495667_0019434 | Ga0495667_0019434_906_1673 | 255 |
| 377 | 3300046559 | Ga0495667_0031521 | Ga0495667_0031521_2323_3090 | 255 |
| 378 | 3300046615 | Ga0495656_0000381 | Ga0495656_0000381_12795_13562 | 255 |
| 379 | 3300046615 | Ga0495656_0030222 | Ga0495656_0030222_994_1761 | 255 |
| 380 | 3300046615 | Ga0495656_0035348 | Ga0495656_0035348_963_1730 | 255 |
| 381 | 3300046642 | Ga0495634_0007987 | Ga0495634_0007987_6808_7575 | 255 |
| 382 | 3300046642 | Ga0495634_0020441 | Ga0495634_0020441_1881_2648 | 255 |
| 383 | 3300046648 | Ga0495611_0130417 | Ga0495611_0130417_298_1065 | 255 |
| 384 | 3300046660 | Ga0495625_0051874 | Ga0495625_0051874_335_1102 | 255 |
| 385 | 3300046663 | Ga0495635_0001955 | Ga0495635_0001955_11516_12283 | 255 |
| 386 | 3300046663 | Ga0495635_0198640 | Ga0495635_0198640_248_1018 | 255 |
| 387 | 3300046664 | Ga0495659_0000645 | Ga0495659_0000645_11505_12272 | 255 |
| 388 | 3300046665 | Ga0495661_0061995 | Ga0495661_0061995_911_1678 | 255 |
| 389 | 3300046674 | Ga0495588_0003103 | Ga0495588_0003103_2455_3222 | 255 |
| 390 | 3300046674 | Ga0495588_0190601 | Ga0495588_0190601_250_1017 | 255 |
| 391 | 3300046675 | Ga0495657_0074244 | Ga0495657_0074244_594_1361 | 255 |
| 392 | 3300046678 | Ga0495599_0017266 | Ga0495599_0017266_3645_4412 | 255 |
| 393 | 3300046680 | Ga0495646_0071068 | Ga0495646_0071068_946_1713 | 255 |
| 394 | 3300046681 | Ga0495647_0000151 | Ga0495647_0000151_7726_8493 | 255 |
| 395 | 3300046683 | Ga0495658_0000439 | Ga0495658_0000439_6100_6867 | 255 |
| 396 | 3300046683 | Ga0495658_0068462 | Ga0495658_0068462_785_1552 | 255 |
| 397 | 3300046689 | Ga0495613_0005413 | Ga0495613_0005413_2277_3044 | 255 |
| 398 | 3300046689 | Ga0495613_0030381 | Ga0495613_0030381_2472_3239 | 255 |
| 399 | 3300046690 | Ga0495624_0017115 | Ga0495624_0017115_287_1054 | 255 |
| 400 | 3300046690 | Ga0495624_0017221 | Ga0495624_0017221_835_1602 | 255 |
| 401 | 3300046691 | Ga0495670_0002108 | Ga0495670_0002108_1426_2193 | 255 |
| 402 | 3300046691 | Ga0495670_0004752 | Ga0495670_0004752_3704_4471 | 255 |
| 403 | 3300046691 | Ga0495670_0243679 | Ga0495670_0243679_30_797 | 255 |
| 404 | 3300046809 | Ga0495600_0006075 | Ga0495600_0006075_5676_6443 | 255 |
| 405 | 3300046809 | Ga0495600_0096349 | Ga0495600_0096349_972_1739 | 255 |
| 406 | 3300046810 | Ga0495660_0050946 | Ga0495660_0050946_507_1274 | 255 |
| 407 | 3300047315 | Ga0495581_0000084 | Ga0495581_0000084_16451_17218 | 255 |
| 408 | 3300047315 | Ga0495581_0004621 | Ga0495581_0004621_6198_6965 | 255 |
| 409 | 3300047317 | Ga0495604_0042976 | Ga0495604_0042976_2590_3357 | 255 |
| 410 | 3300047319 | Ga0495674_0006112 | Ga0495674_0006112_5934_6701 | 255 |
| 411 | 3300047319 | Ga0495674_0085063 | Ga0495674_0085063_762_1529 | 255 |
