F459829

General Info

Members Datasets Scaffolds Average Seq Length
529 209 1058 236

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10129064|Ga0307405_101290642
Length 292
Sequence MGGQLTSASGRMRFRSARNVLFLTGESQVISVEFFHTGELYNRFSTLKRNFVDSGEIYMTSVRLSYAAVLIALLVLSAVITPAQKKSRTQDAARHSSDAAKTFTEIMNVKDKAIPKELLDTAEAIAVFPGVIKAAFLIGGRGGQGVISRRVKGGWSAPAFFNLGGGSFGPQIGAQQTDYVLLIMNPSGLDGLLKDKFELGGEAGIAAGPVGREAAASTNPRLDAGILSYSRSKGVFVGAALKGAVISPDNDLNEAIYGKKADAVLQGSAMTFAQMPPQVRIFPRTLVRYSIR

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
160 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
161 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
170 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
171 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
176 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
177 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
178 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
179 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
180 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
181 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
182 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
183 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
184 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
185 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
186 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
187 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
188 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
189 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
190 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
191 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
192 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
193 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
194 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
195 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
198 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.08
Rhizosphere 97.73
Stem 0
Stem Tuber 0
Unclassified 22.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10129064 3300031731 Unclassified 1744
2 MRS1b_contig_7375543 2162886011 Bacteria 988
3 MBSR1b_contig_10295850 2162886012 Bacteria 1163
4 CNAas_1000018 3300000532 Bacteria 10303
5 JGI24751J29686_10000059 3300002459 Bacteria 61971
6 rootL2_10116429 3300003322 Bacteria 2289
7 Ga0065714_10006812 3300005288 Bacteria 3557
8 Ga0065714_10064422 3300005288 Bacteria 270668
9 Ga0065704_10018941 3300005289 Bacteria 2096
10 Ga0065704_10117487 3300005289 Bacteria 1833
11 Ga0065712_10000122 3300005290 Bacteria 92508
12 Ga0065712_10074709 3300005290 Bacteria 4029
13 Ga0065712_10191373 3300005290 Unclassified 1147
14 Ga0065715_10013475 3300005293 Bacteria 2344
15 Ga0065715_10090240 3300005293 Bacteria 7372
16 Ga0065715_10091355 3300005293 Bacteria 5857
17 Ga0065715_10101854 3300005293 Bacteria 3164
18 Ga0065715_10121141 3300005293 Bacteria 2238
19 Ga0065715_10141500 3300005293 Bacteria 1823
20 Ga0065715_10157770 3300005293 Bacteria 1660
21 Ga0065715_10162151 3300005293 Bacteria 1619
22 Ga0065715_10272310 3300005293 Bacteria 1094
23 Ga0065715_10402002 3300005293 Unclassified 880
24 Ga0065707_10001885 3300005295 Bacteria 5965
25 Ga0065707_10103868 3300005295 Bacteria 2725
26 Ga0070690_100093586 3300005330 Bacteria 1982
27 Ga0070690_100274880 3300005330 Unclassified 1200
28 Ga0070670_100000345 3300005331 Bacteria 39001
29 Ga0070670_100016750 3300005331 Bacteria 6291
30 Ga0070677_10080916 3300005333 Unclassified 1389
31 Ga0068869_100070632 3300005334 Bacteria 2584
32 Ga0068869_100090935 3300005334 Bacteria 2295
33 Ga0068869_100109042 3300005334 Bacteria 2104
34 Ga0068869_100112261 3300005334 Bacteria 2075
35 Ga0070666_10068004 3300005335 Unclassified 2419
36 Ga0070666_10068728 3300005335 Bacteria 2407
37 Ga0070680_100001057 3300005336 Bacteria 19724
38 Ga0070680_100013003 3300005336 Bacteria 6476
39 Ga0070680_100117691 3300005336 Bacteria 2216
40 Ga0070682_100016376 3300005337 Bacteria 4309
41 Ga0070682_100077856 3300005337 Bacteria 2138
42 Ga0068868_100036080 3300005338 Bacteria 3825
43 Ga0068868_100326143 3300005338 Bacteria 1309
44 Ga0070689_100000147 3300005340 Bacteria 40915
45 Ga0070689_100130009 3300005340 Unclassified 2019
46 Ga0070692_10002421 3300005345 Bacteria 7237
47 Ga0070692_10009173 3300005345 Bacteria 4449
48 Ga0070692_10068064 3300005345 Unclassified 1891
49 Ga0070692_10255340 3300005345 Unclassified 1051
50 Ga0070671_100040305 3300005355 Bacteria 3879
51 Ga0070671_100071898 3300005355 Unclassified 2888
52 Ga0070673_100104365 3300005364 Bacteria 2340
53 Ga0070673_100240813 3300005364 Bacteria 1573
54 Ga0070688_100255851 3300005365 Bacteria 1248
55 Ga0070659_100028223 3300005366 Bacteria 4332
56 Ga0070667_100034266 3300005367 Bacteria 4247
57 Ga0070703_10002834 3300005406 Unclassified 4967
58 Ga0070701_10061403 3300005438 Unclassified 1982
59 Ga0070701_10177305 3300005438 Bacteria 1245
60 Ga0070705_100001165 3300005440 Bacteria 14401
61 Ga0070705_100183485 3300005440 Bacteria 1419
62 Ga0070705_100185869 3300005440 Unclassified 1412
63 Ga0070700_100000065 3300005441 Bacteria 76224
64 Ga0070700_100039638 3300005441 Bacteria 2879
65 Ga0070700_100056002 3300005441 Bacteria 2470
66 Ga0070700_100374888 3300005441 Unclassified 1062
67 Ga0070700_100451588 3300005441 Unclassified 978
68 Ga0070694_100003470 3300005444 Bacteria 9442
69 Ga0070694_100017600 3300005444 Bacteria 4519
70 Ga0070694_100038835 3300005444 Bacteria 3165
71 Ga0070694_100040216 3300005444 Bacteria 3116
72 Ga0070694_100325920 3300005444 Bacteria 1183
73 Ga0070708_100001064 3300005445 Bacteria 20966
74 Ga0070708_100071764 3300005445 Bacteria 3118
75 Ga0070663_100265333 3300005455 Bacteria 1363
76 Ga0070662_100030994 3300005457 Unclassified 3748
77 Ga0070662_100099494 3300005457 Bacteria 2198
78 Ga0070681_10002114 3300005458 Bacteria 18042
79 Ga0070681_10020360 3300005458 Bacteria 6649
80 Ga0068867_100154078 3300005459 Bacteria 1807
81 Ga0068867_100178988 3300005459 Unclassified 1685
82 Ga0068867_100840195 3300005459 Bacteria 822
83 Ga0070685_10118555 3300005466 Unclassified 1641
84 Ga0070706_100000661 3300005467 Bacteria 39338
85 Ga0070706_100001956 3300005467 Bacteria 21222
86 Ga0070706_100047814 3300005467 Bacteria 3948
87 Ga0070706_100119892 3300005467 Bacteria 2452
88 Ga0070698_100026078 3300005471 Bacteria 6087
89 Ga0070698_100065816 3300005471 Bacteria 3649
90 Ga0070698_100076242 3300005471 Bacteria 3355
91 Ga0070698_100112898 3300005471 Bacteria 2682
92 Ga0070698_100150802 3300005471 Bacteria 2272
93 Ga0070699_100000632 3300005518 Bacteria 33010
94 Ga0070699_100001563 3300005518 Bacteria 20936
95 Ga0070699_100071546 3300005518 Bacteria 3016
96 Ga0070699_100116474 3300005518 Bacteria 2348
97 Ga0070699_100161976 3300005518 Unclassified 1980
98 Ga0070679_100000014 3300005530 Bacteria 150481
99 Ga0070697_100046066 3300005536 Bacteria 3534
100 Ga0070697_100075306 3300005536 Bacteria 2774
101 Ga0070697_100088823 3300005536 Bacteria 2553
102 Ga0068853_100040905 3300005539 Bacteria 3957
103 Ga0068853_100248622 3300005539 Bacteria 1631
104 Ga0068853_100398078 3300005539 Bacteria 1288
105 Ga0070672_100200563 3300005543 Bacteria 1668
106 Ga0070672_100432287 3300005543 Bacteria 1132
107 Ga0070695_100020107 3300005545 Unclassified 4073
108 Ga0070695_100020633 3300005545 Bacteria 4024
109 Ga0070695_100043800 3300005545 Bacteria 2847
110 Ga0070695_100138738 3300005545 Bacteria 1683
111 Ga0070695_100156594 3300005545 Unclassified 1595
112 Ga0070695_100266761 3300005545 Bacteria 1252
113 Ga0070696_100010980 3300005546 Bacteria 6065
114 Ga0070696_100051337 3300005546 Bacteria 2868
115 Ga0070696_100223187 3300005546 Bacteria 1415
116 Ga0070693_100007395 3300005547 Bacteria 5367
117 Ga0070693_100012624 3300005547 Bacteria 4279
118 Ga0070693_100014413 3300005547 Bacteria 4051
119 Ga0070693_100174074 3300005547 Bacteria 1381
120 Ga0070665_100026290 3300005548 Bacteria 5862
121 Ga0070704_100030592 3300005549 Bacteria 3609
122 Ga0070704_100067851 3300005549 Viruses 2577
123 Ga0070704_100086072 3300005549 Unclassified 2328
124 Ga0070704_100157537 3300005549 Bacteria 1792
125 Ga0070704_100157702 3300005549 Bacteria 1791
126 Ga0070704_100203562 3300005549 Unclassified 1600
127 Ga0070704_100303218 3300005549 Bacteria 1332
128 Ga0068855_100118516 3300005563 Bacteria 3031
129 Ga0068855_100372649 3300005563 Bacteria 1569
130 Ga0070664_100307525 3300005564 Unclassified 1434
131 Ga0070664_100431707 3300005564 Bacteria 1208
132 Ga0070664_100626771 3300005564 Unclassified 998
133 Ga0068857_100073530 3300005577 Bacteria 3046
134 Ga0068857_100153705 3300005577 Bacteria 2086
135 Ga0068857_100551757 3300005577 Bacteria 1086
136 Ga0068854_100306676 3300005578 Bacteria 1286
137 Ga0068854_100330696 3300005578 Unclassified 1241
138 Ga0068854_100484311 3300005578 Bacteria 1039
139 Ga0068854_100598827 3300005578 Bacteria 941
140 Ga0070702_100002802 3300005615 Bacteria 7635
141 Ga0070702_100027608 3300005615 Unclassified 3065
142 Ga0070702_100158415 3300005615 Bacteria 1461
143 Ga0070702_100263001 3300005615 Bacteria 1176
144 Ga0068852_100101515 3300005616 Unclassified 2598
145 Ga0068852_100208955 3300005616 Bacteria 1851
146 Ga0068852_100490902 3300005616 Unclassified 1221
147 Ga0068859_100001017 3300005617 Bacteria 28714
148 Ga0068859_100018234 3300005617 Bacteria 7057
149 Ga0068859_100022971 3300005617 Bacteria 6255
150 Ga0068859_100037744 3300005617 Unclassified 4848
151 Ga0068859_100040324 3300005617 Bacteria 4686
152 Ga0068859_100058288 3300005617 Bacteria 3890
153 Ga0068859_100146609 3300005617 Bacteria 2435
154 Ga0068859_100164025 3300005617 Bacteria 2301
155 Ga0068859_100347232 3300005617 Bacteria 1578
156 Ga0068859_100495541 3300005617 Bacteria 1317
157 Ga0068864_100007419 3300005618 Bacteria 9030
158 Ga0068864_100035693 3300005618 Bacteria 4234
159 Ga0068864_100182248 3300005618 Bacteria 1920
160 Ga0068864_100234157 3300005618 Bacteria 1699
161 Ga0068861_100025852 3300005719 Bacteria 4263
162 Ga0068861_100305869 3300005719 Bacteria 1379
163 Ga0068870_10134765 3300005840 Bacteria 1438
164 Ga0068870_10291990 3300005840 Bacteria 1026
165 Ga0068863_100011034 3300005841 Bacteria 8764
166 Ga0068863_100170174 3300005841 Bacteria 2089
167 Ga0068863_100444064 3300005841 Bacteria 1272
168 Ga0068858_100016911 3300005842 Bacteria 6850
169 Ga0068858_100144787 3300005842 Bacteria 2231
170 Ga0068858_100168024 3300005842 Bacteria 2067
171 Ga0068860_100021443 3300005843 Bacteria 6255
172 Ga0068860_100026908 3300005843 Bacteria 5542
173 Ga0068860_100034432 3300005843 Bacteria 4857