| 412 | 3300047320 | Ga0495672_0004345 | Ga0495672_0004345_8659_9426 | 255 |
| 413 | 3300047320 | Ga0495672_0090625 | Ga0495672_0090625_704_1477 | 255 |
| 414 | 3300047321 | Ga0495676_0015887 | Ga0495676_0015887_1562_2329 | 255 |
| 415 | 3300047322 | Ga0495680_0083655 | Ga0495680_0083655_654_1421 | 255 |
| 416 | 3300047322 | Ga0495680_0237797 | Ga0495680_0237797_152_919 | 255 |
| 417 | 3300047322 | Ga0495680_0272446 | Ga0495680_0272446_105_872 | 255 |
| 418 | 3300047445 | Ga0495677_0074512 | Ga0495677_0074512_455_1222 | 255 |
| 419 | 3300047471 | Ga0495684_0015749 | Ga0495684_0015749_185_952 | 255 |
| 420 | 3300047471 | Ga0495684_0035512 | Ga0495684_0035512_1957_2724 | 255 |
| 421 | 3300047673 | Ga0495593_0000038 | Ga0495593_0000038_22073_22840 | 255 |
| 422 | 3300047673 | Ga0495593_0077949 | Ga0495593_0077949_807_1574 | 255 |
| 423 | 3300048089 | Ga0495614_0015458 | Ga0495614_0015458_241_1008 | 255 |
| 424 | 3300048090 | Ga0495615_0016157 | Ga0495615_0016157_802_1569 | 255 |
| 425 | 3300048907 | Ga0496104_0552897 | Ga0496104_0552897_133_900 | 255 |
| 426 | 3300048915 | Ga0496112_0006551 | Ga0496112_0006551_353_1120 | 255 |
| 427 | 3300048916 | Ga0496113_0110517 | Ga0496113_0110517_1174_1941 | 255 |
| 428 | 3300048918 | Ga0496115_0361911 | Ga0496115_0361911_64_831 | 255 |
| 429 | 3300048918 | Ga0496115_0486533 | Ga0496115_0486533_187_954 | 255 |
| 430 | 3300048919 | Ga0496116_0008716 | Ga0496116_0008716_2139_2906 | 255 |
| 431 | 3300048919 | Ga0496116_0212171 | Ga0496116_0212171_164_931 | 255 |
| 432 | 3300048920 | Ga0496117_0087125 | Ga0496117_0087125_633_1400 | 255 |
| 433 | 3300048920 | Ga0496117_0099447 | Ga0496117_0099447_671_1438 | 255 |
| 434 | 3300048921 | Ga0496118_0073400 | Ga0496118_0073400_1061_1828 | 255 |
| 435 | 3300048922 | Ga0496119_0069436 | Ga0496119_0069436_271_1038 | 255 |
| 436 | 3300048924 | Ga0496121_0002503 | Ga0496121_0002503_12127_12894 | 255 |
| 437 | 3300048924 | Ga0496121_0194751 | Ga0496121_0194751_222_989 | 255 |
| 438 | 3300048924 | Ga0496121_0252132 | Ga0496121_0252132_172_939 | 255 |
| 439 | 3300048925 | Ga0496122_0196476 | Ga0496122_0196476_19_786 | 255 |
| 440 | 3300048927 | Ga0496124_0144580 | Ga0496124_0144580_806_1573 | 255 |
| 441 | 3300048927 | Ga0496124_0190826 | Ga0496124_0190826_757_1524 | 255 |
| 442 | 3300048927 | Ga0496124_0351667 | Ga0496124_0351667_135_902 | 255 |
| 443 | 3300048928 | Ga0496125_0021733 | Ga0496125_0021733_4087_4854 | 255 |
| 444 | 3300048928 | Ga0496125_0139266 | Ga0496125_0139266_198_965 | 255 |
| 445 | 3300049570 | Ga0501033_0069428 | Ga0501033_0069428_407_1174 | 255 |
| 446 | 3300049571 | Ga0501034_0061846 | Ga0501034_0061846_455_1225 | 255 |
| 447 | 3300049571 | Ga0501034_0227180 | Ga0501034_0227180_774_1541 | 255 |
| 448 | 3300049572 | Ga0501036_0256230 | Ga0501036_0256230_53_820 | 255 |