174 Ga0068860_100094987 3300005843 Bacteria 2841
175 Ga0068860_100416212 3300005843 Bacteria 1332
176 Ga0068860_100995113 3300005843 Bacteria 856
177 Ga0068860_101041691 3300005843 Unclassified 837
178 Ga0068862_100071210 3300005844 Bacteria 3002
179 Ga0068862_100090374 3300005844 Unclassified 2666
180 Ga0068862_100127886 3300005844 Bacteria 2245
181 Ga0068862_100275503 3300005844 Bacteria 1540
182 Ga0068862_100900339 3300005844 Unclassified 870
183 Ga0081539_10001477 3300005985 Bacteria 39895
184 Ga0081539_10021633 3300005985 Unclassified 4286
185 Ga0070716_100251145 3300006173 Bacteria 1205
186 Ga0097621_100083064 3300006237 Bacteria 2668
187 Ga0097621_100137838 3300006237 Bacteria 2083
188 Ga0097621_100151578 3300006237 Bacteria 1988
189 Ga0068871_100232134 3300006358 Bacteria 1601
190 Ga0068871_100378083 3300006358 Bacteria 1258
191 Ga0075428_100049734 3300006844 Bacteria 4600
192 Ga0075428_100149792 3300006844 Bacteria 2535
193 Ga0075428_100225700 3300006844 Unclassified 2022
194 Ga0075430_100002209 3300006846 Bacteria 16133
195 Ga0075431_100024420 3300006847 Bacteria 6194
196 Ga0075431_100162453 3300006847 Bacteria 2296
197 Ga0075433_10041008 3300006852 Bacteria 4010
198 Ga0075433_10041932 3300006852 Unclassified 3968
199 Ga0075433_10048514 3300006852 Unclassified 3692
200 Ga0075433_10187618 3300006852 Bacteria 1839
201 Ga0075433_10261547 3300006852 Bacteria 1534
202 Ga0075433_10311668 3300006852 Bacteria 1393
203 Ga0075434_100033691 3300006871 Bacteria 5057
204 Ga0075434_100086393 3300006871 Unclassified 3136
205 Ga0075434_100092880 3300006871 Bacteria 3020
206 Ga0075434_100163810 3300006871 Bacteria 2243
207 Ga0075434_100441520 3300006871 Bacteria 1322
208 Ga0075434_100618301 3300006871 Unclassified 1102
209 Ga0075434_101068296 3300006871 Unclassified 821
210 Ga0075429_100016441 3300006880 Bacteria 6411
211 Ga0075429_100100120 3300006880 Bacteria 2529
212 Ga0075429_100112129 3300006880 Bacteria 2383
213 Ga0068865_100297682 3300006881 Bacteria 1290
214 Ga0097620_100001017 3300006931 Bacteria 28714
215 Ga0097620_100018237 3300006931 Bacteria 7057
216 Ga0097620_100022972 3300006931 Bacteria 6255
217 Ga0097620_100037743 3300006931 Unclassified 4848
218 Ga0097620_100040324 3300006931 Bacteria 4686
219 Ga0097620_100058287 3300006931 Bacteria 3890
220 Ga0097620_100146608 3300006931 Bacteria 2435
221 Ga0097620_100164038 3300006931 Bacteria 2301
222 Ga0097620_100347234 3300006931 Bacteria 1578
223 Ga0097620_100495565 3300006931 Bacteria 1317
224 Ga0075435_100065107 3300007076 Bacteria 2962
225 Ga0099794_10077998 3300007265 Bacteria 1631
226 Ga0105250_10144129 3300009092 Bacteria 988
227 Ga0105240_10026324 3300009093 Bacteria 7631
228 Ga0105240_10648643 3300009093 Unclassified 1157
229 Ga0111539_10008996 3300009094 Bacteria 12641
230 Ga0111539_10130397 3300009094 Unclassified 2944
231 Ga0111539_11171037 3300009094 Unclassified 893
232 Ga0105245_10707266 3300009098 Bacteria 1041
233 Ga0105245_11231044 3300009098 Unclassified 797
234 Ga0105247_10000669 3300009101 Bacteria 27007
235 Ga0105247_10051128 3300009101 Bacteria 2544
236 Ga0105247_10128464 3300009101 Unclassified 1650
237 Ga0105247_10225178 3300009101 Bacteria 1271
238 Ga0114129_10130876 3300009147 Bacteria 3446
239 Ga0114129_10179042 3300009147 Unclassified 2886
240 Ga0114129_10185954 3300009147 Unclassified 2824
241 Ga0114129_10553223 3300009147 Unclassified 1496
242 Ga0105243_10001961 3300009148 Bacteria 17532
243 Ga0105243_10782714 3300009148 Unclassified 938
244 Ga0105243_10938009 3300009148 Unclassified 864
245 Ga0105241_10003083 3300009174 Bacteria 12421
246 Ga0105241_10089516 3300009174 Bacteria 2425
247 Ga0105241_10101361 3300009174 Bacteria 2289
248 Ga0105241_10115801 3300009174 Bacteria 2152
249 Ga0105241_10134195 3300009174 Unclassified 2007
250 Ga0105241_10957817 3300009174 Bacteria 798
251 Ga0105242_10030989 3300009176 Unclassified 4271
252 Ga0105242_10320925 3300009176 Unclassified 1420
253 Ga0105248_10001010 3300009177 Bacteria 31107
254 Ga0105248_10015110 3300009177 Bacteria 8502
255 Ga0105248_10018237 3300009177 Bacteria 7750
256 Ga0105248_10038357 3300009177 Bacteria 5362
257 Ga0105248_10120403 3300009177 Bacteria 2961
258 Ga0105248_10163734 3300009177 Unclassified 2508
259 Ga0105248_10489133 3300009177 Bacteria 1387
260 Ga0105237_10001269 3300009545 Bacteria 33646
261 Ga0105237_10242065 3300009545 Unclassified 1805
262 Ga0105237_10385351 3300009545 Bacteria 1407
263 Ga0105238_10004606 3300009551 Bacteria 13641
264 Ga0105238_10014617 3300009551 Bacteria 7937
265 Ga0105249_10006809 3300009553 Bacteria 9964
266 Ga0105249_10126048 3300009553 Bacteria 2439
267 Ga0105249_10414056 3300009553 Bacteria 1380
268 Ga0105249_10492828 3300009553 Bacteria 1269
269 Ga0105239_10081422 3300010375 Bacteria 3564
270 Ga0105239_10365367 3300010375 Bacteria 1630
271 Ga0105239_10457292 3300010375 Bacteria 1449
272 Ga0105239_10699905 3300010375 Unclassified 1158
273 Ga0105239_10857994 3300010375 Bacteria 1041
274 Ga0105246_10004330 3300011119 Bacteria 8634
275 Ga0105246_10027778 3300011119 Unclassified 3712
276 Ga0105246_10074774 3300011119 Bacteria 2396
277 Ga0105246_10336751 3300011119 Bacteria 1231
278 Ga0157373_10002869 3300013100 Bacteria 13044
279 Ga0157374_10125000 3300013296 Bacteria 2486
280 Ga0157378_10025474 3300013297 Bacteria 5207
281 Ga0157378_10054800 3300013297 Bacteria 3551
282 Ga0157378_10120650 3300013297 Unclassified 2416
283 Ga0157378_10172649 3300013297 Unclassified 2028
284 Ga0157378_10217461 3300013297 Bacteria 1815
285 Ga0157378_10341753 3300013297 Bacteria 1460
286 Ga0157378_10399482 3300013297 Bacteria 1354
287 Ga0157378_10761010 3300013297 Unclassified 992
288 Ga0157378_10814023 3300013297 Bacteria 960
289 Ga0163162_10010664 3300013306 Bacteria 8935
290 Ga0163162_10030380 3300013306 Bacteria 5354
291 Ga0163162_10055977 3300013306 Bacteria 3972
292 Ga0163162_10404042 3300013306 Unclassified 1499
293 Ga0157372_10002165 3300013307 Bacteria 21379
294 Ga0157372_10424665 3300013307 Bacteria 1549
295 Ga0157375_10025254 3300013308 Bacteria 5517
296 Ga0157375_10186679 3300013308 Bacteria 2227
297 Ga0157375_10690106 3300013308 Bacteria 1175
298 Ga0157375_10776505 3300013308 Bacteria 1108
299 Ga0157375_10895063 3300013308 Unclassified 1032
300 Ga0163163_10000504 3300014325 Bacteria 35124
301 Ga0163163_10031295 3300014325 Bacteria 5135
302 Ga0163163_10040671 3300014325 Unclassified 4541
303 Ga0163163_10046843 3300014325 Bacteria 4248
304 Ga0163163_10051243 3300014325 Bacteria 4070
305 Ga0163163_10089702 3300014325 Bacteria 3087
306 Ga0157380_10027980 3300014326 Bacteria 4294
307 Ga0157380_10418566 3300014326 Bacteria 1277
308 Ga0157379_10064014 3300014968 Unclassified 3287
309 Ga0157379_10213839 3300014968 Bacteria 1746
310 Ga0157379_10468854 3300014968 Bacteria 1164
311 Ga0157376_10239874 3300014969 Bacteria 1689
312 Ga0157376_10910196 3300014969 Unclassified 898
313 Ga0163161_10014687 3300017792 Bacteria 5453
314 Ga0207653_10001322 3300025885 Bacteria 8053
315 Ga0207710_10000436 3300025900 Bacteria 27277
316 Ga0207710_10135108 3300025900 Bacteria 1187
317 Ga0207680_10019149 3300025903 Unclassified 3656
318 Ga0207680_10051506 3300025903 Bacteria 2462
319 Ga0207647_10011375 3300025904 Bacteria 6242
320 Ga0207647_10157993 3300025904 Bacteria 1323
321 Ga0207645_10018939 3300025907 Bacteria 4521
322 Ga0207643_10002706 3300025908 Bacteria 9579
323 Ga0207643_10171008 3300025908 Unclassified 1311
324 Ga0207684_10000085 3300025910 Bacteria 175922
325 Ga0207684_10012634 3300025910 Bacteria 7334
326 Ga0207684_10050310 3300025910 Unclassified 3535
327 Ga0207684_10061548 3300025910 Bacteria 3188
328 Ga0207684_10158324 3300025910 Unclassified 1949
329 Ga0207654_10017015 3300025911 Unclassified 3795
330 Ga0207654_10199832 3300025911 Bacteria 1316
331 Ga0207707_10000016 3300025912 Bacteria 256002
332 Ga0207707_10008302 3300025912 Bacteria 9011
333 Ga0207707_10047141 3300025912 Bacteria 3754
334 Ga0207695_10061954 3300025913 Bacteria 3864
335 Ga0207671_10009154 3300025914 Bacteria 8310
336 Ga0207671_10178128 3300025914 Unclassified 1653
337 Ga0207671_10198373 3300025914 Bacteria 1567
338 Ga0207660_10003055 3300025917 Bacteria 10949
339 Ga0207660_10182562 3300025917 Bacteria 1630
340 Ga0207662_10081912 3300025918 Bacteria 1971
341 Ga0207649_10255046 3300025920 Unclassified 1265
342 Ga0207652_10000126 3300025921 Bacteria 82522
343 Ga0207681_10043855 3300025923 Bacteria 2995
344 Ga0207694_10011102 3300025924 Bacteria 6803
345 Ga0207694_10022070 3300025924 Bacteria 4828
346 Ga0207650_10000011 3300025925 Bacteria 450115
347 Ga0207659_10492464 3300025926 Unclassified 1037
348 Ga0207644_10091349 3300025931 Bacteria 2270
349 Ga0207706_10046270 3300025933 Unclassified 3853
350 Ga0207706_10076041 3300025933 Bacteria 2954
351 Ga0207686_10018795 3300025934 Unclassified 3918
352 Ga0207686_10369668 3300025934 Bacteria 1084
353 Ga0207709_10025356 3300025935 Bacteria 3394
354 Ga0207709_10056486 3300025935 Unclassified 2430
355 Ga0207709_10378992 3300025935 Bacteria 1076
356 Ga0207670_10001045 3300025936 Bacteria 14622
357 Ga0207670_10429812 3300025936 Bacteria 1061
358 Ga0207670_10459453 3300025936 Bacteria 1028
359 Ga0207665_10108319 3300025939 Bacteria 1949
360 Ga0207691_10535718 3300025940 Unclassified 993
361 Ga0207711_10025562 3300025941 Bacteria 4952
362 Ga0207711_10045804 3300025941 Unclassified 3737
363 Ga0207711_10051786 3300025941 Unclassified 3517
364 Ga0207711_10096953 3300025941 Bacteria 2603
365 Ga0207711_10130490 3300025941 Bacteria 2253
366 Ga0207711_10174453 3300025941 Unclassified 1952
367 Ga0207711_10711717 3300025941 Unclassified 936
368 Ga0207689_10015608 3300025942 Bacteria 6432
369 Ga0207689_10021145 3300025942 Bacteria 5470
370 Ga0207689_10051679 3300025942 Bacteria 3388
371 Ga0207689_10069593 3300025942 Bacteria 2892
372 Ga0207689_10368178 3300025942 Bacteria 1196
373 Ga0207679_10323278 3300025945 Bacteria 1336
374 Ga0207679_10375356 3300025945 Unclassified 1245
375 Ga0207667_10079314 3300025949 Unclassified 3403
376 Ga0207651_10055523 3300025960 Bacteria 2721
377 Ga0207712_10005413 3300025961 Bacteria 8055
378 Ga0207712_10080257 3300025961 Bacteria 2372
379 Ga0207677_10025346 3300026023 Bacteria 3699
380 Ga0207677_10439118 3300026023 Bacteria 1116
381 Ga0207703_10022898 3300026035 Bacteria 4908
382 Ga0207703_10061913 3300026035 Bacteria 3065
383 Ga0207703_10076098 3300026035 Bacteria 2783
384 Ga0207703_10098197 3300026035 Bacteria 2476
385 Ga0207703_10172648 3300026035 Bacteria 1903
386 Ga0207703_10392319 3300026035 Bacteria 1286