| 449 | 3300049574 | Ga0501038_0030866 | Ga0501038_0030866_1019_1786 | 255 |
| 450 | 3300049574 | Ga0501038_0143221 | Ga0501038_0143221_1176_1943 | 255 |
| 451 | 3300049577 | Ga0501041_0110127 | Ga0501041_0110127_133_903 | 255 |
| 452 | 3300049579 | Ga0501043_0015355 | Ga0501043_0015355_600_1370 | 255 |
| 453 | 3300049579 | Ga0501043_0364439 | Ga0501043_0364439_311_1078 | 255 |
| 454 | 3300049581 | Ga0501047_0057292 | Ga0501047_0057292_1236_2003 | 255 |
| 455 | 3300049582 | Ga0501048_0160356 | Ga0501048_0160356_118_885 | 255 |
| 456 | 3300049584 | Ga0501068_0016013 | Ga0501068_0016013_2914_3684 | 255 |
| 457 | 3300049585 | Ga0501069_0005696 | Ga0501069_0005696_4411_5181 | 255 |
| 458 | 3300049586 | Ga0501070_0014884 | Ga0501070_0014884_4394_5164 | 255 |
| 459 | 3300049586 | Ga0501070_0070613 | Ga0501070_0070613_1755_2525 | 255 |
| 460 | 3300049586 | Ga0501070_0146650 | Ga0501070_0146650_452_1219 | 255 |
| 461 | 3300049588 | Ga0501072_0095655 | Ga0501072_0095655_1095_1862 | 255 |
| 462 | 3300049590 | Ga0501074_0082975 | Ga0501074_0082975_631_1401 | 255 |
| 463 | 3300049591 | Ga0501075_0002331 | Ga0501075_0002331_2027_2797 | 255 |
| 464 | 3300049592 | Ga0501076_0194754 | Ga0501076_0194754_104_874 | 255 |
| 465 | 3300049742 | Ga0501080_0016494 | Ga0501080_0016494_104_874 | 255 |
| 466 | 3300049742 | Ga0501080_0089509 | Ga0501080_0089509_197_967 | 255 |
| 467 | 3300049744 | Ga0501083_0070803 | Ga0501083_0070803_1443_2210 | 255 |
| 468 | 3300049822 | Ga0501035_0000371 | Ga0501035_0000371_18275_19045 | 255 |
| 469 | 3300049822 | Ga0501035_0016438 | Ga0501035_0016438_660_1427 | 255 |
| 470 | 3300049823 | Ga0501044_0332332 | Ga0501044_0332332_160_927 | 255 |
| 471 | 3300049824 | Ga0501045_0046031 | Ga0501045_0046031_56_826 | 255 |
| 472 | 3300050489 | nmdc:mga03683_4846_c1 | nmdc:mga03683_4846_c1_839_1714 | 255 |
| 473 | 3300050490 | nmdc:mga03n38_216561_c1 | nmdc:mga03n38_216561_c1_154_921 | 255 |
| 474 | 3300050490 | nmdc:mga03n38_47996_c1 | nmdc:mga03n38_47996_c1_1075_1851 | 255 |
| 475 | 3300050491 | nmdc:mga00v17_6965_c1 | nmdc:mga00v17_6965_c1_3761_4636 | 255 |
| 476 | 3300050492 | nmdc:mga0yw44_410015_c1 | nmdc:mga0yw44_410015_c1_71_838 | 255 |
| 477 | 3300050492 | nmdc:mga0yw44_910_c1 | nmdc:mga0yw44_910_c1_1072_1947 | 255 |
| 478 | 3300050493 | nmdc:mga0k408_28781_c1 | nmdc:mga0k408_28781_c1_112_879 | 255 |
| 479 | 3300050493 | nmdc:mga0k408_356141_c1 | nmdc:mga0k408_356141_c1_69_836 | 255 |
| 480 | 3300050494 | nmdc:mga06z11_238710_c1 | nmdc:mga06z11_238710_c1_23_790 | 255 |
| 481 | 3300050494 | nmdc:mga06z11_242058_c1 | nmdc:mga06z11_242058_c1_243_1010 | 255 |
| 482 | 3300050494 | nmdc:mga06z11_3342_c1 | nmdc:mga06z11_3342_c1_3715_4590 | 255 |
| 483 | 3300050496 | nmdc:mga07m45_37324_c1 | nmdc:mga07m45_37324_c1_740_1507 | 255 |