387 Ga0207639_10104011 3300026041 Bacteria 2301
388 Ga0207708_10000091 3300026075 Bacteria 71484
389 Ga0207708_10019718 3300026075 Bacteria 5085
390 Ga0207708_10038637 3300026075 Unclassified 3636
391 Ga0207708_10078831 3300026075 Bacteria 2530
392 Ga0207708_10116150 3300026075 Bacteria 2082
393 Ga0207708_10444038 3300026075 Unclassified 1079
394 Ga0207708_10499147 3300026075 Unclassified 1020
395 Ga0207641_10030380 3300026088 Unclassified 4475
396 Ga0207641_10143347 3300026088 Bacteria 2158
397 Ga0207641_10203523 3300026088 Bacteria 1827
398 Ga0207641_10227338 3300026088 Unclassified 1733
399 Ga0207641_10386452 3300026088 Bacteria 1341
400 Ga0207641_10415341 3300026088 Bacteria 1294
401 Ga0207641_10587105 3300026088 Bacteria 1089
402 Ga0207648_10131705 3300026089 Bacteria 2201
403 Ga0207676_10001966 3300026095 Bacteria 14971
404 Ga0207676_10004849 3300026095 Bacteria 9529
405 Ga0207676_10005374 3300026095 Bacteria 9074
406 Ga0207676_10148912 3300026095 Bacteria 2013
407 Ga0207676_10620593 3300026095 Bacteria 1040
408 Ga0207674_10120681 3300026116 Unclassified 2589
409 Ga0207674_10163563 3300026116 Bacteria 2180
410 Ga0207674_10181600 3300026116 Bacteria 2055
411 Ga0207674_10269201 3300026116 Bacteria 1651
412 Ga0207674_10323393 3300026116 Bacteria 1492
413 Ga0207674_10774149 3300026116 Bacteria 926
414 Ga0207675_100127485 3300026118 Bacteria 2411
415 Ga0207675_100341016 3300026118 Bacteria 1467
416 Ga0207675_100382633 3300026118 Bacteria 1384
417 Ga0207698_10161918 3300026142 Bacteria 1958
418 Ga0207698_10471657 3300026142 Bacteria 1216
419 Ga0207428_10012243 3300027907 Bacteria 7544
420 Ga0268265_10081835 3300028380 Unclassified 2551
421 Ga0268265_10190064 3300028380 Unclassified 1772
422 Ga0268265_10199901 3300028380 Unclassified 1733
423 Ga0268264_10017506 3300028381 Bacteria 5869
424 Ga0268264_10156775 3300028381 Bacteria 2047
425 Ga0268264_10200338 3300028381 Unclassified 1826
426 Ga0268264_10446422 3300028381 Bacteria 1252
427 Ga0307408_100008256 3300031548 Bacteria 6873
428 Ga0307408_100333423 3300031548 Bacteria 1282
429 Ga0307405_10016876 3300031731 Bacteria 3993
430 Ga0307410_10007984 3300031852 Bacteria 5836
431 Ga0307410_10218776 3300031852 Unclassified 1464
432 Ga0307406_10001644 3300031901 Bacteria 12282
433 Ga0307412_10004452 3300031911 Bacteria 7806
434 Ga0307412_10132361 3300031911 Unclassified 1813
435 Ga0307412_10735584 3300031911 Bacteria 850
436 Ga0307409_100126147 3300031995 Bacteria 2178
437 Ga0307416_100021268 3300032002 Unclassified 4653
438 Ga0307416_100081077 3300032002 Bacteria 2742
439 Ga0307416_100191145 3300032002 Bacteria 1931
440 Ga0307414_10000434 3300032004 Bacteria 22181
441 Ga0307411_10141925 3300032005 Unclassified 1772
442 Ga0307415_100001298 3300032126 Bacteria 11800
443 Ga0307415_100149128 3300032126 Bacteria 1797
444 Ga0395901_0432055 3300038443 Unclassified 1349
445 Ga0242422_00315 3300038699 Bacteria 2909
446 Ga0242420_040114 3300038996 Unclassified 892
447 Ga0439458_0005619 3300042157 Bacteria 2816
448 Ga0451576_0644968 3300045051 Unclassified 1113
449 Ga0496104_0206949 3300048907 Unclassified 1874
450 Ga0496104_0511175 3300048907 Unclassified 1112
451 Ga0496107_0147012 3300048910 Bacteria 1743
452 Ga0496108_0062673 3300048911 Bacteria 3131
453 Ga0496108_0495725 3300048911 Unclassified 1067
454 Ga0496110_0238395 3300048913 Bacteria 1655
455 Ga0496112_0163793 3300048915 Unclassified 2190
456 Ga0496112_0193678 3300048915 Bacteria 1994
457 Ga0496112_0466562 3300048915 Bacteria 1200
458 Ga0496112_0472958 3300048915 Bacteria 1190
459 Ga0496114_0020045 3300048917 Bacteria 5425
460 Ga0501292_000964 3300049515 Bacteria 3497
461 Ga0501298_010524 3300049521 Bacteria 1593
462 Ga0501299_016210 3300049522 Bacteria 1317
463 Ga0501033_0506991 3300049570 Unclassified 834
464 Ga0501038_0141930 3300049574 Bacteria 1964
465 Ga0501076_0618892 3300049592 Unclassified 893
466 Ga0501198_003644 3300049649 Bacteria 2112
467 Ga0501198_005046 3300049649 Bacteria 1848
468 Ga0501202_000684 3300049652 Bacteria 5048
469 Ga0501208_011479 3300049655 Bacteria 1278
470 Ga0501209_015635 3300049656 Bacteria 1696
471 Ga0501216_006629 3300049660 Bacteria 1781
472 Ga0501217_000162 3300049661 Bacteria 9452
473 Ga0501217_004614 3300049661 Bacteria 2839
474 Ga0501217_077753 3300049661 Bacteria 914
475 Ga0501223_000552 3300049663 Bacteria 9038
476 Ga0501223_003111 3300049663 Bacteria 3626
477 Ga0501223_005081 3300049663 Bacteria 2782
478 Ga0501224_011952 3300049664 Bacteria 1278
479 Ga0501224_015801 3300049664 Bacteria 1119
480 Ga0501227_000150 3300049665 Bacteria 12977
481 Ga0501227_002908 3300049665 Bacteria 3751
482 Ga0501230_003922 3300049667 Bacteria 2012
483 Ga0501233_002142 3300049668 Bacteria 3450
484 Ga0501233_015375 3300049668 Bacteria 1575
485 Ga0501233_016327 3300049668 Bacteria 1539
486 Ga0501235_009071 3300049669 Bacteria 2172
487 Ga0501235_011372 3300049669 Bacteria 1952
488 Ga0501240_002324 3300049673 Bacteria 2002
489 Ga0501243_006785 3300049675 Unclassified 1740
490 Ga0501243_012203 3300049675 Unclassified 1354
491 Ga0501243_042426 3300049675 Bacteria 802
492 Ga0501250_007405 3300049680 Bacteria 1185
493 Ga0501257_009797 3300049686 Bacteria 2166
494 Ga0501259_010626 3300049688 Bacteria 1507
495 Ga0501261_008650 3300049690 Bacteria 1317
496 Ga0501221_001764 3300049704 Bacteria 3606
497 Ga0501221_017010 3300049704 Bacteria 1383
498 Ga0501225_0049424 3300049705 Unclassified 1169
499 Ga0501234_000222 3300049707 Bacteria 8224
500 Ga0501080_0734137 3300049742 Unclassified 869
501 Ga0501268_005090 3300049765 Bacteria 1875
502 Ga0501273_004795 3300049770 Unclassified 1504
503 Ga0501045_0189301 3300049824 Bacteria 1534
504 Ga0501226_000184 3300049853 Bacteria 10118
505 nmdc:mga05p37_120051_c1 3300050507 Bacteria 3229
506 nmdc:mga05p37_165720_c1 3300050507 Bacteria 2697
507 nmdc:mga05p37_200736_c1 3300050507 Bacteria 2416
508 nmdc:mga05p37_46857_c1 3300050507 Bacteria 5315
509 nmdc:mga05p37_61055_c1 3300050507 Unclassified 4641
510 nmdc:mga05p37_740418_c1 3300050507 Bacteria 1085
511 nmdc:mga09592_36568_c1 3300050508 Bacteria 4113
512 nmdc:mga0qj67_20599_c1 3300050509 Bacteria 5052
513 nmdc:mga06r32_178946_c1 3300050510 Unclassified 2106
514 nmdc:mga06r32_27255_c1 3300050510 Bacteria 5336
515 nmdc:mga08y16_109256_c1 3300050511 Bacteria 2879
516 nmdc:mga08y16_3517_c1 3300050511 Bacteria 16260
517 nmdc:mga08y16_4374_c1 3300050511 Bacteria 14764
518 nmdc:mga0n895_1006996_c1 3300050512 Bacteria 814
519 nmdc:mga0n895_22065_c1 3300050512 Bacteria 5965
520 nmdc:mga0rr50_46783_c1 3300050513 Bacteria 3187
521 nmdc:mga0rr50_525531_c1 3300050513 Bacteria 1007
522 nmdc:mga0a205_167722_c1 3300050515 Unclassified 2091
523 nmdc:mga0a205_188670_c1 3300050515 Bacteria 1954
524 nmdc:mga0a205_215990_c1 3300050515 Bacteria 1805
525 nmdc:mga0a205_224184_c1 3300050515 Unclassified 1765
526 nmdc:mga0a205_225591_c1 3300050515 Unclassified 1758
527 nmdc:mga0a205_43657_c1 3300050515 Bacteria 4322
528 nmdc:mga0a205_504875_c1 3300050515 Unclassified 1066
529 Ga0501084_0049005 3300054114 Bacteria 3536
530 Ga0307405_10129064
531 MRS1b_contig_7375543
532 MBSR1b_contig_10295850
533 CNAas_1000018
534 JGI24751J29686_10000059
535 rootL2_10116429
536 Ga0065714_10006812
537 Ga0065714_10064422
538 Ga0065704_10018941
539 Ga0065704_10117487
540 Ga0065712_10000122
541 Ga0065712_10074709
542 Ga0065712_10191373
543 Ga0065715_10013475
544 Ga0065715_10090240
545 Ga0065715_10091355
546 Ga0065715_10101854
547 Ga0065715_10121141
548 Ga0065715_10141500
549 Ga0065715_10157770
550 Ga0065715_10162151
551 Ga0065715_10272310
552 Ga0065715_10402002
553 Ga0065707_10001885
554 Ga0065707_10103868
555 Ga0070690_100093586
556 Ga0070690_100274880
557 Ga0070670_100000345
558 Ga0070670_100016750
559 Ga0070677_10080916
560 Ga0068869_100070632
561 Ga0068869_100090935
562 Ga0068869_100109042
563 Ga0068869_100112261
564 Ga0070666_10068004
565 Ga0070666_10068728
566 Ga0070680_100001057
567 Ga0070680_100013003
568 Ga0070680_100117691
569 Ga0070682_100016376
570 Ga0070682_100077856
571 Ga0068868_100036080
572 Ga0068868_100326143
573 Ga0070689_100000147
574 Ga0070689_100130009
575 Ga0070692_10002421
576 Ga0070692_10009173
577 Ga0070692_10068064
578 Ga0070692_10255340
579 Ga0070671_100040305
580 Ga0070671_100071898
581 Ga0070673_100104365
582 Ga0070673_100240813
583 Ga0070688_100255851
584 Ga0070659_100028223
585 Ga0070667_100034266
586 Ga0070703_10002834
587 Ga0070701_10061403
588 Ga0070701_10177305
589 Ga0070705_100001165
590 Ga0070705_100183485
591 Ga0070705_100185869
592 Ga0070700_100000065
593 Ga0070700_100039638
594 Ga0070700_100056002
595 Ga0070700_100374888
596 Ga0070700_100451588
597 Ga0070694_100003470
598 Ga0070694_100017600
599 Ga0070694_100038835
600 Ga0070694_100040216
601 Ga0070694_100325920
602 Ga0070708_100001064
603 Ga0070708_100071764
604 Ga0070663_100265333
605 Ga0070662_100030994
606 Ga0070662_100099494
607 Ga0070681_10002114
608 Ga0070681_10020360
609 Ga0068867_100154078
610 Ga0068867_100178988
611 Ga0068867_100840195
612 Ga0070685_10118555
613 Ga0070706_100000661
614 Ga0070706_100001956
615 Ga0070706_100047814
616 Ga0070706_100119892
617 Ga0070698_100026078
618 Ga0070698_100065816
619 Ga0070698_100076242
620 Ga0070698_100112898
621 Ga0070698_100150802
622 Ga0070699_100000632
623 Ga0070699_100001563
624 Ga0070699_100071546
625 Ga0070699_100116474
626 Ga0070699_100161976
627 Ga0070679_100000014
628 Ga0070697_100046066
629 Ga0070697_100075306
630 Ga0070697_100088823
631 Ga0068853_100040905
632 Ga0068853_100248622
633 Ga0068853_100398078
634 Ga0070672_100200563
635 Ga0070672_100432287
636 Ga0070695_100020107
637 Ga0070695_100020633
638 Ga0070695_100043800
639 Ga0070695_100138738
640 Ga0070695_100156594
641 Ga0070695_100266761
642 Ga0070696_100010980
643 Ga0070696_100051337
644 Ga0070696_100223187
645 Ga0070693_100007395
646 Ga0070693_100012624
647 Ga0070693_100014413
648 Ga0070693_100174074
649 Ga0070665_100026290
650 Ga0070704_100030592
651 Ga0070704_100067851
652 Ga0070704_100086072
653 Ga0070704_100157537
654 Ga0070704_100157702
655 Ga0070704_100203562
656 Ga0070704_100303218
657 Ga0068855_100118516
658 Ga0068855_100372649
659 Ga0070664_100307525
660 Ga0070664_100431707
661 Ga0070664_100626771
662 Ga0068857_100073530
663 Ga0068857_100153705
664 Ga0068857_100551757
665 Ga0068854_100306676
666 Ga0068854_100330696
667 Ga0068854_100484311
668 Ga0068854_100598827
669 Ga0070702_100002802
670 Ga0070702_100027608
671 Ga0070702_100158415
672 Ga0070702_100263001
673 Ga0068852_100101515
674 Ga0068852_100208955
675 Ga0068852_100490902
676 Ga0068859_100001017
677 Ga0068859_100018234