| 484 | 3300050496 | nmdc:mga07m45_70557_c1 | nmdc:mga07m45_70557_c1_63_830 | 255 |
| 485 | 3300050507 | nmdc:mga05p37_52_c1 | nmdc:mga05p37_52_c1_12257_13030 | 255 |
| 486 | 3300050508 | nmdc:mga09592_5230_c1 | nmdc:mga09592_5230_c1_3071_3844 | 255 |
| 487 | 3300050509 | nmdc:mga0qj67_372400_c1 | nmdc:mga0qj67_372400_c1_141_920 | 255 |
| 488 | 3300050510 | nmdc:mga06r32_248_c1 | nmdc:mga06r32_248_c1_21247_22020 | 255 |
| 489 | 3300050510 | nmdc:mga06r32_430729_c1 | nmdc:mga06r32_430729_c1_12_782 | 255 |
| 490 | 3300050511 | nmdc:mga08y16_185_c1 | nmdc:mga08y16_185_c1_37922_38695 | 255 |
| 491 | 3300050511 | nmdc:mga08y16_585806_c1 | nmdc:mga08y16_585806_c1_164_931 | 255 |
| 492 | 3300050512 | nmdc:mga0n895_4095_c1 | nmdc:mga0n895_4095_c1_1148_1915 | 255 |
| 493 | 3300050513 | nmdc:mga0rr50_200384_c1 | nmdc:mga0rr50_200384_c1_442_1209 | 255 |
| 494 | 3300050514 | nmdc:mga08x19_52610_c1 | nmdc:mga08x19_52610_c1_473_1240 | 255 |
| 495 | 3300053077 | Ga0495601_0000722 | Ga0495601_0000722_6927_7694 | 255 |
| 496 | 3300053077 | Ga0495601_0030306 | Ga0495601_0030306_2347_3114 | 255 |
| 497 | 3300053084 | Ga0495595_0008051 | Ga0495595_0008051_3198_3965 | 255 |
| 498 | 3300053085 | Ga0495619_0005352 | Ga0495619_0005352_7176_7943 | 255 |
| 499 | 3300053085 | Ga0495619_0050948 | Ga0495619_0050948_270_1037 | 255 |
| 500 | 3300053085 | Ga0495619_0147529 | Ga0495619_0147529_136_903 | 255 |
| 501 | 3300053087 | Ga0500643_016829 | Ga0500643_016829_1073_1840 | 255 |
| 502 | 3300053087 | Ga0500643_039956 | Ga0500643_039956_114_881 | 255 |
| 503 | 3300053092 | Ga0500583_0083250 | Ga0500583_0083250_282_1049 | 255 |
| 504 | 3300053093 | Ga0500651_0077567 | Ga0500651_0077567_652_1419 | 255 |
| 505 | 3300053093 | Ga0500651_0080518 | Ga0500651_0080518_1047_1814 | 255 |
| 506 | 3300053093 | Ga0500651_0083360 | Ga0500651_0083360_546_1313 | 255 |
| 507 | 3300053094 | Ga0500566_0000629 | Ga0500566_0000629_11426_12193 | 255 |
| 508 | 3300053096 | Ga0500641_0014121 | Ga0500641_0014121_709_1476 | 255 |
| 509 | 3300053096 | Ga0500641_0017753 | Ga0500641_0017753_561_1328 | 255 |
| 510 | 3300053098 | Ga0500650_0048591 | Ga0500650_0048591_1099_1866 | 255 |
| 511 | 3300053104 | Ga0500556_0000012 | Ga0500556_0000012_165106_165873 | 255 |
| 512 | 3300053117 | Ga0500593_018097 | Ga0500593_018097_2256_3023 | 255 |
| 513 | 3300053121 | Ga0500607_140331 | Ga0500607_140331_264_1031 | 255 |
| 514 | 3300053122 | Ga0500608_095040 | Ga0500608_095040_98_865 | 255 |
| 515 | 3300053130 | Ga0500642_0000055 | Ga0500642_0000055_11702_12469 | 255 |
| 516 | 3300053131 | Ga0500652_001690 | Ga0500652_001690_3779_4546 | 255 |
| 517 | 3300053136 | Ga0500559_0000615 | Ga0500559_0000615_18512_19279 | 255 |