678 Ga0068859_100022971
679 Ga0068859_100037744
680 Ga0068859_100040324
681 Ga0068859_100058288
682 Ga0068859_100146609
683 Ga0068859_100164025
684 Ga0068859_100347232
685 Ga0068859_100495541
686 Ga0068864_100007419
687 Ga0068864_100035693
688 Ga0068864_100182248
689 Ga0068864_100234157
690 Ga0068861_100025852
691 Ga0068861_100305869
692 Ga0068870_10134765
693 Ga0068870_10291990
694 Ga0068863_100011034
695 Ga0068863_100170174
696 Ga0068863_100444064
697 Ga0068858_100016911
698 Ga0068858_100144787
699 Ga0068858_100168024
700 Ga0068860_100021443
701 Ga0068860_100026908
702 Ga0068860_100034432
703 Ga0068860_100094987
704 Ga0068860_100416212
705 Ga0068860_100995113
706 Ga0068860_101041691
707 Ga0068862_100071210
708 Ga0068862_100090374
709 Ga0068862_100127886
710 Ga0068862_100275503
711 Ga0068862_100900339
712 Ga0081539_10001477
713 Ga0081539_10021633
714 Ga0070716_100251145
715 Ga0097621_100083064
716 Ga0097621_100137838
717 Ga0097621_100151578
718 Ga0068871_100232134
719 Ga0068871_100378083
720 Ga0075428_100049734
721 Ga0075428_100149792
722 Ga0075428_100225700
723 Ga0075430_100002209
724 Ga0075431_100024420
725 Ga0075431_100162453
726 Ga0075433_10041008
727 Ga0075433_10041932
728 Ga0075433_10048514
729 Ga0075433_10187618
730 Ga0075433_10261547
731 Ga0075433_10311668
732 Ga0075434_100033691
733 Ga0075434_100086393
734 Ga0075434_100092880
735 Ga0075434_100163810
736 Ga0075434_100441520
737 Ga0075434_100618301
738 Ga0075434_101068296
739 Ga0075429_100016441
740 Ga0075429_100100120
741 Ga0075429_100112129
742 Ga0068865_100297682
743 Ga0097620_100001017
744 Ga0097620_100018237
745 Ga0097620_100022972
746 Ga0097620_100037743
747 Ga0097620_100040324
748 Ga0097620_100058287
749 Ga0097620_100146608
750 Ga0097620_100164038
751 Ga0097620_100347234
752 Ga0097620_100495565
753 Ga0075435_100065107
754 Ga0099794_10077998
755 Ga0105250_10144129
756 Ga0105240_10026324
757 Ga0105240_10648643
758 Ga0111539_10008996
759 Ga0111539_10130397
760 Ga0111539_11171037
761 Ga0105245_10707266
762 Ga0105245_11231044
763 Ga0105247_10000669
764 Ga0105247_10051128
765 Ga0105247_10128464
766 Ga0105247_10225178
767 Ga0114129_10130876
768 Ga0114129_10179042
769 Ga0114129_10185954
770 Ga0114129_10553223
771 Ga0105243_10001961
772 Ga0105243_10782714
773 Ga0105243_10938009
774 Ga0105241_10003083
775 Ga0105241_10089516
776 Ga0105241_10101361
777 Ga0105241_10115801
778 Ga0105241_10134195
779 Ga0105241_10957817
780 Ga0105242_10030989
781 Ga0105242_10320925
782 Ga0105248_10001010
783 Ga0105248_10015110
784 Ga0105248_10018237
785 Ga0105248_10038357
786 Ga0105248_10120403
787 Ga0105248_10163734
788 Ga0105248_10489133
789 Ga0105237_10001269
790 Ga0105237_10242065
791 Ga0105237_10385351
792 Ga0105238_10004606
793 Ga0105238_10014617
794 Ga0105249_10006809
795 Ga0105249_10126048
796 Ga0105249_10414056
797 Ga0105249_10492828
798 Ga0105239_10081422
799 Ga0105239_10365367
800 Ga0105239_10457292
801 Ga0105239_10699905
802 Ga0105239_10857994
803 Ga0105246_10004330
804 Ga0105246_10027778
805 Ga0105246_10074774
806 Ga0105246_10336751
807 Ga0157373_10002869
808 Ga0157374_10125000
809 Ga0157378_10025474
810 Ga0157378_10054800
811 Ga0157378_10120650
812 Ga0157378_10172649
813 Ga0157378_10217461
814 Ga0157378_10341753
815 Ga0157378_10399482
816 Ga0157378_10761010
817 Ga0157378_10814023
818 Ga0163162_10010664
819 Ga0163162_10030380
820 Ga0163162_10055977
821 Ga0163162_10404042
822 Ga0157372_10002165
823 Ga0157372_10424665
824 Ga0157375_10025254
825 Ga0157375_10186679
826 Ga0157375_10690106
827 Ga0157375_10776505
828 Ga0157375_10895063
829 Ga0163163_10000504
830 Ga0163163_10031295
831 Ga0163163_10040671
832 Ga0163163_10046843
833 Ga0163163_10051243
834 Ga0163163_10089702
835 Ga0157380_10027980
836 Ga0157380_10418566
837 Ga0157379_10064014
838 Ga0157379_10213839
839 Ga0157379_10468854
840 Ga0157376_10239874
841 Ga0157376_10910196
842 Ga0163161_10014687
843 Ga0207653_10001322
844 Ga0207710_10000436
845 Ga0207710_10135108
846 Ga0207680_10019149
847 Ga0207680_10051506
848 Ga0207647_10011375
849 Ga0207647_10157993
850 Ga0207645_10018939
851 Ga0207643_10002706
852 Ga0207643_10171008
853 Ga0207684_10000085
854 Ga0207684_10012634
855 Ga0207684_10050310
856 Ga0207684_10061548
857 Ga0207684_10158324
858 Ga0207654_10017015
859 Ga0207654_10199832
860 Ga0207707_10000016
861 Ga0207707_10008302
862 Ga0207707_10047141
863 Ga0207695_10061954
864 Ga0207671_10009154
865 Ga0207671_10178128
866 Ga0207671_10198373
867 Ga0207660_10003055
868 Ga0207660_10182562
869 Ga0207662_10081912
870 Ga0207649_10255046
871 Ga0207652_10000126
872 Ga0207681_10043855
873 Ga0207694_10011102
874 Ga0207694_10022070
875 Ga0207650_10000011
876 Ga0207659_10492464
877 Ga0207644_10091349
878 Ga0207706_10046270
879 Ga0207706_10076041
880 Ga0207686_10018795
881 Ga0207686_10369668
882 Ga0207709_10025356
883 Ga0207709_10056486
884 Ga0207709_10378992
885 Ga0207670_10001045
886 Ga0207670_10429812
887 Ga0207670_10459453
888 Ga0207665_10108319
889 Ga0207691_10535718
890 Ga0207711_10025562
891 Ga0207711_10045804
892 Ga0207711_10051786
893 Ga0207711_10096953
894 Ga0207711_10130490
895 Ga0207711_10174453
896 Ga0207711_10711717
897 Ga0207689_10015608
898 Ga0207689_10021145
899 Ga0207689_10051679
900 Ga0207689_10069593
901 Ga0207689_10368178
902 Ga0207679_10323278
903 Ga0207679_10375356
904 Ga0207667_10079314
905 Ga0207651_10055523
906 Ga0207712_10005413
907 Ga0207712_10080257
908 Ga0207677_10025346
909 Ga0207677_10439118
910 Ga0207703_10022898
911 Ga0207703_10061913
912 Ga0207703_10076098
913 Ga0207703_10098197
914 Ga0207703_10172648
915 Ga0207703_10392319
916 Ga0207639_10104011
917 Ga0207708_10000091
918 Ga0207708_10019718
919 Ga0207708_10038637
920 Ga0207708_10078831
921 Ga0207708_10116150
922 Ga0207708_10444038
923 Ga0207708_10499147
924 Ga0207641_10030380
925 Ga0207641_10143347
926 Ga0207641_10203523
927 Ga0207641_10227338
928 Ga0207641_10386452
929 Ga0207641_10415341
930 Ga0207641_10587105
931 Ga0207648_10131705
932 Ga0207676_10001966
933 Ga0207676_10004849
934 Ga0207676_10005374
935 Ga0207676_10148912
936 Ga0207676_10620593
937 Ga0207674_10120681
938 Ga0207674_10163563
939 Ga0207674_10181600
940 Ga0207674_10269201
941 Ga0207674_10323393
942 Ga0207674_10774149
943 Ga0207675_100127485
944 Ga0207675_100341016
945 Ga0207675_100382633
946 Ga0207698_10161918
947 Ga0207698_10471657
948 Ga0207428_10012243
949 Ga0268265_10081835
950 Ga0268265_10190064
951 Ga0268265_10199901
952 Ga0268264_10017506
953 Ga0268264_10156775
954 Ga0268264_10200338
955 Ga0268264_10446422
956 Ga0307408_100008256
957 Ga0307408_100333423
958 Ga0307405_10016876
959 Ga0307410_10007984
960 Ga0307410_10218776
961 Ga0307406_10001644
962 Ga0307412_10004452
963 Ga0307412_10132361
964 Ga0307412_10735584
965 Ga0307409_100126147
966 Ga0307416_100021268
967 Ga0307416_100081077
968 Ga0307416_100191145
969 Ga0307414_10000434
970 Ga0307411_10141925
971 Ga0307415_100001298
972 Ga0307415_100149128
973 Ga0395901_0432055
974 Ga0242422_00315
975 Ga0242420_040114
976 Ga0439458_0005619
977 Ga0451576_0644968
978 Ga0496104_0206949
979 Ga0496104_0511175
980 Ga0496107_0147012
981 Ga0496108_0062673
982 Ga0496108_0495725
983 Ga0496110_0238395
984 Ga0496112_0163793
985 Ga0496112_0193678
986 Ga0496112_0466562
987 Ga0496112_0472958
988 Ga0496114_0020045
989 Ga0501292_000964
990 Ga0501298_010524
991 Ga0501299_016210
992 Ga0501033_0506991
993 Ga0501038_0141930
994 Ga0501076_0618892
995 Ga0501198_003644
996 Ga0501198_005046
997 Ga0501202_000684
998 Ga0501208_011479
999 Ga0501209_015635
1000 Ga0501216_006629
1001 Ga0501217_000162
1002 Ga0501217_004614
1003 Ga0501217_077753
1004 Ga0501223_000552
1005 Ga0501223_003111
1006 Ga0501223_005081
1007 Ga0501224_011952
1008 Ga0501224_015801
1009 Ga0501227_000150
1010 Ga0501227_002908
1011 Ga0501230_003922
1012 Ga0501233_002142
1013 Ga0501233_015375
1014 Ga0501233_016327
1015 Ga0501235_009071
1016 Ga0501235_011372
1017 Ga0501240_002324
1018 Ga0501243_006785
1019 Ga0501243_012203
1020 Ga0501243_042426
1021 Ga0501250_007405
1022 Ga0501257_009797
1023 Ga0501259_010626
1024 Ga0501261_008650
1025 Ga0501221_001764
1026 Ga0501221_017010
1027 Ga0501225_0049424
1028 Ga0501234_000222
1029 Ga0501080_0734137
1030 Ga0501268_005090
1031 Ga0501273_004795
1032 Ga0501045_0189301
1033 Ga0501226_000184
1034 nmdc:mga05p37_120051_c1
1035 nmdc:mga05p37_165720_c1
1036 nmdc:mga05p37_200736_c1
1037 nmdc:mga05p37_46857_c1
1038 nmdc:mga05p37_61055_c1
1039 nmdc:mga05p37_740418_c1
1040 nmdc:mga09592_36568_c1
1041 nmdc:mga0qj67_20599_c1
1042 nmdc:mga06r32_178946_c1
1043 nmdc:mga06r32_27255_c1
1044 nmdc:mga08y16_109256_c1
1045 nmdc:mga08y16_3517_c1
1046 nmdc:mga08y16_4374_c1
1047 nmdc:mga0n895_1006996_c1
1048 nmdc:mga0n895_22065_c1
1049 nmdc:mga0rr50_46783_c1
1050 nmdc:mga0rr50_525531_c1
1051 nmdc:mga0a205_167722_c1
1052 nmdc:mga0a205_188670_c1
1053 nmdc:mga0a205_215990_c1
1054 nmdc:mga0a205_224184_c1
1055 nmdc:mga0a205_225591_c1
1056 nmdc:mga0a205_43657_c1
1057 nmdc:mga0a205_504875_c1
1058 Ga0501084_0049005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04366

Ysc84

Las17-binding protein actin regulator

164

289

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.5011 39 190
4emq-assembly5.cif.gz_E crystal structure of a single mutant of dronpa, the green-on-state pdm1-4 0.4764 62 128
5uc0-assembly1.cif.gz_A crystal structure of beta-barrel-like, uncharacterized protein of cog5400 from brucella abortus 0.4722 64 134
2ddd-assembly1.cif.gz_A unique behavior of a histidine responsible for an engineered green-to-red photoconversion process 0.4719 62 128
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.4582 39 190
ID Description Score Start End Superfamily
5cvmA00 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.5931 64 98 3.90.70.10
3lpsA01 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.5174 60 91 3.30.565.10
af_P9WGK9_1_201_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.4223 2 126 3.30.450.20
af_A4I3V9_12_253_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.3755 60 122 3.30.565.10
af_O77365_153_516_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.3406 98 152 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A2V9SBH3-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8363 29 130 GO:0035091
AF-A0A357F0V9-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.7771 22 233 GO:0035091
AF-A0A2V9Z094-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.7746 35 135 GO:0035091
AF-A0A357F0V9-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.7701 22 233 GO:0035091
AF-A0A7V9UMC8-F1-model_v4 Lipid-binding SYLF domain-containing protein 0.7633 6 234 GO:0035091

Map