| 518 | 3300053136 | Ga0500559_0069306 | Ga0500559_0069306_796_1563 | 255 |
| 519 | 3300053139 | Ga0500568_0000386 | Ga0500568_0000386_12179_12946 | 255 |
| 520 | 3300053140 | Ga0500573_0237605 | Ga0500573_0237605_170_937 | 255 |
| 521 | 3300053145 | Ga0500586_000275 | Ga0500586_000275_1823_2590 | 255 |
| 522 | 3300053151 | Ga0500604_0000814 | Ga0500604_0000814_4699_5466 | 255 |
| 523 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_896838_897605 | 255 |
| 524 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_219186_219953 | 255 |
| 525 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_136654_137421 | 255 |
| 526 | 3300053156 | Ga0500622_0000885 | Ga0500622_0000885_1307_2074 | 255 |
| 527 | 3300053177 | Ga0500636_0016619 | Ga0500636_0016619_2239_3006 | 255 |
| 528 | 3300053730 | Ga0500645_000592 | Ga0500645_000592_6525_7292 | 255 |
| 529 | 3300053730 | Ga0500645_024050 | Ga0500645_024050_935_1702 | 255 |
| 530 | 3300060353 | Ga0501082_0150136 | Ga0501082_0150136_336_1115 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xm8-assembly2.cif.gz_B | x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 | 0.9758 | 4 | 255 |
| 1xm8-assembly2.cif.gz_B | x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 | 0.9645 | 4 | 255 |
| 8ewo-assembly2.cif.gz_B | crystal structure of putative glyoxylase ii from pseudomonas aeruginosa | 0.9527 | 3 | 255 |
| 6s0i-assembly1.cif.gz_A | crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site | 0.9515 | 4 | 255 |
| 1qh5-assembly1.cif.gz_B | human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl)glutathione | 0.9482 | 4 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MD49_73_326_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.979 | 4 | 255 | 3.60.15.10 |
| af_I1MD49_73_326_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9677 | 4 | 255 | 3.60.15.10 |
| af_Q8N490_119_385_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9592 | 4 | 255 | 3.60.15.10 |
| af_O35952_50_309_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9446 | 4 | 255 | 3.60.15.10 |
| af_Q8N490_119_385_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9444 | 4 | 255 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A420AU35-F1-model_v4 | deleted | 1.002 | 1 | 255 |
|
| AF-J3HYY5-F1-model_v4 | hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) | 0.9973 | 139 | 255 |
GO:0016787
GO:0046872 |
| AF-A0A380W4M2-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 0.9964 | 1 | 255 |
GO:0004416
GO:0019243 GO:0046872 |
| AF-A0A380W4M2-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 0.9925 | 1 | 255 |
GO:0004416
GO:0019243 GO:0046872 |
| AF-A0A831W259-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) | 0.99 | 110 | 255 |
GO:0004416
GO:0019243 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar